SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Sema domain alignments

These alignments are sequences aligned to the 0048597 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1olza2                fa...........................................................................
Mpf_ENSMPUP00000018182 nvprl........................................................................
Mpf_ENSMPUP00000018183 niprl........................................................................
Mpf_ENSMPUP00000012998 lrlsfqelqa...................................................................
Mpf_ENSMPUP00000018176 r............................................................................
Mpf_ENSMPUP00000013162 tprv.........................................................................
Mpf_ENSMPUP00000018181 prl..........................................................................
Mpf_ENSMPUP00000008412 pri..........................................................................
Mpf_ENSMPUP00000011272 vssgel.......................................................................
Mpf_ENSMPUP00000015626 risl.........................................................................
Mpf_ENSMPUP00000016665 vprl.........................................................................
Mpf_ENSMPUP00000007141 kyqlpnftaetpiqnvvl...........................................................
Mpf_ENSMPUP00000011078 gne..........................................................................
Mpf_ENSMPUP00000000803 qrh..........................................................................
Mpf_ENSMPUP00000008269 rts..........................................................................
Mpf_ENSMPUP00000005073 rdyln........................................................................
Mpf_ENSMPUP00000016842 rmtip........................................................................
Mpf_ENSMPUP00000004555 lkp..........................................................................
Mpf_ENSMPUP00000004705 h............................................................................
Mpf_ENSMPUP00000011201 keigpw.......................................................................
Mpf_ENSMPUP00000004031 tl...........................................................................
Mpf_ENSMPUP00000004404 vt...........................................................................
Mpf_ENSMPUP00000017253 tf...........................................................................
Mpf_ENSMPUP00000002935 st...........................................................................
Mpf_ENSMPUP00000009553 flvt.........................................................................
Mpf_ENSMPUP00000014827 fa...........................................................................
Mpf_ENSMPUP00000002239 rldvf........................................................................
Mpf_ENSMPUP00000013195 yevpsfsaggp..................................................................
Mpf_ENSMPUP00000017177 v............................................................................
Mpf_ENSMPUP00000008420 hr...........................................................................
Mpf_ENSMPUP00000017130 vaanhpnastvglvlppaagtggsrllvgatytgygsaffprnrsledhrfentpeiairsldargdlaklftfdln
Mpf_ENSMPUP00000007355 riaqsakvlqfqgqaaldcghghpdgrrlllssslvealgvwa..................................


                                    10        20        30        40        50            60        
                                     |         |         |         |         |             |        
d1olza2                .....--PIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKDTLYIGAREAVFAVNALNISEK....QHEVYWKVSE
Mpf_ENSMPUP00000018182 .....--KLSYKEMLESNNVITFNGLANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNI-KD....FQKIVWPVSY
Mpf_ENSMPUP00000018183 .....--KLTYKDLLLSNSCIPFLGSSEGLDFQTILLDEERGRLLVGAKDHIFLLSLIDLNKN....FKKIYWPAAK
Mpf_ENSMPUP00000012998 .....------------RHGLRTFRLERTCCYEALLVDEERGRLFVGAENHVASLSLDNISKR....AKKLAWPAPV
Mpf_ENSMPUP00000018176 .....-VYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGSKDHILSLNINNISQE....PLSVFWPAST
Mpf_ENSMPUP00000013162 .....--RLSFKELKATGTAHFFNFLLNTTDYRILLKDEDHDRMYVGSKDYVLSLDLHDINRE....PLIIHWAASP
Mpf_ENSMPUP00000018181 .....--RLSHKELLDLNRTSIFHSPFGFLDLHAMLLDEYQERLFVGGKDLVYSLSLEQISNG....YQEIHWPSTA
Mpf_ENSMPUP00000008412 .....-------TWEHREVHLEKFHEPGIFNYSVLLLSEDKTTLYVGAREAVFALSAHNVSEK....QHEAYWKVSE
Mpf_ENSMPUP00000011272 .....------------AAVVRRFSQTGIQDFLTLTLTEQTGLLYVGAREALFAFSVEALEL-....QGAISWEAPA
Mpf_ENSMPUP00000015626 .....-------PLGSQDRPFLRFGAENISNYTALLLSRDGKTLYVGAREALFALNSSASFLPgga.YQELSWSADA
Mpf_ENSMPUP00000016665 .....--RLSYRDLLSANRSAVFLGPRGSLDLRAMYLDEYRDRLFLGGRDAIYSLRLDQSWPD....PREVQWPPQP
Mpf_ENSMPUP00000007141 .....----------------------------------HKHHIYLGAVNYIYVLNDKD--LQ....KVAEYKTGPV
Mpf_ENSMPUP00000011078 .....----------------------SQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEIPKTevipSKKLTWRSRQ
Mpf_ENSMPUP00000000803 .....-------------------------RLDIQMIMTMNRTLYVAARDHIYTVDMDTSHTEeiycSKKLTWKSRQ
Mpf_ENSMPUP00000008269 .....------LPISEADSYLTRFTVPQTYNYSVLLVDPASHTLYVGARDTIFALSLPFSGER....PRRIDWMVPE
Mpf_ENSMPUP00000005073 .....-----HYPVFVGSGPGRLTPAEGPDDLHIQRVLRVNRTLFIGDRDNLYRVELEPPTATelryQRKLTWRSNP
Mpf_ENSMPUP00000016842 .....----------YEELSRTRHFKGQAQNYSTLLLEESSARLLVGARGALFSLNARDIGDGa...HKEIRWEASP
Mpf_ENSMPUP00000004555 .....--------------WVFNFTYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSL-....LQATEWASNE
Mpf_ENSMPUP00000004705 .....-------------RALSLFHQKGLQDFDTLLLSDDGGTLYVGAREAILALDIQDPGMPkl..KNMIPWPASD
Mpf_ENSMPUP00000011201 .....---------------LREFRAKNAVDFSQLTFDPGQKELVVGARNYLFRLQLEDLSL-....IQAVEWECDE
Mpf_ENSMPUP00000004031 .....-----------------------------------NRTLLVAARDHVFSFDLQAQEEGtgl.VPNKYLTWRS
Mpf_ENSMPUP00000004404 .....------------------FRGEPAEGFNHLVVDERTGHIYLGAVNRIYKLSSD---LK....VLVTHQTGPD
Mpf_ENSMPUP00000017253 .....--------------------SASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGN---LT....LLRAHVTGPV
Mpf_ENSMPUP00000002935 .....-----------------FHSENRDWTFNHLTVHRGTGAVYVGAINRVYKLTGN---LT....IQVAHKTGPE
Mpf_ENSMPUP00000009553 .....-----------------------DTTLTHLAVHRVTGEVFVGAVNRVFKLAPN---LT....ELRAHVTGPV
Mpf_ENSMPUP00000014827 .....---------------------PNGTHLQHLAQDPTSGTLYLGATNFLFQLSPG---LQ....LEAAVSTGPV
Mpf_ENSMPUP00000002239 .....---------------------RSDTELNHLVVDEASGVLYVGAVNALYQLSAD---LQ....LQQQATTGPA
Mpf_ENSMPUP00000013195 .....-----------------------VQAVTTYEGGEDGSAVFVATRNRLYVLGPG---LE....PVESLATGPI
Mpf_ENSMPUP00000017177 .....-----------------------------LFHEPGSSAVWVGGRGKVYLFDFPEGKNA....SVRTVNIGS-
Mpf_ENSMPUP00000008420 .....-------------------FSAPNTTFNHLALAPGRGTLYVGAVNRLFQLSPE---LR....LQAVAVTGPV
Mpf_ENSMPUP00000017130 psddn----------------------------------------------------------....----------
Mpf_ENSMPUP00000007355 .....----------------------------------------------------------....----------


                       70                   80        90        100       110       120             
                        |                    |         |          |         |         |             
d1olza2                DKK..AKCAEK.........GKSKQTECLNYIRVLQPLS.ATSLYVCGTNAFQPACDHLNLTSFKFL..........
