SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

RbsD-like alignments

These alignments are sequences aligned to the 0054354 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                   10        20        30        40        50        60        70   
                                    |         |         |         |         |         |         |   
d2ob5a1                    MLKNIDPALNADVLHALRAMGHGDTLVISDTNFPSDSVARQTTVGKVLHIDNVSAARAMKAILSVLPLDTPLQ
WP_004456284.1.27537:1-144 MLKGVPQILSPELLKVLCEMGHSDKIVIADGNFPTES---MGKECIVVRCDGHGIPELLDAILEVFPLDTYVE


                                80        90       100        110       120       130       140     
                                 |         |         |          |         |         |         |     
d2ob5a1                    PSVGRMEVMGAPDQLEPVQVEVQQEIDAAEGKSAP.MYGIERFAFYEKAKQAYCVITTGETRFYGCFLLTKGV
WP_004456284.1.27537:1-144 NPVNLMEVMKGDNVKTPIWDEYKNIIGKHDDRGSNvISTIERFKFYEEAKKAYAIIATGEKALYANVILQKGV


                              
                              
d2ob5a1                    I-p
WP_004456284.1.27537:1-144 V-.


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0054354 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Daphnia pulex - Common water flea
NoYes   Caenorhabditis japonica
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Glomerella graminicola 22
NoYes   Cyanophora paradoxa
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Corynebacterium glutamicum R
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Arthrobacter arilaitensis Re117
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Actinomyces sp. F0330
NoYes   Anaerolinea thermophila UNI-1
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus proteolyticus MRP
NoYes   Oceanithermus profundus DSM 14977
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Veillonella parvula DSM 2008
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus sp.
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium novyi NT
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus brevis ATCC 367
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Paludibacter propionicigenes WB4
NoYes   Cellulophaga algicola DSM 14237
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema brennaborense DSM 12168
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Collimonas fungivorans Ter331
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Azospirillum sp. B510
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   alpha proteobacterium HIMB59
NoYes   Xanthobacter autotrophicus Py2
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella violacea DSS12
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Marinomonas sp. MWYL1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Frateuria aurantia DSM 6220
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas sp. VLB120
NoYes   Thermogladius cellulolyticus 1633
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium argentoratense DSM 44202
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Gardnerella vaginalis HMP9231
NoYes   Gardnerella vaginalis ATCC 14019
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium breve UCC2003
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Eubacterium siraeum V10Sc8a
NoYes   Clostridium thermocellum DSM 1313
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Thermoanaerobacter sp. X513
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus faecium Aus0085
NoYes   Enterococcus faecium NRRL B-2354
NoYes   Enterococcus faecium DO
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc carnosum JB16
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus LOCK900
NoYes   Lactobacillus rhamnosus ATCC 8530
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus johnsonii N6.2
NoYes   Lactobacillus johnsonii DPC 6026
NoYes   Lactobacillus johnsonii NCC 533
NoYes   Lactobacillus fermentum F-6
NoYes   Lactobacillus reuteri TD1
NoYes   Lactobacillus reuteri I5007
NoYes   Lactobacillus reuteri JCM 1112
NoYes   Lactobacillus reuteri SD2112
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus brevis KB290
NoYes   Lactobacillus acidophilus La-14
NoYes   Lactobacillus acidophilus NCFM
NoYes   Pediococcus pentosaceus SL4
NoYes   Lactococcus garvieae Lg2
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis IO-1
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Lactococcus lactis subsp. cremoris SK11
NoYes   Streptococcus equi subsp. zooepidemicus ATCC 35246
NoYes   Streptococcus equi subsp. zooepidemicus MGCS10565
NoYes   Streptococcus equi subsp. zooepidemicus
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus iniae SF1
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus pneumoniae A026
