SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


alpha/beta-Hydrolases alignments

These alignments are sequences aligned to the 0046077 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                 10        20        30        40        50         60        70    
                                  |         |         |         |         |          |         |    
d1c4xa_ ...........tveiie------KRFPSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASNWRPIIPDLAE.NFFVVAPDLIGFGQSEYPET
d1iupa_ ......nleigksilaa------------GVLTNYHDVGEG--QPVILIHGSGPGVSAYANWRLTIPALSK.FYRVIAPDMVGFGFTDRPEN
d1j1ia_ ..............ayv-----ERFVNAGGVETRYLEAGKG--QPVILIHGGGAGAESEGNWRNVIPILAR.HYRVIAMDMLGFGKTAKPDI
d2rhwa1 ltesstskfvkinekgf-----------SDFNIHYNEAGNG--ETVIMLHGGGPGAGGWSNYYRNVGPFVDaGYRVILKDSPGFNKSDAVVM


            80        90       100        110       120       130           140       150       160 
             |         |         |          |         |         |             |         |         | 
d1c4xa_ YPGHIMSWVGMRVEQILGLMNHFGIE.KSHIVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAP....MNARPPELARLLAFYADPRLTPYR
d1iupa_ YNYSKDSW----VDHIIGIMDALEIE.KAHIVGNAFGGGLAIATALRYSERVDRMVLMGAA---....GTRFDVTEGLNAVWGYTPSIENMR
d1j1ia_ -EYTQDRR----IRHLHDFIKAMNFDgKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLV....VEIHEDLRPIINYDFTREGMVHLV
d2rhwa1 DEQRGLVN----ARAVKGLMDALDID.RAHLVGNAMGGATALNFALEYPDRIGKLILMGPGGLGpsmfAPMPMEGIKLLFKLYAEPSYETLK


              170       180       190       200       210        220       230       240       250  
                |         |         |         |         |          |         |         |         |  
d1c4xa_ ELIHSFVYDPENFPGMEEIVKSRFEVANDPEVRRIQEVMFESMKAGMESL.VIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAE
d1iupa_ NLLDIFAYDRSLVT--DELARLRYEASIQPGFQESFSSMFPEPRQRWIDAlASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQ
d1j1ia_ KALTNDGFKID-----DAMINSRYTYATDEATRKAYVATMQWIREQGGL-.FYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSW
d2rhwa1 QMLQVFLYDQSLIT--EELLQGRWEAIQRQPEHLKNFLISAQKAPLST--.WDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDAR


             260       270       280    
               |         |         |    
d1c4xa_ LVVLDRCGHWAQLERWDAMGPMLMEHFR-a..
d1iupa_ LHVFGRCGHWTQIEQTDRFNRLVVEFFN-ea.
d1j1ia_ GYIIPHCGHWAMIEHPEDFANATLSFL--slr
d2rhwa1 LHVFSKCGHWAQWEHADEFNRLVIDFLR-ha.


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046077 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Medicago truncatula - Barrel medic
NoYes   Conexibacter woesei DSM 14684
NoYes   Nakamurella multipartita DSM 44233
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces scabiei 87.22
NoYes   Amycolatopsis mediterranei U32
NoYes   Nocardioides sp. JS614
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Actinoplanes missouriensis 431
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Intrasporangium calvum DSM 43043
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Bacillus sp. 1NLA3E
NoYes   Treponema primitia ZAS-2
NoYes   Geobacillus sp. JF8
NoYes   Arcobacter sp. L
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Methylibium petroleiphilum PM1
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia pickettii 12D
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia vietnamiensis G4
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Comamonas testosteroni CNB-2
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Tistrella mobilis KA081020-065
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylocella silvestris BL2
NoYes   Teredinibacter turnerae T7901
NoYes   Vibrio furnissii NCTC 11218
NoYes   Marinobacter adhaerens HP15
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Serratia sp. ATCC 39006
NoYes   Escherichia blattae DSM 4481
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas sp. VLB120
NoYes   Cycloclasticus sp. P1
NoYes   Streptomyces davawensis JCM 4913
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium diphtheriae HC03
NoYes   Thermus thermophilus JL-18
NoYes   Thermus thermophilus HB8
NoYes   Sulfobacillus acidophilus TPY
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia lata
NoYes   Burkholderia cepacia GG4
NoYes   Alicycliphilus denitrificans BC
NoYes   Vibrio sp. EJY3
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Acinetobacter radioresistens SH164
NoYes   Acinetobacter lwoffii SH145
NoYes   Cycloclasticus zancles 7-ME
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   3_050719R (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]