SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


SPOC domain-like alignments

These alignments are sequences aligned to the 0039511 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1jeya1 ............................................................................................
d1jeyb1 rhs.........................................................................................
d1ow1a_ pvdmvqllkkypivwqgllalkndtaavqlhfvsgnnvlahrslplseggpplriaqrmrleatqlegvarrmtvetdyclllalpcgrdqe


                10        20         30        40          50         60        70        80        
                 |         |          |         |           |          |         |         |        
d1jeya1 RALSRLKLKLNKDIVISVGIYNLVQKAL.KPPPIKLYRETN..EPVKTKTRTFNTSTGG.LLLPSDTKRSQIYGSRQIILEKEETEELKRFD
d1jeyb1 -IHWPCRLTIGSNLSIRIAAYKSILQERvKKTWTVVDAKTLkkEDIQKETVYCLNDDDEtEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKS
d1ow1a_ ----------------------------.------------..----------------.--------------------------------


         90       100       110        120       130       140       150       160       170       1
          |         |         |          |         |         |         |         |         |        
d1jeya1 D.PGLMLMGFKPLVLLKKHHYLRPS.LFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQEEELDDQKIQVTPPG
d1jeyb1 EgKCFSVLGFCKSSQVQRRFFMGNQvLKVFAARDD-EAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYE--------C
d1ow1a_ -.-----------------------.-------D----------------------------------------------------------


        80       190            200       210                   220       230       240       250   
         |         |              |         |                     |         |         |         |   
d1jeya1 FQLVFLPFADDKRKMPFTEK.....IMATPEQVGKMKAIVEKLRFT............YRSDSFENPVLQQHFRNLEALALDLMEPEQAVDL
d1jeyb1 LVYVQLPFMEDLRQYMFSSLknskkYAPTEAQLNAVDALIDSMSLAkkdektdtledlFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQ
d1ow1a_ --------------------.....---------------------............----------------------------------


            260         270       280                                                               
              |           |         |                                                               
d1jeya1 TLPKVEAMNKRL..GSLVDEFKELVYPPD-y.............................................................
d1jeyb1 HIWNMLNPPAEVttK---------------sqiplskiktlfplieakkk..........................................
d1ow1a_ ------------..----------------vvsqteslkaafitylqakqaagiinvpnpgsnqpayvlqifppcefseshlsrlapdllas


                       
                       
d1jeya1 ...............
d1jeyb1 ...............
d1ow1a_ isnisphlmiviasv


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0039511 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium cellulolyticum H10
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Clostridium sp. BNL1100
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Cyclobacterium marinum DSM 745
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Zunongwangia profunda SM-A87
NoYes   Gramella forsetii KT0803
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Flavobacterium johnsoniae UW101
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Opitutus terrae PB90-1
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter bemidjiensis Bem
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Rubrivivax gelatinosus IL144
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Collimonas fungivorans Ter331
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Tistrella mobilis KA081020-065
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Nitrosococcus halophilus Nc4
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta concilii GP6
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Methanobacterium sp. AL-21
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Sulfobacillus acidophilus TPY
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Thermoanaerobacter sp. X513
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Bacillus coagulans 36D1
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Geobacter sp. M18
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum PSI07
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium tropici CIAT 899
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Mesorhizobium australicum WSM2073
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Coxiella burnetii CbuK_Q154
NoYes   Coxiella burnetii CbuG_Q212
NoYes   Coxiella burnetii RSA 331
NoYes   Coxiella burnetii RSA 493
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Methanobacterium sp. SWAN-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   2_050719S (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]