Mpf_ENSMPUP00000018182 TRR..DECKWA.........GKDILKECANFIKVLKAYN.QTHLYACGTGAFHPICTYIEIGHHPEDnifkled...
Mpf_ENSMPUP00000018183 ERV..ELCKLA.........GKDANTECANFIRVLQPYN.KTHLYVCGTGAFHPICGYIDLGVYKEEvifkldt...
Mpf_ENSMPUP00000012998 EWR..EECNWA.........GKDIGTECMNFVKLLHAYN.RTHLLACGTGAFHPTCAFVEVGHRLEEpmlrldl...
Mpf_ENSMPUP00000018176 IKV..EECKMA.........GKDPTHGCGNFVRVIQAFN.RTHLYVCGSGAFSPVCTYLNRGRRSEDqvfmid....
Mpf_ENSMPUP00000013162 QRI..EECVLS.........GKDGNGECGNFVRLIQPWN.RTHLYVCGTGAYNPMCTYVNRGRRAQAtpwtqtqvvr
Mpf_ENSMPUP00000018181 LKI..EECIMK.........GKDAS-ECANYVRVLHHYN.RTHLLTCGTGAFDPLCAFIRVGYHLEDplfhlep...
Mpf_ENSMPUP00000008412 DKK..AKCAEK.........GKSRQTECLNYIRVLQPLG.PGALYVCGTNAFQPACDHLDLTSFRFL..........
Mpf_ENSMPUP00000011272 EKK..AECIQK.........GKSNQTECFNFIRFLQPYN.TSHLYVCGTYAFQPKCTYIDMLTFTLEr.........
Mpf_ENSMPUP00000015626 DRK..QQCSFK.........GKDPQRDCQNYIKILLPLN.TTHLFTCGTAAFSPVCTYISVENFTLAqdemgr....
Mpf_ENSMPUP00000016665 GQK..EECVRK.........GRDPLVECANFVRVLQPHN.RTHLLVCGTGAFQPTCALITVGHRGEHvlhlep....
Mpf_ENSMPUP00000007141 LEH..PDCSPCqdcshkanlSGAVWKDNINMALLIDIYY.DDQLISCGS-VQRGTCQRHVLPRSNTAdiqsevhcmy
Mpf_ENSMPUP00000011078 QDR..ENCAMK.........GKHKD-ECHNFIKVFVPRN.DEMVFVCGTNAFNPMCRYYRLNTLEYD..........
Mpf_ENSMPUP00000000803 ADV..DTCRMK.........GKHKD-ECHNFIKVLLKKN.DDTLFVCGTNAFNPSCRNYKMDTLEPS..........
Mpf_ENSMPUP00000008269 AHR..QNCRKK.........GKKED-ECHNFVQILAIAN.ASHLLTCGTFAFDPKCGVIDVSSFQQV..........
Mpf_ENSMPUP00000005073 SDI..NVCRMK.........GKQEG-ECRNFVKVLLLRD.ESTLFVCGSNAFNPVCANYSMDTLQPL..........
Mpf_ENSMPUP00000016842 EMQ..SKCHQK.........GKNNQTECFNHVRFLQRLN.ATHFYACGTHAFQPLCAAIDAEAFTLP..........
Mpf_ENSMPUP00000004555 DTR..RSCQSK.........GKTEE-ECQNYLRVLIVTG.RK-VFMCGTNAFSPVCSSRQVGNLSRT..........
Mpf_ENSMPUP00000004705 RKK..SECAFK.........KKSNETQCFNFIRVLVSFN.ATHLYTCGTFAFSPACTFIELRDSYLLpise......
Mpf_ENSMPUP00000011201 ATK..KACYSK.........GKSKE-ECQNYIRVLLVGG.DR-LFTCGTNAFTPVCTNRSLNNLTEI..........
Mpf_ENSMPUP00000004031 QDM..ENCAVR.........GKLTD-ECHNYIRVLVPWD.SQTLLACGTNSFSPVCRSYGITSLQQE..........
Mpf_ENSMPUP00000004404 EDN..PKCYPPrivqt....CNEPLTTTNNVNKMLLIDYkENRLIACGS-LYQGICKLLRLEDLFKLge........
Mpf_ENSMPUP00000017253 EDN..EKCYPPpsvqs....CPHGLGSTDNVNKLLLLDYaANRLLACGS-ASQGICQFLRLDDLFKLge........
Mpf_ENSMPUP00000002935 EDN..KSCYPPlivqp....CSEVLTLTNNVNKLLIIDYsENRLLACGS-LYQGVCKLLRLDDLFILve........
Mpf_ENSMPUP00000009553 EDN..ARCYPPpsmra....CAHRLAPADNVNKLLLVDYaARRLVACGS-VWQGVCQFLRLDDLFKLge........
Mpf_ENSMPUP00000014827 LDS..RDCLPPvmpd.....ECPQAQATNNLNQLLLVSP.GA-LVVCGS-VHQGVCELRRLGQLEQLllrp......
Mpf_ENSMPUP00000002239 LDN..KKCTPPieps.....QCHEAVQTDNVNQLLLLDPpGKRLVECGS-LFKGICALRALSNISTRlfye......
