SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Sialidases alignments

These alignments are sequences aligned to the 0046491 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1e8ua_ g...........................................................................................
d1ms9a2 apgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsr
d1nsca_ epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthyaaqpggyyngtredrnklrhlisvklgkiptve
d1so7a_ lpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdydapthqvqwqaqevvaqarldghrsmnpcplydaqt
d1v3ea_ ithdvgik....................................................................................
d1w0pa3 vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsy
d1w8oa3 geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgigapgpnsilqrrstdggrtwgeqqvvsagqttapikgfsdpsylvdr
d1z4va_ i...........................................................................................
d2aepa1 eyrnwskpqckitgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttlnnrhsndtvhdrtpyrtllmnelgvpfhlgtkqv
d2slia2 genifyagdvtesnyfripslltlstgtvisaadaryggthdskskiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiq
d3sila_ eksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntasdqsfidtaaarstdggktwnkkiaiyndrvnskl
d4cpzb_ epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptve


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 vvdptvivkgnklyvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagvaiva
d1nsca_ nsifhmaawsgsachdgrewtyigvdgpdsnalikikygeaytdtyhsyannilrtqesacn..............................
d1so7a_ gtlflffiaipgqvteqqqlqtranvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvp..........
d1v3ea_ ............................................................................................
d1w0pa3 arwptdaaqngdrikpwmpngifysvydvasgnwqapixvnpgpghgitltrqqnisgsqn...............................
d1w8oa3 etgtifnfhvysqrqgfagsrpgtdpadpnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgeg.....................
d1z4va_ ............................................................................................
d2aepa1 ciawsssschdgkawlhvcvtghdenatasfiydgrlvdsigswskkilrtqesecvcingtctvvmtdgsasgradtkilfieegkivhis
d2slia2 gsasyidpvlledkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgviyndatnqptefrvdgeynly
d3sila_ srvmdptcivaniqgretilvmvgkwnnndktwgayrdkapdtdwdlvlykstddgvtfskvetni..........................
d4cpzb_ nsifhmaawsgsachdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnci............................


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 sngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgps
d1nsca_ ............................................................................................
d1so7a_ ............................................................................................
d1v3ea_ ............................................................................................
d1w0pa3 ............................................................................................
d1w8oa3 ............................................................................................
d1z4va_ ............................................................................................
d2aepa1 plsgsaqhve..................................................................................
d2slia2 qhdtnltckq..................................................................................
d3sila_ ............................................................................................
d4cpzb_ ............................................................................................


                                                         10        20        30               40    
                                                          |         |         |                |    
d1e8ua_ .........................................-APIHDPDFIGGIGKELIVDNASDVTSFYP.......SAFQEHLNFIPAPT
d1ms9a2 pksnqpgsqssftavtiegmrvmlfthplnfkgrwlrdrln------------------------------.......--------------
d1nsca_ .........................................------------------------------.......--------------
d1so7a_ .........................................------------------------------.......--------------
d1v3ea_ .........................................---------------PLNPDDFWRCTSGLPslmktpkIRLMPGPGLLAMPT
d1w0pa3 .........................................------------------------------.......--------------
d1w8oa3 .........................................------------------------------.......--------------
d1z4va_ .........................................----NDNRYINGINQFYF--SIAEGRNLTL.......GPLLNMPSFIPTAT
d2aepa1 .........................................------------------------------.......--------------
d2slia2 .........................................------------------------------.......--------------
d3sila_ .........................................------------------------------.......--------------
d4cpzb_ .........................................------------------------------.......--------------


