SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Heme oxygenase-like alignments

These alignments are sequences aligned to the 0048646 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                    10        20         30        40        50        60        70        80       
                     |         |          |         |         |         |         |         |       
d1otva_ litd----TLSPQAFEEALRAKGDFYH.IHHPYHIAMHNGDATRKQIQGWVANRFYYQTTIPLKDAAIMANCPDAQTRRKWVQRILDHDGSH
d1rcwa_ ...n----------FLDQLDLIIQNKHmLEHTFYVKWSKGELTKEQLQAYAKDYYLHIKAFPKYLSAIHSRCDDLEARKLLLDNLMDEEN--


         90       100       110       120       130        140       150       160       170       1
          |         |         |         |         |          |         |         |         |        
d1otva_ GEDGGIEAWLRLGEAVGLSRDDLLSERHVLPGVRFAVDAYLNFA.RRACWQEAACSSLTELFAPQIHQSRLDSWPQHYPWIKEEGYFYFRSR
d1rcwa_ GYPNHIDLWKQFVFALGVTPEELEAHEP-SEAAKAKVATFMRWCtGDSLAAGVAALYSYESQIPRIAREKIRGLTEYFGFSNPEDYAYFTEH


        80       190       200       210       220       230       240       250        
         |         |         |         |         |         |         |         |        
d1otva_ LSQANRDVEHGLALAKAYCDSAEKQNRMLEILQFKLDILWSMLDAMTMAYALQRPPYHTVTDKAAWHTTRLV----lehh
d1rcwa_ EEADVRHAREEKALIEMLLKDDA--DKVLEASQEVTQSLYGFLDSF------------------------------l...