Mpf_ENSMPUP00000013195 GDPgcQTCAACgpg......PHGPQGDTDAQVLVLEPAL.PA-LVSCGS-SLHGRCFLHELEPGGTAlhlappiclf
Mpf_ENSMPUP00000017177 ---..---TKG.........SCLDKRDCENYITLLERQG.EG-LLICGTNARRPSCWRLVNGTV---..........
Mpf_ENSMPUP00000008420 FDS..PDCVPFrdpa.....DCPQARLTDNTNQLLLVSGrAQELVACGQ-ARQGVCEKRGLEDVARVlyqa......
Mpf_ENSMPUP00000017130 ---..------.........-------------------.---------------------------..........
Mpf_ENSMPUP00000007355 ---..------.........-------------------.---------------------------..........


                                                       130          140                   150       
                                                         |            |                     |       
d1olza2                ............................GKNEDGKGRCP...FDPAHSYTSVMV.....DG.......ELYSGTSY.
Mpf_ENSMPUP00000018182 ............................SHFENGRGKSP...YDPKLLTASLLI.....DG.......ELYSGTAA.
Mpf_ENSMPUP00000018183 ............................QNLESGRLKCP...FDPQQPFASVMT.....DE.......YLYSGTAS.
Mpf_ENSMPUP00000012998 ............................RRLEDGKGKSP...YDPRHRAASVLV.....GE.......ELYSGVAA.
Mpf_ENSMPUP00000018176 ............................SKCESGKGRCS...FNPNVNTVSVMI.....NE.......ELFSGMYI.
Mpf_ENSMPUP00000013162 grgsratdgalrptptaprqdyifylepERLESGKGKCP...YDPKLDTASALI.....NE.......ELYAGVYI.
Mpf_ENSMPUP00000018181 ............................HRSERGRGRCP...FDPSSSFISTLV.....GS.......ELFTGLYS.
Mpf_ENSMPUP00000008412 ............................GRREDGKGRCP...FDPAQSYTSVMV.....DG.......ELYSGTSY.
Mpf_ENSMPUP00000011272 ............................GEFEDGKGKCP...YDPAKGHTGLLV.....DG.......ELYSATLN.
Mpf_ENSMPUP00000015626 ............................ILLEDGKGRCP...FDPNFKSTALVV.....DS.......ELYTGTVS.
Mpf_ENSMPUP00000016665 ............................SSVESGRGRCP...HEPSSPFASTSV.....GG.......ELYTGLTA.
Mpf_ENSMPUP00000007141 ...........................sPQADEEPGQCPdcvVSA-LGTKVLIS.....EKtrfi...NFFVGNTIn
Mpf_ENSMPUP00000011078 ............................GEEISGLARCP...FDARQTNVALFA.....DG.......KLYSATVA.
Mpf_ENSMPUP00000000803 ............................GDEFSGMARCP...YDAKHANVALFA.....DG.......KLYSATVT.
Mpf_ENSMPUP00000008269 ............................ERLENGRGKCP...FEPAQRSAAVMA.....GG.......VLYAATVK.
Mpf_ENSMPUP00000005073 ............................GDNISGMARCP...YDPKHANVALFS.....EG.......MLFTATVT.
Mpf_ENSMPUP00000016842 ............................ASFEEGKEKCP...YDPARGFTGLII.....DG.......GLYTATRY.
Mpf_ENSMPUP00000004555 ............................IEKINGVARCP...YDPRHNSTAVISs....QG.......ELYAATVI.
Mpf_ENSMPUP00000004705 ............................DKVVEGKGQSP...FDPAHKHTAVLT.....DG.......MLYSGTMN.
Mpf_ENSMPUP00000011201 ............................HDQISGMARCP...YSPQHNSTALLTa....GG.......ELYAATAM.
Mpf_ENSMPUP00000004031 ............................GEELSGQARCP...FDATQSNVAVFA.....EG.......SLYSATAA.
Mpf_ENSMPUP00000004404 ............................PFHKKEHYLSG...VNESGSVFGVIVsysnlDD.......KLFIATAVd
Mpf_ENSMPUP00000017253 ............................PHHRKEHYLSS...VREAGSMAGVLI.....AGppgqgqaKLFVGTPId
Mpf_ENSMPUP00000002935 ............................PSHKKEHYLSS...VNKTGTMYGVIVrsdgeDG.......KLFIGTAVd
Mpf_ENSMPUP00000009553 ............................PHHRKEHYLSG...AQEPDSMAGVIV.....EQdqgps..KLFVGTAVd
Mpf_ENSMPUP00000014827 ............................ERPGDTQYVAA...NDPAVSTVGLVA.....QGlagep..LLFVGRGYt
Mpf_ENSMPUP00000002239 ............................DGSGEKSFVAS...NDERVATVGLVSatsp.GGer.....VLFVGKGN.
Mpf_ENSMPUP00000013195 .........................sahHNQPEECPDCV...ASPLGTVVTVVE.....QGhas....YFYVASSLd
Mpf_ENSMPUP00000017177 ............................ESLGEKRGYAP...FSPDENSLVLFD.....GD.......EVYSTIRKq
Mpf_ENSMPUP00000008420 ............................EDPGDGQFVAA...NAPGVATVGLVVaapg.RD.......LLLVARGLa
Mpf_ENSMPUP00000017130 ............................-----------...------------.....--.......--------.
Mpf_ENSMPUP00000007355 ............................-----------...------------.....--.......--------.