            50        60        70        80        90       100       110       120       130      
             |         |         |         |         |         |         |         |         |      
d1e8ua_ TGSGCTRIPSFDMSATHYCYTHNVILSGCRDHSHSHQYLALGVLRTTATGRIFFSTLRSISLDDTQNRKSCSVSATPLGCDMLCSKVTETEE
d1ms9a2 --------------------------------------------------------------------------------------------
d1nsca_ --------------------------------------------------------------------------------------------
d1so7a_ ----------------------------------------------------A---------------------------------------
d1v3ea_ TVDGCIRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLNPRISHTFNINDNRKSCSLALLNTDVYQLCSTPKVDER
d1w0pa3 --------------------------------------------------------------------------------------------
d1w8oa3 --------------------------------------------------------------------------------------------
d1z4va_ TPEGCTRIPSFSLTKTHWCYTHNVILNGCQDHVSSNQFVSMGIIEPTSAGFPFFRTLKTLYLSDGVNRKSCSISTVPGGCMMYCFVSTQPER
d2aepa1 ---------------------------------------------------------------------ECSCYPRYPGVRCVCR-------
d2slia2 --------------------------------------------------------------------------------------------
d3sila_ --------------------------------------------------------------------------------------------
d4cpzb_ --------------------------------------------------------------------------------------------


         140       150         160       170       180        190       200       210       220     
           |         |           |         |         |          |         |         |         |     
d1e8ua_ EDYNSAVPTLMAHGRLGFDGQY..HEKDLDVTTLFEDWVANYPGVGGGSFID.GRVWFSVYGGLKPNSPSDTVQEGKYVIYKRYNDTCPDEQ
d1ms9a2 ----------------------..----------------------------.---------------------------------------
d1nsca_ ----------------------..----------------------------.----------------------------------C----
d1so7a_ ----------------------..----------------------------.---------------------------------------
d1v3ea_ SDYASPGIEDIVLDIVNYDGSIstTRFKNNNISFDQPYAALYPSVGPGIYYK.GKIIFLGYGGLEHPIN------------ENVICNTTGCP
d1w0pa3 ----------------------..----------------------------.---------------------------------------
d1w8oa3 ----------------------..------------------------I---.---------------------------------------
d1z4va_ DDYFSAAPPEQRIIIMYYNDTI..VERIINPPGVLDVWATLNPGTGSGVYYL.GWVLFPIYGGVIKGTSLWNNQANKYFIPQMVAALCSQNQ
d2aepa1 ----------------------..----------------------------.---------------------------------------
d2slia2 ----------------------..-------------Y--------------.---------------------------------------
d3sila_ ----------------------..----HDIVTKNGTISAMLGGVGSGLQLNdGKLVFPV--------------------------------
d4cpzb_ ----------------------..----------------------------.------------------------------------G--


          230       240       250       260       270       280       290       300           310   
            |         |         |         |         |         |         |         |             |   
d1e8ua_ DYQIRMAKSSYKPGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSYFSPALLYPMTV....SNKTA
d1ms9a2 -----------------------------------------------------------------------------------....-----
d1nsca_ -----------------------------------------------------------------------------------....-----
d1so7a_ -----------------------------------------------------------------------------------....-----
d1v3ea_ GKTQRDCNQASHSPWFSDRRMVNSIIVVDKGLNSIPKLKVWTISMRQNYWGSEGRLLLLGNKIYIYTRSTSWHSKLQLGIIDI....TDYSD
d1w0pa3 -----------------G-----------------------------------------------------------------....-----
d1w8oa3 -----------------------------------------------------------------------------------....-----
d1z4va_ ATQVQNAKSSYYSSWFGNRMIQSGILACPLRQDLTNECLVLPFSNDQVLMGAEGRLYMYGDSVYYYQRSNSWWPMTMLYKVTItftnGQPSA
d2aepa1 -----------------------------------------------------------------------------------....-----
d2slia2 -----------------------------------------------------------------------------------....-----
d3sila_ -----------------------------------------------------------------------------------....-----
d4cpzb_ -----------------------------------------------------------------------------------....-----