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048646 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Trichodesmium erythraeum IMS101
NoYes   Rivularia sp. PCC 7116
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Methylacidiphilum infernorum V4
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Dechloromonas aromatica RCB
NoYes   Azoarcus sp. KH32C
NoYes   Azoarcus sp. BH72
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Advenella kashmirensis WT001
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Neorickettsia sennetsu str. Miyayama
NoYes   Neorickettsia risticii str. Illinois
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Wolbachia sp. wRi
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Shewanella woodyi ATCC 51908
NoYes   Colwellia psychrerythraea 34H
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Alteromonas sp. SN2
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Frateuria aurantia DSM 6220
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Chthonomonas calidirosea T49
NoYes   Chlamydophila pneumoniae LPCoLN
NoYes   Chlamydophila pneumoniae J138
NoYes   Chlamydophila pneumoniae CWL029
NoYes   Chlamydophila pneumoniae AR39
NoYes   Chlamydia psittaci 01DC12
NoYes   Chlamydia psittaci WC
NoYes   Chlamydia psittaci M56
NoYes   Chlamydia psittaci WS/RT/E30
NoYes   Chlamydia psittaci VS225
NoYes   Chlamydia psittaci MN
NoYes   Chlamydia psittaci GR9
NoYes   Chlamydia psittaci 84/55
NoYes   Chlamydia psittaci 08DC60
NoYes   Chlamydia psittaci 02DC15
NoYes   Chlamydia psittaci C19/98
NoYes   Chlamydia psittaci NJ1
NoYes   Chlamydia psittaci CP3
NoYes   Chlamydophila psittaci RD1
NoYes   Chlamydia psittaci Mat116
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydia trachomatis C/TW-3
NoYes   Chlamydia trachomatis L2/434/Bu(f)
NoYes   Chlamydia trachomatis L2/434/Bu(i)
NoYes   Chlamydia trachomatis IU888
NoYes   Chlamydia trachomatis IU824
NoYes   Chlamydia trachomatis L2b/Canada2
NoYes   Chlamydia trachomatis L2b/Canada1
NoYes   Chlamydia trachomatis L3/404/LN
NoYes   Chlamydia trachomatis L2b/Ams5
NoYes   Chlamydia trachomatis L2b/Ams4
NoYes   Chlamydia trachomatis L2b/Ams3
NoYes   Chlamydia trachomatis L2b/Ams2
NoYes   Chlamydia trachomatis L2b/Ams1
NoYes   Chlamydia trachomatis L2b/795
NoYes   Chlamydia trachomatis L2b/CV204
NoYes   Chlamydia trachomatis L2b/LST
NoYes   Chlamydia trachomatis L2b/UCH-2
NoYes   Chlamydia trachomatis L2b/8200/07
NoYes   Chlamydia trachomatis L2/25667R
NoYes   Chlamydia trachomatis L1/224
NoYes   Chlamydia trachomatis L1/115
NoYes   Chlamydia trachomatis L1/440/LN
NoYes   Chlamydia trachomatis K/SotonK1
NoYes   Chlamydia trachomatis Ia/SotonIa3
NoYes   Chlamydia trachomatis Ia/SotonIa1
NoYes   Chlamydia trachomatis G/SotonG1
NoYes   Chlamydia trachomatis F/SotonF3
NoYes   Chlamydia trachomatis F/SW5
NoYes   Chlamydia trachomatis F/SW4
NoYes   Chlamydia trachomatis E/SotonE8
NoYes   Chlamydia trachomatis E/SotonE4
NoYes   Chlamydia trachomatis E/SW3
NoYes   Chlamydia trachomatis D/SotonD6
NoYes   Chlamydia trachomatis D/SotonD5
NoYes   Chlamydia trachomatis D/SotonD1
NoYes   Chlamydia trachomatis A/5291
NoYes   Chlamydia trachomatis A/363
NoYes   Chlamydia trachomatis RC-J/971
NoYes   Chlamydia trachomatis RC-L2/55
NoYes   Chlamydia trachomatis J/6276tet1
NoYes   Chlamydia trachomatis RC-J/966
NoYes   Chlamydia trachomatis RC-J(s)/122
NoYes   Chlamydia trachomatis RC-F(s)/342
NoYes   Chlamydia trachomatis RC-L2(s)/3
NoYes   Chlamydia trachomatis RC-J/953
NoYes   Chlamydia trachomatis RC-J943
NoYes   Chlamydia trachomatis RC-Fs852
NoYes   Chlamydia trachomatis RC-L2s46
NoYes   Chlamydia trachomatis RC-F69
NoYes   Chlamydia trachomatis L2c
NoYes   Chlamydia trachomatis D-LC
NoYes   Chlamydia trachomatis D-EC
NoYes   Chlamydia trachomatis G/9301
NoYes   Chlamydia trachomatis G/11074
NoYes   Chlamydia trachomatis G/11222
NoYes   Chlamydia trachomatis G/9768
NoYes   Chlamydia trachomatis E/150
NoYes   Chlamydia trachomatis E/11023
NoYes   Chlamydia trachomatis B/TZ1A828/OT
NoYes   Chlamydia trachomatis Sweden2
NoYes   Chlamydia trachomatis E/Bour
NoYes   Chlamydia trachomatis A2497
NoYes   Chlamydia trachomatis A2497
NoYes   Chlamydia trachomatis L2b/UCH-1/proctitis
NoYes   Chlamydia trachomatis 434/Bu
NoYes   Chlamydia trachomatis A/HAR-13
NoYes   Chlamydia trachomatis D/UW-3/CX
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Sorangium cellulosum So0157-2
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Ralstonia pickettii 12J
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Nitrosomonas sp. AL212
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Wolbachia endosymbiont of Drosophila melanogaster
NoYes   Wolbachia endosymbiont of Drosophila simulans wHa
NoYes   Wolbachia endosymbiont of Drosophila simulans wNo
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Mesorhizobium australicum WSM2073
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Rahnella aquatilis HX2
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter genomosp. 13TU RUH2624
NoYes   Acinetobacter sp. SH024
NoYes   Acinetobacter calcoaceticus ruh2202
NoYes   Acinetobacter baumannii ZW85-1
NoYes   Acinetobacter baumannii TYTH-1
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii BJAB0715
NoYes   Acinetobacter baumannii BJAB07104
NoYes   Acinetobacter baumannii TCDC-AB0715
NoYes   Acinetobacter baumannii D1279779
NoYes   Acinetobacter baumannii MDR-TJ
NoYes   Acinetobacter baumannii 1656-2
NoYes   Acinetobacter baumannii ATCC 19606
NoYes   Acinetobacter baumannii AB307-0294
NoYes   Acinetobacter baumannii AYE
NoYes   Acinetobacter baumannii SDF
NoYes   Acinetobacter baumannii MDR-ZJ06
NoYes   Acinetobacter baumannii AB0057
NoYes   Acinetobacter baumannii ACICU
NoYes   Methylophaga sp. JAM7
NoYes   Cycloclasticus zancles 7-ME
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Lotus japonicus
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]