                             160       170                     180        190                   200 
                               |         |                       |          |                     | 
d1olza2                .....NFLGSEPIISRNSS..HS............PLRTEYAIPWLNEPS.FVFADV............IRKSPDSP
Mpf_ENSMPUP00000018182 .....DFMGRDFAIFRTLGhhHP............IRTEQHDSRWLNDPR.FISAHL............IPESD---
Mpf_ENSMPUP00000018183 .....DFLGKDTAFTRSLG..PThdhhy.......IRTDISEHYWLNGAK.FIGTFP............IPDTY---
Mpf_ENSMPUP00000012998 .....DLMGRDFTIFRSLGqrPS............LRTEPHDSRWLNEPK.FVKVFW............IPESE---
Mpf_ENSMPUP00000018176 .....DFMGTDAAIFRSLT..KRna..........VRTDQHNSKWLSEPM.FVDAHV............IPDGT---
Mpf_ENSMPUP00000013162 .....DFMGTDAAIFRTLG..KQta..........MRTDQYNSRWLNDPS.FIHAEL............IPDSA---
Mpf_ENSMPUP00000018181 .....DYWGRDAAVFRSMGrlAH............IRTEHDDERLLKEPK.FVGSYL............IPDNE---
Mpf_ENSMPUP00000008412 .....NFLGSEPIISRNSS..HS............PLRTEYAIPWLNEPS.FVFADV............MRERPDGL
Mpf_ENSMPUP00000011272 .....NFLGTEPVILRNMGp.HH............SMKTEYLAFWLNEPH.FVGSAY............IPESVGSF
Mpf_ENSMPUP00000015626 .....SFQGNDPAISRSQS..LR............PTKTESSLNWLQDPA.FVASAY............IPESLGSL
Mpf_ENSMPUP00000016665 .....DFLGREAMIFRSGGp.RP............ALRSDSDQNLLHDPR.FVMAAR............IADNS---
Mpf_ENSMPUP00000007141 .....SSSHPDHSLHSISV..RR............LKETQDGFKFLTDQS.YIDVLPefrds.......YPIKYVHA
Mpf_ENSMPUP00000011078 .....DFLASDAVIYRSMG..DGsa..........LRTIKYDSKWIKEPH.FLHA--............--------
Mpf_ENSMPUP00000000803 .....DFLAIDAVIYRSLG..DSpt..........LRTVKHDSKWLKEPY.FVQA--............--------
Mpf_ENSMPUP00000008269 .....NYLGTEPIISRAVGrtED............WIRTETLPSWLNAPA.FAAAVA............LSPAEWGD
Mpf_ENSMPUP00000005073 .....DFLAIDAVIYRSLG..DRpt..........LRTVKHDSKWFKEPY.FVHA--............--------
Mpf_ENSMPUP00000016842 .....EFR-SVPDIRRSRHp.HA............LRTEEAPMQWLNDAE.FVFSVL............VRESEASA
Mpf_ENSMPUP00000004555 .....DFSGRDPAIYRSLGsrPP............LRTAQYNSKWLNEPN.FVAA--............--------
Mpf_ENSMPUP00000004705 .....NFLGSEPILIRTLGp.QP............VLKTDNFLRWLQPDAsFVAA--............--------
Mpf_ENSMPUP00000011201 .....DFPGRDPAIYRSLGilPP............LRTAQYNSKWLNEPN.FVSS--............--------
Mpf_ENSMPUP00000004031 .....DFQASDAVVYRSLGpqPP............LRSAKYDSKWLREPH.FVHA--............--------
Mpf_ENSMPUP00000004404 .....GKPEYFPTISSRKL..TK............NSEADGMFAYVFHDE.FVASMIkipsdtftvipdFDIYYVYG
Mpf_ENSMPUP00000017253 .....GKSEYFPTLSSRRLm.ANeedadmfgf...VYQDEFVSSQLKIPS.D----Tlskfpa......FDIYYVYS
Mpf_ENSMPUP00000002935 .....GKQDYFPTLSSRKL..PRdpessa......M------LDYELHSD.FVSSLIkipsdtlalvshFDIFYIYG
Mpf_ENSMPUP00000009553 .....GKSEYFPTLSSRKLi.SD............EDSSDMFSLVYQ-DE.FVSSQIkipsdtlssypaFDIYYIYG
Mpf_ENSMPUP00000014827 ...srGVGGGIPPITTRTL..WP............LDPQTAFSYEETAKL.AVGRLSe...........YSHHFVSA
Mpf_ENSMPUP00000002239 .....GPHDNGIIVSTRLL..DRaegreafeaytdHAAYKAGYLSTNTQQ.FVAA--............--------
Mpf_ENSMPUP00000013195 etvaaSFSPRSVSIRRLKA..DA............SGFAPGFAALSVLPQ.YLAS--............YPIEYVYS
Mpf_ENSMPUP00000017177 .....EYNGKIPRFRRIQG..EI............ELYT--SDTVMQNPQ.FIKATI............VHQD----
Mpf_ENSMPUP00000008420 ....gKLAGGVPPLTVRQL..AG............PQPF---SSEGLGRL.VVGDFSd...........YNNSYVAA
Mpf_ENSMPUP00000017130 .....--------------..--............ILKIKQGAKERHKLG.FVRAFL............HPPDP--P
Mpf_ENSMPUP00000007355 .....--------------..--............---------------.------............--------


                             210             220       230        240         250       260         
                               |               |         |          |           |         |         
d1olza2                DGEDDRVYFFFTEVSVE......YEFVFRVLIPRIARVCKG.DQGG.LRTLQ.KKWTSFLKARLICSRPDS......
Mpf_ENSMPUP00000018182 NPEDDKVYFFFRENAID......GEHTGKATHARIGQICKN.DFGG.HRSLV.NKWTTFLKARLICSVPGPngi...
Mpf_ENSMPUP00000018183 NPDDDKIYFFFRESSQE......GTTSDKTILSRVGRVCKN.DVGG.QRSLI.NKWTTFLKARLVCSIPGNdga...
Mpf_ENSMPUP00000012998 NPDDDKIYFFFRESAVEa.....APALGRLSVSRVGQICRN.DVGG.QRSLV.NKWTTFLKARLVCSVPGAeg....
Mpf_ENSMPUP00000018176 DPNDAKVYFFFKEKLTD......NSRSTKQIHSMIARICPN.DTGG.LRSLV.NKWTTFLKARLVCSVTDEdgp...
Mpf_ENSMPUP00000013162 ERNDDKLYFFFRERSAE......AP-QSPAVYARIGRICLN.DDGG.HCCLV.NKWSTFLKARLVCSVPGEdgi...
Mpf_ENSMPUP00000018181 DRDDNKVYFFFTEKALE......AESNAHAIYARVGRLCVN.DVGG.QRILV.NKFSTILKARLVCSVPGMngi...
Mpf_ENSMPUP00000008412 DSGDDRVYFFFTEVSVE......YEFVFKLMIPRVARVCKG.DQGG.LRTLQ.KKWTSFLKARLICSRPDS......
Mpf_ENSMPUP00000011272 TGDDDKVYFFFSERAVE......YDCYAEQVVARVARVCKG.DMGG.ARTLQ.RKWTTFLKARLVCSAPDW......
Mpf_ENSMPUP00000015626 QGDDDKIYFFFSETGQE......FEFFENTIVSRIARICKG.DEGG.ERVLQ.QRWTSFLKAQLLCSRPED......
Mpf_ENSMPUP00000016665 DQDDDKVYFFFSETVPSp.....DGGPGRVTVSRVGRVCVN.DLGG.QRVLV.SKWSTFLKARLVCSVPGPgga...
Mpf_ENSMPUP00000007141 FESNHFIYFLTVQRETL......D---AQTFHTRVIRFCSV.D---.-----.SGLHSYMEMPLECILTEKrrkrst
Mpf_ENSMPUP00000011078 IEYGNYVYFFFREIAVE......HNNLGKAVYSRVARICKN.DMGGsQRVLE.KHWTSFLKARLNCSVPGDs.....