            320       330       340       350           360       370       380       390       400 
              |         |         |         |             |         |         |         |         | 
d1e8ua_ TLHSPYTFNAFTRPGSIPCQASARCPNSCVTGVYTDPYPLIFYR....NHTLRGVFGTMLDSEQARLNPASAVFDSTSRSRITRVSSSSTKA
d1ms9a2 --------------------------------------------....----------------------L---------------------
d1nsca_ --------------------------------------------....--------------------------------------------
d1so7a_ --------------------------------------------....--------------------------------------------
d1v3ea_ IRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTDAYPLN---....-PTGSIVSSVILDSQKSRVNPVITYSTATERVNELAILNRTLSA
d1w0pa3 --------------------------------------------....--------------------------------------------
d1w8oa3 --------------------------------------------....--------------------------------------------
d1z4va_ ISAQNVPTQQVPRPGTGDCSATNRCPGFCLTGVYADAWLLTNPSststFGSEATFTGSYLNTATQRINPTMYIANNTQIISSQQFGSSGQEA
d2aepa1 --------------------------------------------....--------------------------------------------
d2slia2 --------------------------------------------....--------------------------------------------
d3sila_ --------------------------------------------....--------------------------------------------
d4cpzb_ --------------------------------------------....--------------------------------------------


              410       420       430       440                                                     
                |         |         |         |                                                     
d1e8ua_ AYTTSTCFKVVKTNKTYCLSIAEISNTLFGEFRIVPLLVEILK--nd.............................................
d1ms9a2 ---------------------------------------------wltdnqriynvgqvsigdensayssvlykddklyclheinsnevysl
d1nsca_ ---------------------------------------------iggdcylmitdgsasgiskcrflkiregriikeifptgrvehteect
d1so7a_ ---------------------------------------------yayrklhpiqrpipsafcflshdhgrtwarghfvaqdtlecqvaeve
d1v3ea_ GYTTTSCI--THYNKGYCFHIVEINHKSLNTLQPMLFKTEIPKSCs..............................................
d1w0pa3 ---------------------------------------------rliypaivldrfflnvmsiysddggsnwqtgstlpipfrwksssile
d1w8oa3 ---------------------------------------------qlrygphagrliqqytiinaagafqavsvysddhgrtwrageavgvg
d1z4va_ AYGHTTCFRDTGSVMVYCIYIIELSSSLLGQFQIVPFIRQVTL--s..............................................
d2aepa1 ---------------------------------------------dnwkgsnrpivdinvkdysivssyvcsglvgdtprkndssssshcln
d2slia2 ---------------------------------------------dynfsgnnliesktdvdvnmnifyknsvfkafptnylamrysddega
d3sila_ ---------------------------------------------qmvrtknittvlntsfiystdgitwslpsgycegfgsenniiefnas
d4cpzb_ ---------------------------------------------gncylmitdgsasgvsecrflkiregriikeifptgrvkhteectcg


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 vfarlvgelriiksvlqswknwdshlssictpa...........................................................
d1nsca_ cgfasnktiecacrdnsytakrpfvklnvetdtaeirlmctetyldtprpddgsitgpcesngdkgrggikggfvhqrmaskigrwysrtms
d1so7a_ tgeqrvvtlnarshlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgspaqwllythpthswqradlgaylnprppa
d1v3ea_ ............................................................................................
d1w0pa3 tlepseadmvelqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnistgtvdasitrfeqsdgshfllftnpqgn
d1w8oa3 mdenktvelsdgrvllnsrdsarsgyrkvavstdgghsygpvtidrdlpdptnnasiirafpdapagsarakvllfsnaasqtsrsqgtirm
d1z4va_ ............................................................................................
d2aepa1 pnneegghgvkgwafddgndvwmgrtisekfrsgyetfkviegwskpnsklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrk
d2slia2 swsdldivssfkpevskflvvgpgigkqistgenagrllvplyskssaelgfmysddhgdnwtyveadnltggataeaqivempdgslktyl
d3sila_ lvnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaqnknndytrsdislyahnlysgevkliddfyp
d4cpzb_ fasnktiecacrdnsytakrpfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkgsggikggfvhqrmeskigrwysrtmskt


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 ............................................................................................
d1nsca_ ktermgmelyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdggkktwhsaataiyclmgsgqllwdtvtgv
d1so7a_ peawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaey................................
d1v3ea_ ............................................................................................
d1w0pa3 pagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpitllkqklt....................
d1w8oa3 scddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg.......................................
d1z4va_ ............................................................................................
d2aepa1 qetevwwtsnsivvfcgtsgtygtgswpdgadinlmpi......................................................
d2slia2 rtgsnciaevtsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrkngkiwiglvndtgntgidkysvewkysy
d3sila_ kvgnasgagysclsyrknvdketlyvvyeangsiefqdlsrhlpviksyn..........................................
d4cpzb_ ermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggketwhsaataiyclmgsgqllwdtvtgvdm


