SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Concanavalin A-like lectins/glucanases alignments

These alignments are sequences aligned to the 0045782 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1ajka_ n...........................................................................................
d1dypa_ smqppiakpgetwilqakrsdefnvkdatkwnfqtenygvwswknenatvskgklklttkreshqrtfwdgcnqqqvanyplyytsgvaksr
d1gbga_ qtggsfyepfnnyntglwqkadgysngnmfnctwrannvsmtslgemrlsltspsynkfdcgenrsvqtygyglyevnmkpaknv.......
d1mvea_ mvsakdfsgaelytleevqygkfearmkmaaas...........................................................
d1o4ya_ aqdwngipvpanpgngmtwqlqdnvsdsfnytssegnrptaftskwkpsyingwtgpgstifnapqawtngsqlaiqaqpagngksyngiit
d1o4za_ dwkdipvpadagpnmkwefqeisdnfeyeapadnkgseflekwddfyhnawagpgltewkrdrsyvadgelkmwatrkpgsdkinmgcitsk
d1umza_ pvdvafgrnyvptwafdhikyfnggneiqlhldkytgtgfqskgsylfghfsmqmklvpgd...............................
d1upsa1 dfpanpiekagykldfsdefngptldrekwtdyylphwckdpesakanyrfengslveyitedqkpwcpehdgtvrssaimsfdkswihnfs
d3d6ea_ qtggsfyepfnnyntglwqkwafdhvsmtslgemrlsltspsynkfdgggnqsvqtygyglyevnmkpaknv....................
d5ocra_ qqptktsnpndqwtikwsasdefnkndpdwakwiktgnlpntsawkwnnqknvkisngiaeltmrhnanntpdggtyftsgifksyqkftyg


                                              10              20                30                  
                                               |               |                 |                  
d1ajka_ ..............................-TGIVSSFFTYTGP......AHGTQWDEIDI.EFLG.......KDT............TKVQ
d1dypa_ ............atgnygyyearikgastf-PGVSPAFWMYSTIdrsltkEGDVQYSEIDVvELTQksav...RES............DHDL
d1gbga_ ..............................--GIVSSFFTYTGP......TDGTPWDEIDI.EFLG.......KDT............TKVQ
d1mvea_ ..............................--GTVSSMFLYQNGsei...ADGRPWVEVDI.EVLG.......KNP............GSFQ
d1o4ya_ .......sknkiqypvymeikakimdqvla-----NAFWTLTDD......----ETQEIDImEGYG.......SDRggtwfa......QRMH
d1o4za_ .......trvvypvyiearakvmnstlasd-------VWLLSAD......----DTQEIDIlEAYG.......ADYsesagkdhsyfsKKVH
d1umza_ ..............................SAGTVTAFYLSSQN......---SEHDEIDF.EFLGnrt....GQP............YILQ
d1upsa1 gttdnhernewrgyttkygyfeiraklsntGGGGHQAWWMVGMQddtndwFNSKQTGEIDIlETFF.......SKK............DTWR
d3d6ea_ ..............................--GIVSAFYTSTGP......TDGTPWDEIDI.EFLG.......KDT............TKVQ
d5ocra_ ...................yfeakiqgadiGEGVCPSFWLYSDFdysva.NGETVYSEIDVvELQQfdwyeghQ-Ddi..........YDMD


          40                      50        60         70        80                                 
           |                       |         |          |         |                                 
d1ajka_ FNYYTNGVGG..............HEKVISLGFDASKGFHTYAFDW.QPGYIKWYVDGVLKHTATA......N...................
d1dypa_ HNIVVKNGKPtwmrpgsfpqt...NHNGYHLPFDPRNDFHTYGVNV.TKDKITWYVDGEIVGEKDN......L...................
d1gbga_ FNYYTNGVGN..............HEKIVNLGFDAANSYHTYAFDW.QPNSIKWYVDGQLKHTATT......Q...................
d1mvea_ SNIITGKAGAqkt...........SEKHHAVSPAADQAFHTYGLEW.TPNYVRWTVDGQEVRKTEGgqv...S...................
d1o4ya_ LSHHTFIRNPftdyqpmgd.....ATWYYNGGTPWRSAYHRYGCYWkDPFTLEYYIDGVKVRTVTRaeidpnNhlggt..............
d1o4za_ ISHHVFIRDPfqdyqpkd......AGSWFEDGTVWNKEFHRFGVYWrDPWHLEYYIDGVLVRTVSGkdii..Dpkhftnttdpgnteidtrt
d1umza_ TNVFTGGKGD..............REQRIYLWFDPTKEFHYYSVLW.NMYMIVFLVDDVPIRVFKNckdl..Gvkf................
d1upsa1 IAAYGWNDPNfqtswt........ISEDKVPSGDPTSEYHIYAMEW.TPTALKFYYDNELFKVIYG......S...................
d3d6ea_ FNYYTNGVGN..............HEKIVNLGFDAANSYHTYAFDW.QPNSIKWYVDGQLKHTATT......Q...................
d5ocra_ LNLHAVVKENgqgvwkrpkmypqeQLNKWRAPWDPSKDFHIYGCEV.NQNEIIWYVDGVEVARKPN......K...................