Mpf_ENSMPUP00000000803 VDYGDYIYFFFREIAVE......YNTMGKVVFPRVAQVCKN.DMGGsQRVLE.KQWTSFLKARLNCSVPGDs.....
Mpf_ENSMPUP00000008269 EDGDDEIYFFFTETSRA......FDSYERIKVPRVARVCAG.DLGG.RKTLQ.HRWTTFLKADLLCPGPEH......
Mpf_ENSMPUP00000005073 VEWASHIYFFFREIAME......FNYLEKVVVSRVARVCKN.DLGGsPRVLE.KQWTSFLKARLNCSVPGDs.....
Mpf_ENSMPUP00000016842 VGDDDKVYYFFTERATDegpssfAQSRNSHRVARVARVCKG.DLGG.KKILQ.KKWTSFLKARLVCHIPQ-......
Mpf_ENSMPUP00000004555 YDIGLFAYFFLRENAVE......HD-CGRTVYSRVARVCKN.DVGG.RFLLE.DTWTTFMKARLNCSRPGEv.....
Mpf_ENSMPUP00000004705 IPSTHFVYFFFEETASE......FEFFEKLHTSRVARVCKN.DVGG.DKLLQ.KKWTTFLKAQLLCSQPG-......
Mpf_ENSMPUP00000011201 YDIGNFTYFFFRENAVE......HD-CGKTVFSRAARVCKN.DIGG.RFLLE.DTWTTFMKARLNCSRPGEv.....
Mpf_ENSMPUP00000004031 LEHGDHVYFFFREVSVE......DARLGRVQFSRVARVCKR.DMGGsPRALD.RHWTSFLKLRLNCSVPGDs.....
Mpf_ENSMPUP00000004404 FSSGNFVYFLTLQPEMVsppg..STTKEQVYTSKLVRLCKE.D---.-----.TAFNSYVEVPIGCERGGV......
Mpf_ENSMPUP00000017253 FRSEQFVYYLTLQLDTQltsp..DAAGEHFFTSKIVRLCVD.D---.-----.PKFYSYVEFPIGCEQAGV......
Mpf_ENSMPUP00000002935 FASGGFVYFLTVQPETPegvai.NSAGDLFYTSRIVRLCQD.D---.-----.PKFHSYVSLPFGCTRAGV......
Mpf_ENSMPUP00000009553 FVSASFVYFLTLQLDTQqtll..DVAGEKFFTSKIVRMCAG.D---.-----.SEFYSYVEFPIGCSWRGV......
Mpf_ENSMPUP00000014827 FARGASAYFLFLRRDLQ......A--QSRAFRAYVSRVCLR.D---.-----.QHYYSYVELPLACQGGR-......
Mpf_ENSMPUP00000002239 FEDGLYVFFVFNQQDKH......P----PRNRTLLARMCKQ.D---.-----.PFYYSYLEMDLECLDPSEpq....
Mpf_ENSMPUP00000013195 FRAGAFVYFLTVQRASV......TA-APGALHTRLARLNAA.E---.-----.PELGDYRELVLDCRFAPKrrrrga
Mpf_ENSMPUP00000017177 QAYDDKIYYFFREDNPD......KNPEAPLNVSRVAQLCRG.DQGG.ESSLSvSKWNTFLKAMLVCSDAST......
Mpf_ENSMPUP00000008420 FADARSAYFVFRRRGAR......A---QAEYRSYVARVCLG.D---.-----.ANLYSYVEVPLACRGQG-......
Mpf_ENSMPUP00000017130 PGAPSYAYLALNSEARA......GD-KESQARSLLARICLPrGAGG.--DAK.KLTESYIQLGLQCAGGAGr.....
Mpf_ENSMPUP00000007355 -----------------......------------------.----.-----.------------------......


                              270         280                290                     300       310  
                                |           |                  |                       |         |  
d1olza2                ...GLVFNVLRDVFVLRSP..GL.........KVPVFYALFT..PQLN............NVGLSAVCAYNLSTAEE
Mpf_ENSMPUP00000018182 ...DTHFDELQDVFLMNSK..DP.........KNPIVYGVFT..TSSN............IFKGSAVCMYSMSDVRR
Mpf_ENSMPUP00000018183 ...DTHFDELQDIYLLPTR..DE.........RNPVVYGVFT..TTSS............IFKGSAVCVYSMADIRA
Mpf_ENSMPUP00000012998 ...DTHFDQLQDVFLLSLR..DR.........WSPLLYAVFS..TSST............VFQGSAVCVYSMNDVRR
Mpf_ENSMPUP00000018176 ...ETHFDELEDVFLLETD..NP.........RTTLVYGIFT..TSSS............VFKGSAVCVYHLSDIQT
Mpf_ENSMPUP00000013162 ...ETHFDELQDVFVQQTQ..DV.........RNPVIYAVFT..SSGS............VFRGSAVCVYSMADIRM
Mpf_ENSMPUP00000018181 ...DTYFDELEDIFLLHTR..DH.........KNPVIFGLFN..TTSN............IFRGHAICVYHMSSIRA
Mpf_ENSMPUP00000008412 ...NLVFNVLQDVFVLRAE..GL.........KEPVIYGVFT..PQLN............NVGLSAVCAYHLSAAEE
Mpf_ENSMPUP00000011272 ...QLYFNQLQALHTLRDA..SW.........HNTTFFGVFR..ARWG............DVDLSAVCEYQLEEIQR
Mpf_ENSMPUP00000015626 ...GFPFNVLQDVFTLSPSpqDW.........RDTLFYGVFT..SQWHrg..........TTEGSAVCVFTMRDVQN
Mpf_ENSMPUP00000016665 ...ETHFDQLEDVFLLWPS..AG.........KNLEVYALFS..TVSA............VFQGFAVCVYHMEDIWE
Mpf_ENSMPUP00000007141 ..rEEVFNILQAAYVGKPG..AHlakqiganlNDDILYGVFA..RSQPdsae........PMNRSAVCAFPIKYVNE
Mpf_ENSMPUP00000011078 ...FFYFDVLQSITDIIQI..NG.........I-PTVVGVFT..TQLN............SIPGSAVCAFSMDDIEK
Mpf_ENSMPUP00000000803 ...HFYFNILQAVTDVIRI..NG.........R-DVVLATFS..TPYN............SIPGSAVCAYDMLDIAN
Mpf_ENSMPUP00000008269 ...GRASSVLQDMAILRPE..HGs........ETPIFYGIFS..SQWE............GAAISAVCAFQPQDIRT