NoYes   Streptococcus pneumoniae ST556
NoYes   Streptococcus pneumoniae SPNA45
NoYes   Streptococcus pneumoniae SPN034156
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669
NoYes   Streptococcus pneumoniae TCH8431/19A
NoYes   Streptococcus pneumoniae JJA
NoYes   Streptococcus pneumoniae Hungary19A-6
NoYes   Streptococcus pneumoniae Taiwan19F-14
NoYes   Streptococcus pneumoniae D39
NoYes   Streptococcus pneumoniae R6
NoYes   Streptococcus pneumoniae TIGR4
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae SA20-06
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus suis D9
NoYes   Exiguobacterium antarcticum B7
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Bacillus coagulans 36D1
NoYes   Staphylococcus aureus subsp. aureus MSHR1132
NoYes   Staphylococcus pseudintermedius ED99
NoYes   Staphylococcus pasteuri SP1
NoYes   Staphylococcus warneri SG1
NoYes   Staphylococcus epidermidis ATCC 12228
NoYes   Staphylococcus aureus CA-347
NoYes   Staphylococcus aureus Bmb9393
NoYes   Staphylococcus aureus M1
NoYes   Staphylococcus aureus 08BA02176
NoYes   Staphylococcus aureus ST228/18412
NoYes   Staphylococcus aureus ST228/18341
NoYes   Staphylococcus aureus ST228/16125
NoYes   Staphylococcus aureus ST228/16035
NoYes   Staphylococcus aureus ST228/15532
NoYes   Staphylococcus aureus ST228/10497
NoYes   Staphylococcus aureus ST228/10388
NoYes   Staphylococcus aureus 04-02981
NoYes   Staphylococcus aureus RF122
NoYes   Staphylococcus aureus subsp. aureus Z172
NoYes   Staphylococcus aureus subsp. aureus 6850
NoYes   Staphylococcus aureus subsp. aureus SA957
NoYes   Staphylococcus aureus subsp. aureus CN1
NoYes   Staphylococcus aureus subsp. aureus SA40
NoYes   Staphylococcus aureus subsp. aureus 11819-97
NoYes   Staphylococcus aureus subsp. aureus M013
NoYes   Staphylococcus aureus subsp. aureus HO 5096 0412
NoYes   Staphylococcus aureus subsp. aureus VC40
NoYes   Staphylococcus aureus subsp. aureus T0131
NoYes   Staphylococcus aureus subsp. aureus LGA251
NoYes   Staphylococcus aureus subsp. aureus ECT-R 2
NoYes   Staphylococcus aureus subsp. aureus JKD6159
NoYes   Staphylococcus aureus subsp. aureus ED133
NoYes   Staphylococcus aureus subsp. aureus ED98
NoYes   Staphylococcus aureus subsp. aureus TW20
NoYes   Staphylococcus aureus subsp. aureus 55/2053
NoYes   Staphylococcus aureus subsp. aureus TCH60
NoYes   Staphylococcus aureus subsp. aureus str. JKD6008
NoYes   Staphylococcus aureus subsp. aureus 71193
NoYes   Staphylococcus aureus subsp. aureus S0385
NoYes   Staphylococcus aureus subsp. aureus str. Newman
NoYes   Staphylococcus aureus subsp. aureus Mu3
NoYes   Staphylococcus aureus subsp. aureus USA300_TCH1516
NoYes   Staphylococcus aureus subsp. aureus USA300_FPR3757
NoYes   Staphylococcus aureus subsp. aureus JH9
NoYes   Staphylococcus aureus subsp. aureus MSSA476
NoYes   Staphylococcus aureus subsp. aureus MRSA252
NoYes   Staphylococcus aureus subsp. aureus MW2
NoYes   Staphylococcus aureus subsp. aureus N315
NoYes   Staphylococcus aureus subsp. aureus Mu50
NoYes   Staphylococcus aureus subsp. aureus COL
NoYes   Staphylococcus aureus subsp. aureus NCTC 8325
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Brachyspira pilosicoli WesB
NoYes   Brachyspira pilosicoli B2904
NoYes   Brachyspira pilosicoli P43/6/78
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Thermotoga maritima MSB8
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium tropici CIAT 899
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Mesorhizobium australicum WSM2073
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Bibersteinia trehalosi USDA-ARS-USMARC-192
NoYes   Aggregatibacter actinomycetemcomitans ANH9381
NoYes   Aggregatibacter actinomycetemcomitans D11S-1
NoYes   Haemophilus somnus 2336
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida 36950
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Pasteurella multocida subsp. multocida str. Pm70
NoYes   Haemophilus parasuis ZJ0906
NoYes   Haemophilus influenzae KR494
NoYes   Haemophilus influenzae F3047
NoYes   Haemophilus influenzae F3031
NoYes   Haemophilus influenzae 10810
NoYes   Haemophilus influenzae PittGG
NoYes   Haemophilus influenzae 86-028NP
NoYes   Haemophilus influenzae R2866
NoYes   Haemophilus influenzae R2846
NoYes   Haemophilus influenzae Rd KW20
NoYes   Actinobacillus suis H91-0380
NoYes   Actinobacillus pleuropneumoniae serovar 3 str. JL03
NoYes   Actinobacillus pleuropneumoniae serovar 7 str. AP76
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Tarsius syrichta 69_1
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_050719N (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]