SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


PLP-dependent transferases alignments

These alignments are sequences aligned to the 0047670 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                           10        20        30        40        50        60     
                                            |         |         |         |         |         |     
d1js3a_ ...........................MNASDFRRRGKEMVDYMADYLEGIEGRQVYPDVQPGYLRPLIPATAPQEPDTFEDILQDVEKIIM
d1pmma_ kkqvtdlrselldsrfgaksistiaes-------------------------KRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDD


           70        80        90       100       110       120       130       140       150       
            |         |         |         |         |         |         |         |         |       
d1js3a_ PGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGEGGGVIQGSASEATLVALL
d1pmma_ EN----------------------VHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAP----APKNGQAVGTNTIGSSEACMLGGM


        160       170       180       190       200       210        220       230       240       2
          |         |         |         |         |         |          |         |         |        
d1js3a_ AARTKVVRRLQAASPGLTQGAVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPSDG.KFAMRASALQEALERDKAAGLIPFFVVATLGTTSC
d1pmma_ AMKWRWRKRMEAAGKPT------DKPNLVCG-PVQICWHKFARYWDVELREIPMRPgQLFMDPKRMIEACDENT------IGVVPTFGVTYT


        50       260             270       280       290        300       310       320       330   
         |         |               |         |         |          |         |         |         |   
d1js3a_ CSFDNLLEVGPICHEE......DIWLHVDAAYAGSAFICPEFRHLLNG.VEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYL
d1pmma_ GNYEFPQPLHDALDKFqadtgiDIDMHIDAASGGFLAPFVAPDIVWDFrLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELVFNVDYL


            340       350        360       370       380       390       400           410          
              |         |          |         |         |         |         |             |          
d1js3a_ KHSHQGSGLITDYRHWQLPLGRRFR.SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAE..VT..LGLVCFRLKGS...D
d1pmma_ GGQI---------GTFAINFSRPAGqVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTgrPDegIPAVCFKLKDGedpG


        420       430       440          450       460       470            
          |         |         |            |         |         |            
d1js3a_ GLNEALLERINSARKIHLVPCRLRG...QFVLRFAICSRKVESGHVRLAWEHIRGLAAEL--la....
d1pmma_ YTLYDLSERLRLRGWQVPAFTLGGEatdIVVMRIMCR-RGFEMDFAELLLEDYKASLK----ylsdhp


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0047670 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Micromonas sp. RCC299
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Ectocarpus siliculosus
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Fragilariopsis cylindrus
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Cyanothece sp. PCC 8802
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium variabile DSM 44702
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Bifidobacterium dentium Bd1
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Paenibacillus polymyxa M1
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus halodurans C-125
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus megaterium DSM 319
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Maribacter sp. HTCC2170
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Methylacidiphilum infernorum V4
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter felis ATCC 49179
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Methylibium petroleiphilum PM1
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Cupriavidus metallidurans CH34
NoYes   Burkholderia sp. CCGE1002
NoYes   Bordetella avium 197N
NoYes   Bordetella bronchiseptica RB50
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Maricaulis maris MCS10
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella suis ATCC 23445
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio furnissii NCTC 11218
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella woodyi ATCC 51908
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Hahella chejuensis KCTC 2396
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Erwinia billingiae Eb661
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas sp. VLB120
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   halophilic archaeon DL31
NoYes   Methanosaeta concilii GP6
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanobacterium sp. AL-21
NoYes   Natrinema sp. J7-2
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium terpenotabidum Y-11
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecium DO
NoYes   Lactobacillus fermentum F-6
NoYes   Lactobacillus reuteri TD1
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus brevis KB290
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Streptococcus thermophilus ND03
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Staphylococcus epidermidis ATCC 12228
NoYes   Staphylococcus aureus subsp. aureus SA957
NoYes   Staphylococcus aureus subsp. aureus M013
NoYes   Salinibacter ruber DSM 13855
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Alistipes shahii WAL 8301
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Fusobacterium nucleatum subsp. animalis 4_8
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Sorangium cellulosum So0157-2
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia sp. YI23
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Sulfuricella denitrificans skB26
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Sinorhizobium fredii HH103
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium tropici CIAT 899
NoYes   Mesorhizobium australicum WSM2073
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Haemophilus somnus 2336
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Haemophilus influenzae PittGG
NoYes   Haemophilus influenzae 86-028NP
NoYes   Haemophilus influenzae R2846
NoYes   Vibrio fischeri ES114
NoYes   Thioflavicoccus mobilis 8321
NoYes   Coxiella burnetii CbuG_Q212
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Francisella tularensis subsp. holarctica LVS
NoYes   Francisella tularensis subsp. holarctica FSC200
NoYes   Francisella tularensis subsp. tularensis TIGB03
NoYes   Francisella tularensis subsp. tularensis TI0902
NoYes   Francisella tularensis subsp. tularensis NE061598
NoYes   Francisella tularensis subsp. tularensis FSC198
NoYes   Francisella tularensis subsp. tularensis SCHU S4
NoYes   Francisella cf. novicida Fx1
NoYes   Ferroplasma acidarmanus fer1
NoYes   Methanobacterium sp. SWAN-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community ob1 (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]