Mpf_ENSMPUP00000005073 ...HFYFNVLQAVTGVVSL..GG.........R-PVVLAVFS..TPSN............SIPGSAVCAFDMTQVAA
Mpf_ENSMPUP00000016842 ...---YELLRAVCSLDAN..AS.........ARTHFYAAFTltTQWK............TLEASAICRYDLAEVQA
Mpf_ENSMPUP00000004555 ...PFYYNELQSAFHLPEQ..D-.........---LIYGVFT..TNVN............SIAASAVCAFNLSAISQ
Mpf_ENSMPUP00000004705 ...QLPFNVIRHAVLLPAA..AS.........AEPLVYATFS..SQWQig..........GTRSSAVCAFALKDIKR
Mpf_ENSMPUP00000011201 ...PFYYNELQSTFFLPEL..D-.........---LIYGIFT..TNVN............SIAASAVCVFNLSAISQ
Mpf_ENSMPUP00000004031 ...TFYFDVLQALTGPVNL..YG.........R-SALFGVFT..TQTN............SIPGSAVCAFYLDDIEH
Mpf_ENSMPUP00000004404 ...E--YRLLQAAYLSKAG..AVlartlgvrpEDDLLFTVFS..KGQKrkmk........SLDESALCIFILKQIND
Mpf_ENSMPUP00000017253 ...E--YRLVQDAYLSRPG..RAlarqlglaeDEDVLFTVFA..QGQKnrvk........PPKESVLCLFTLRAIKE
Mpf_ENSMPUP00000002935 ...E--YRLLQAAYLAKPG..DSlaqafnissHDDVLFAVFS..KGQKqyhh........PPDDSALCAFPIRAINL
Mpf_ENSMPUP00000009553 ...E--YRLVQSAHLAKPG..LLlaqalgvppDEDVLFTVFS..QGQKnras........PPRQTVLCLFTLSTINA
Mpf_ENSMPUP00000014827 ...---YGLLQAAAVATSL..EVa........QGEVLFAAFS..SAAPptvgrppsaaagASGASALCAFPLDEVDR
Mpf_ENSMPUP00000002239 ...TPAFGTCLAASVAGLS..AS.........--RVLYAVFS..RDGRsg..........GGPHAGLCLFPLDEVHA
Mpf_ENSMPUP00000013195 aegGQPYPVLRAAHTAPVG..SRlatelsireGQEVLFGVFR..ARRDsspg........VNPNSVVCAFPIDLVDT
Mpf_ENSMPUP00000017177 ...NKNFNRLQDVFLLPDP..NGqw.......RDTRVYGVFS..NPWN............---YSAVCVYSLGDIDK
Mpf_ENSMPUP00000008420 ...-----LIQAASLTP--..--.........--SALLAAFA..AGPG............-GARPALCAFPLAELDG
Mpf_ENSMPUP00000017130 ...GDLYSRLVSVFPAR--..--.........--ELLFAVFE..RPQGspaa........RATPAALCAFRFADVQA
Mpf_ENSMPUP00000007355 ...----------------..--.........------GVFS..AATGegqerr......SPATTALCLFRMSEIQE


                            320           330        340       350         360           370       3
                              |             |          |         |           |             |        
d1olza2                VFSHGKYMQSTT....VEQSHTKWVRYN.GPVPKPRPGACIDS..EARAANYTSSLNLPDKTL....QFVKDHPLMD
Mpf_ENSMPUP00000018182 VFLGP----YAH....RDGPNYQWVPFQ.GRVPYPRPGTCPSK..--TFGGFDSTKDLPDDVI....TFARSHPAMY
Mpf_ENSMPUP00000018183 VFNGP----YAH....KESADHRWVQYD.GRIPYPRPGTCPSK..-TYDPLIKSTRDFPDDVI....SFIKRHPVMF
Mpf_ENSMPUP00000012998 AFLGP----FAH....KEGPLHQWVSYQ.GRVPYPRPGMCPSK..--TFGTFSSTKDFPDDVI....QFARNHPLMY
Mpf_ENSMPUP00000018176 VFNGP----FAH....KEGPNHQLISYQ.GRIPYPRPGTCPGG..-AFTPNMRTTKEFPDDVV....TFIRNHPLMY
Mpf_ENSMPUP00000013162 VFNGP----FAH....KEGPNYQWMPFS.GKMPYPRPGTCPGG..-TFTPSMKSTKDYPDEVI....NFMRSHPLMY
Mpf_ENSMPUP00000018181 AFNGP----YAH....KEGPEYHWSLYE.GRVPYPRPGSCASK..-VNGGRYGTTKDYPDDAI....RFARSHPLMY
Mpf_ENSMPUP00000008412 VFSRGKYMQSTT....VEQSHTKWVRYN.GAVPTPRPGACITR..EARAANLSSSLSLPDKTL....QFVKDHPLMD
Mpf_ENSMPUP00000011272 VFEGP----YKE....YREQAQKWGRYT.DPIPSPRPGSCINN..WHRRHGYTSSLELPDNTL....NFIKKHPLME
Mpf_ENSMPUP00000015626 AFSGL----YKE....VNRETQQWYTVT.HPVPSPRPGACITN..SARERKIRSSLQLPDRVL....NFLKDHFLMD
Mpf_ENSMPUP00000016665 VFKGP----FAH....QDGPQHQWGPYG.GKVPFPRPGVCPSKmtAQPGRPFGSTKNYPDEVL....QFARAHPLMF
Mpf_ENSMPUP00000007141 FFNKIVN--KNN....VRCLQHFYGPNH.EH--------CFNR..-TLLRNSSGCEVRSDEYR....TEFTTALQRV
Mpf_ENSMPUP00000011078 VFRGR----FKE....QKTPDSVWTAVPeDKVPKPRPGCCAKH..-GLAEAYKTSIDFPDETL....AFIKSHPLMD
Mpf_ENSMPUP00000000803 VFTGR----FKE....QKSPDSTWTPVPdERVPKPRPGCCAGS..-SSLEKYTTSNEFPDDTL....NFIKTHPLMD
Mpf_ENSMPUP00000008269 VLNGS----FREl...KHDCNRGLPVMD.NDVPQPRPGECLTN..NMKLQQFGSSLSLPDRVL....TFIRDHPLMD
Mpf_ENSMPUP00000005073 VFEGR----FRE....QKSPESIWTPVPeDQVPRPRPGCCA--..-APGMQYNASSAFPDEIL....NFVKTHPLMD
Mpf_ENSMPUP00000016842 VFAGP----YME....YQDGARRWGRYE.GGVPEPRPGSCITD..SLRTRGYNSSQDLPSLVL....DFVKLHPLMA