                                                                 
                                                                 
d1e8ua_ .........................................................
d1ms9a2 .........................................................
d1nsca_ dmal.....................................................
d1so7a_ .........................................................
d1v3ea_ .........................................................
d1w0pa3 .........................................................
d1w8oa3 .........................................................
d1z4va_ .........................................................
d2aepa1 .........................................................
d2slia2 avdtpqmgysysclaelpdgqvgllyekydswsrnelhlkdilkfekysiseltgqa
d3sila_ .........................................................
d4cpzb_ al.......................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046491 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Capitella sp. I
NoYes   Monosiga brevicollis
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Trichomonas vaginalis
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium acnes SK137
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Bifidobacterium bifidum S17
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Actinomyces sp. F0330
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Clostridium perfringens ATCC 13124
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus mitis B6
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus oralis Uo5
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Maribacter sp. HTCC2170
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Brachyspira murdochii DSM 12563
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Vibrio cholerae O395
NoYes   Shewanella pealeana ATCC 700345
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium pseudotuberculosis P54B96
NoYes   Corynebacterium pseudotuberculosis 267
NoYes   Corynebacterium pseudotuberculosis 42/02-A
NoYes   Corynebacterium pseudotuberculosis 3/99-5
NoYes   Corynebacterium pseudotuberculosis PAT10
NoYes   Corynebacterium pseudotuberculosis I19
NoYes   Corynebacterium pseudotuberculosis FRC41
NoYes   Corynebacterium pseudotuberculosis C231
NoYes   Corynebacterium pseudotuberculosis 1002
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium diphtheriae BH8
NoYes   Corynebacterium diphtheriae INCA 402
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae HC02
NoYes   Corynebacterium diphtheriae HC01
NoYes   Corynebacterium diphtheriae 241
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Corynebacterium diphtheriae PW8
NoYes   Corynebacterium diphtheriae C7 (beta)
NoYes   Corynebacterium diphtheriae 31A
NoYes   Gardnerella vaginalis HMP9231
NoYes   Gardnerella vaginalis ATCC 14019
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium bifidum PRL2010
NoYes   Bifidobacterium bifidum BGN4
NoYes   Actinomyces graevenitzii C83
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Streptococcus intermedius B196
NoYes   Streptococcus intermedius C270
NoYes   Streptococcus equi subsp. zooepidemicus ATCC 35246
NoYes   Streptococcus equi subsp. zooepidemicus MGCS10565
NoYes   Streptococcus equi subsp. zooepidemicus
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus pneumoniae A026
NoYes   Streptococcus pneumoniae ST556
NoYes   Streptococcus pneumoniae SPNA45
NoYes   Streptococcus pneumoniae SPN994039
NoYes   Streptococcus pneumoniae SPN994038
NoYes   Streptococcus pneumoniae SPN034183
NoYes   Streptococcus pneumoniae SPN034156
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae OXC141
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669
NoYes   Streptococcus pneumoniae TCH8431/19A
NoYes   Streptococcus pneumoniae CGSP14
NoYes   Streptococcus pneumoniae G54
NoYes   Streptococcus pneumoniae JJA
NoYes   Streptococcus pneumoniae 70585
NoYes   Streptococcus pneumoniae Hungary19A-6
NoYes   Streptococcus pneumoniae Taiwan19F-14
NoYes   Streptococcus pneumoniae D39
NoYes   Streptococcus pneumoniae 670-6B
NoYes   Streptococcus pneumoniae R6
NoYes   Streptococcus pneumoniae TIGR4
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus suis A7
NoYes   Staphylococcus pseudintermedius ED99
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida 36950
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Pasteurella multocida subsp. multocida str. Pm70
NoYes   Haemophilus parasuis ZJ0906
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Combined (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]