        90       100              110                120       130                140       150     
         |         |                |                  |         |                  |         |     
d1ajka_ IPSTPGKIMMNLWNGT.......GVDDWLGSYNG.........ANPLYAEYDWVKYTSNQTGG.........SFFEPFNSYNSGTWE..KAD
d1dypa_ YWHRQMNLTLSQGLRA.......PHTQWKCNQFYpsanksae.GFPTSMEVDYVRTWV-----.........---------------..---
d1gbga_ IPQTPGKIMMNLWNGA.......GVDEWLGSYNG.........VTPLYAHYNWVRYTK-----.........---------------..---
d1mvea_ NLTGTQGLRFNLWSSE.......-SAAWVGQFDEs........KLPLFQFINWVKVYKYTPGQgeggsdftlDWTDNFDTFDGSRWG..KGD
d1o4ya_ GLNQATNIIIDCENQT.......---DWRPAATQeelad....DSKNIFWVDWIRVYKP----.........---------------..---
d1o4za_ GLNKEMDIIINTEDQTwrsspasGLQSNTYTPTDnelsn....IENNTFGVDWIRIYKP----.........---------------..---
d1umza_ PFNQPMKIYSSLWNAD.......---DWATRGG-.........-----------LEKTDWSKA.........PFIASYRSFHIDGCEasVEA
d1upsa1 -PDYEMGTILNI----.......YTDAGSGAHND.........VWPKEWAIDYMRVWKPVDG-.........---------------..---
d3d6ea_ IPQTPGKIYMSLWAGA.......GVDEWLGSYNG.........VTPLYAHYNWVRYTK-----.........---------------..---
d5ocra_ YWHRPMNVTLSLGLRKpfvkff.DNKNNAINPETdakareklsDIPTSMYVDYVRVWEK----.........---------------..---


            160       170       180       190       200       210                            
              |         |         |         |         |         |                            
d1ajka_ GYSNGGVFNCTWRANNVNFTNDGKLKLGLTSSAYNKFDCAEYRSTNIYGYGLYEVSMKPA-k.......................
d1dypa_ -------------------------------------------------------------kv......................
d1gbga_ -------------------------------------------------------------r.......................
d1mvea_ WTFDGNRVDLTDKNIYS--------------------------------------------rdgmlilaltrkgqesfngqvprd
d1o4ya_ -------------------------------------------------------------vav.....................
d1o4za_ -------------------------------------------------------------vek.....................
d1umza_ KFCATQGARWWDQKEFQDLDAFQYRRLSWVRQKYTIYNYCTDRSRYPSMPPECK-------rdrdi...................
d1upsa1 -------------------------------------------------------------yk......................
d3d6ea_ -------------------------------------------------------------r.......................
d5ocra_ -------------------------------------------------------------s.......................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045782 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Streptomyces coelicolor A3(2)
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus albus 7
NoYes   Clostridium lentocellum DSM 5427
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus sp. JS
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus halodurans C-125
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Ignavibacterium album JCM 16511
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Rhodopirellula baltica SH 1
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Saccharophagus degradans 2-40
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Shewanella pealeana ATCC 700345
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Clostridium thermocellum DSM 1313
NoYes   Ruminococcus champanellensis 18P13
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Streptococcus lutetiensis 033
NoYes   Streptococcus suis D9
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Sorangium cellulosum So0157-2
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium tropici CIAT 899
NoYes   Mesorhizobium australicum WSM2073
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]