Mpf_ENSMPUP00000004555 AFNGP----FRY....QENPRAAWLPIA.NPIPNFQCGTLPEV..-------GPNENLTERSL....QDAQRLFLMS
Mpf_ENSMPUP00000004705 VFEGK----YKE....LNKETSRWTTYG.VPEISPRPGSCSVG..-----------PSSDKAL....TFMKDHFLMD
Mpf_ENSMPUP00000011201 AFNGP----FKY....QENSRSAWLPYP.NPNPNFQCGTVDQG..--------LYVNLTERNL....QDAQKFILMH
Mpf_ENSMPUP00000004031 GFEGK----FKE....QRSLDGAWTPVSeDRVPSPRPGSCAGV..-GVAALFPSSRDLPDEVL....TFIKAHPLLD
Mpf_ENSMPUP00000004404 RIKERLQSCYRG....EGTLDLAWLKVKdIP--------CSSA..---------LLTIDDNFC....GL--DMNAPL
Mpf_ENSMPUP00000017253 KIKERIQSCYRG....EGKLSLPWLLNK.EL-------GCINS..---------PLQIDDDF-....-CGQDFNQPL
Mpf_ENSMPUP00000002935 QIKERLQSCYQG....EGNLELNWLLGK.DV-------QCTKA..-----------PVPIDDN....FCGLDINQPL
Mpf_ENSMPUP00000009553 HIRRRIQSCYRG....EGTLALPWLLN-.KELPCINTPMQING..----NFCGLVLNQPLGGL....HVIEGLPLLA
Mpf_ENSMPUP00000014827 LANRTRDACYTRegraENDVEVAYIEYD.VN------------..-------SDCAQLPVDTLdaypCGSDHTPSPM
Mpf_ENSMPUP00000002239 KMEASRNTCYTGtr..DVGRDTFYKPFH.GE---IQCGGHGPA..--------ASESFP----....CGSEHLPYPL
Mpf_ENSMPUP00000013195 VIEQGVKRCCESpvpqGMRRGLDFFQSH.SFCPNP-PGQEAPS..-----LNTSCHHFPLLVH....GSLSRVDLFN
Mpf_ENSMPUP00000017177 VFRTSSLKGY--....-----------H.ASLPNPRPGKCLPD..---------RQPIPTDTF....QVADSHPEVA
Mpf_ENSMPUP00000008420 SMERARRLCYTA....-----------G.GRGPSGLEEATVEY..GVTSRCVALPADSPESYP....CGDEHTPSPI
Mpf_ENSMPUP00000017130 AIRAARNACFVEpa..PDVVAVL-----.-------DSVVQGT..GPACERKRNIQLQPEQLD....CGAAHLQHPL
Mpf_ENSMPUP00000007355 RAKS--------....------------.----------CPWD..FQTAEQNCKEGE------....--------QP


                       80       390         400       410       420       430               440     
                        |         |           |         |         |         |                 |     
d1olza2                DSVTPIDNRPRLIKKD..VNYTQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHA........VHIIEETQLFQ
Mpf_ENSMPUP00000018182 NPVFPINNRPIMIKTDvnYQFTQIVVDRVDAEDGQ-YDVMFIGTDVGTVLKVVSIPKEtwhdle..EVLLEEMTVFR
Mpf_ENSMPUP00000018183 KSVYPVAGGPTFKRINvdYRLTQIVVDHVVAEDGQ-YDVMFLGTDIGTVLKVVSISKEkwnme...EVVLEELQVFK
Mpf_ENSMPUP00000012998 NSVLPVGGRPLFLQVGagYTFTQITADRVAAADGH-YDVLFIGTDAGTVLKVISVPKGsrpnge..GLLLEELHVFE
Mpf_ENSMPUP00000018176 NSVYPIHRRPLIVRIGtdYKYTKIAVDRVNAADGR-YHVLFLGTDRGTVQKVVVLPSNssarg...ELILEELEVFK
Mpf_ENSMPUP00000013162 QAVYPLQRRPLVVRTGapYRLTTVAVDQVDAADGR-YEVLFLGTDRGTVQKVIVLPKDdqeme...ELMLEEVEVFK
Mpf_ENSMPUP00000018181 QSIKPAHKKPILVKTDgrYNLKQIAVDRVEAEDGQ-YDVLFIGTDNGIVLKVITIYNQetesme..EVILEELQIFK
Mpf_ENSMPUP00000008412 SSVTPIDNRPRLIRSD..VNYTQVVVDRTWALDGTPYDVMFVGTDQGTLHKAVSLENE........AHIIEETRLFQ
Mpf_ENSMPUP00000011272 EQVRPRWGRPLLVKKD..TNFTHLVADRVTGLDAATYTVLFIGTGDGWLLKAVSLGPW........VHLIEELQMF-
Mpf_ENSMPUP00000015626 GQV---RSHLLLLQPR..ARYQRVAVHRVRGLHHT-YDVLFLGTGDGRLHKAVSVGSR........VHIIEELQIFP
Mpf_ENSMPUP00000016665 WPVRPRRGRPVLVKTHlaQQLHQIVVDRVEAEDGT-YDVIFLGTDSGSVLKVIALQGGgstese..EVVLEELQVFK
Mpf_ENSMPUP00000007141 DLFMG-----------..-QFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGs.......STPHVNFRLDS
Mpf_ENSMPUP00000011078 SAVPPIADEPWFTKTRirYRLTAIAVDHTAGPHQN-YTVIFVGSEAGVVLKVLAKTSPfslnd...SVLLEEIEAYN
Mpf_ENSMPUP00000000803 EAVPSVINRPWFLRTMvrYRLTKIAVDTAAGPYQN-HTVVFLGSEKGIILKFLARVGNsgflnd..SLFLEEMSVYN
Mpf_ENSMPUP00000008269 RPVFPTDDHPLLVTTD..TAYLRVVAHRVTSLSGTEYDVLYLGTEDGHLHRAVRIGAQ........LSVLEDLALFP
Mpf_ENSMPUP00000005073 EAVPSLGHAPWIVRTLmrHQLTRVAVDVGAGPWGN-HTVVFLGSEVGTVLKFLIWPNAstsgttgpSVFLEEFETYR
Mpf_ENSMPUP00000016842 RPVVPTRGRPLLLKRN..VRYTHLTGTPVSTPAGPTYDLLFLGTADGWIHKAVVLGSG........MHIIEETQVFK
Mpf_ENSMPUP00000004555 EAVQPVTPEPCVTQDS..VRFSHLVVDLVQAKDTL-YHVLYIGTESGTILKALSTASRslr.....GCYLEELHVLP
Mpf_ENSMPUP00000004705 EQV---VGTPLLVKSG..VEYTRLAVETAQGADGHSHLVLYLGTTTGAFHKAVVSGDSg.......AHLVEEIQLFL
Mpf_ENSMPUP00000011201 EVVQPVTSVPAFMEDN..SRFSHMAVDVVQGRDML-VHIIYLATDYGTIKKVRAPLAPaag.....SCLLEEIELFP
Mpf_ENSMPUP00000004031 PAVPPATHQPLLTLTSr.ALLTQLAVDGRAGPYRN-TTVLFLGSNDGTVLKVLPPGGPsggre...PILLEEINAYS
Mpf_ENSMPUP00000004404 GVSEMVRGIPVFTEDR..DRMTSVIAYVYKN-----HSLAFVGTKSGKLKKIRVDGPRgn......ALQYETVQVVE
Mpf_ENSMPUP00000017253 GGTVTIEGTPLFVDKD..DGLTAVAAYDYRG-----RTVVFAGTRSGRIRKILVDLANpsgrp...ALAYESVVAQE
Mpf_ENSMPUP00000002935 GGSTPVEGLTLYTTSR..DRMTSVASYVYNG-----YSVVFVGTKSGKLKKIRADGPPhg......GVQYEMVSVLK
Mpf_ENSMPUP00000009553 DSSDGMASVAAYTYR-..------------Q-----HSVVFIGTRTGSLKKVRVDGSQy.......AHLYETVPVVD
Mpf_ENSMPUP00000014827 ASRVPLEATPILEWPG..VQLTAVAVTVEDG-----HTIAFLGDSQGQLHRVYLGPGSd.......GHSYSTQNIQQ
Mpf_ENSMPUP00000002239 GSRDGLTATAVLHRGG..LNLTAVVVTAEHG-----HTVAFLGTSDGRVLKVYLAPDGs.......SAEYGSILVEI
Mpf_ENSMPUP00000013195 GLLG-----------P..VQVTALHVTRLDN-----VTVAHMGTADGRILQVELARSLny......LLYVSNFSL--
Mpf_ENSMPUP00000017177 QRVEPMGPSKAPLFHSk.YHYQKVVVHRMQASRGETFHVLYLTTDRGTIHKVVESREGersl....VFNIMEIQPFH
Mpf_ENSMPUP00000008420 AGRQPLEAKPVLQLEQ..P------ISAVAGLQTDGHTIAFLGDTQGQLHKVFLNGSQ........GQVYHSQQVGP
Mpf_ENSMPUP00000017130 SILQPLKATPVFRAPG..--LSSVAVATVSN-----YTVVFLGTVSGRLLKINLNESM........QVVSRRVVTVA
Mpf_ENSMPUP00000007355 ERVQPIASSTLIHSD-..--LTSVYGTVVMN-----RTVLFLGTGDGQLLKVVLGENLt.......SNCPEVIYEIK


                                         450        460       470               
                                           |          |         |               
d1olza2                D................FEPVQT.LLLSSKKGNRFVYAGSNSGVVQAPL-a......
Mpf_ENSMPUP00000018182 E................PTTISA.MELSTK--QQQLYIGSTTGVAQLPLHrcdiy..
Mpf_ENSMPUP00000018183 H................SSIILN.MELSLK--QQQLYIGSRDGLVQLSLHrcdty..
Mpf_ENSMPUP00000012998 D................SAAITS.MQISSK--RHQLYVASRSAVAQIPLHrcaa...
Mpf_ENSMPUP00000018176 N................HAPITT.MKISSK--KQQLYVSSNEGISQVSLHrchiy..
Mpf_ENSMPUP00000013162 E................PAPVKT.MTISSK--RQQLYVASAVGVTHLSLHrcqay..
Mpf_ENSMPUP00000018181 D................PVPIIS.MEISSK--RQQLYIGSASAVAQVRFHqcdmy..
Mpf_ENSMPUP00000008412 D................LEPVQT.LLLNSQKGRKFVYAGSSSGVVQAPV-.......
Mpf_ENSMPUP00000011272 D................QEPVES.LVLSQS--KKLLFAGSRSQLVQLPLA.......
Mpf_ENSMPUP00000015626 H................GQPVQN.LLLDAD--RGLLYAASYSSVVQVPVA.......
Mpf_ENSMPUP00000016665 V................PTPITE.MEISVK--RQTLYVGSRLGVARLRLHqcety..
Mpf_ENSMPUP00000007141 H................PVSPEA.IVEHPLNQNGYTLVVTGKKITKIPL-.......
Mpf_ENSMPUP00000011078 Hakcnaenee.......DRKVIS.LQLDKD--HHAVYVAFSSCVIRLPL-srcery.
Mpf_ENSMPUP00000000803 Pekcsydgve.......DKRIMG.MQLDKA--SSSLYVAFSTCVIKLPL-grcerh.
Mpf_ENSMPUP00000008269 E................PQPVES.MKLY----QNWLLVGSRTEVTQV---n......
Mpf_ENSMPUP00000005073 PdrcrgqrcgrsgdgeaGRRLLS.LELDTA--SGGLLAAFPRCVVRVPVArcqqy..
Mpf_ENSMPUP00000016842 E................PQSVEN.LVISPV--QHSLYVGAPSGVIQLPL-.......
Mpf_ENSMPUP00000004555 Pgr..............REPLRS.LRILHS--ARALFVGLSDGVLRVPLErcaty..
Mpf_ENSMPUP00000004705 D................PEPVRN.LLLAPE--QGAVFAGFSGGIWRIP--rancsiy
Mpf_ENSMPUP00000011201 Err..............GQPIRS.LQILHS--QSVLFVGLQEHVAKVPL-krcpfy.
Mpf_ENSMPUP00000004031 Psrcsgkraaqm.....ARRVIG.LELDTE--GHRLFVAFSGCIIYLPL-srcarh.
Mpf_ENSMPUP00000004404 P................GPVLRD.MAFSKD--HEQLYIMSERQLTRVPV-.......
Mpf_ENSMPUP00000017253 S................SPILRD.LVLSPD--RQYLYAMTEKQVTRVPV-.......
Mpf_ENSMPUP00000002935 D................GSPILRdMAFSVD--ERYLYIMSERQITRVPV-.......
Mpf_ENSMPUP00000009553 G................SPILRD.LLFSPD--HRHIYLLSEKQVSQLPV-.......
Mpf_ENSMPUP00000014827 G................SAVSKD.LTFDGA--FEHLYVMTQSTLLKVPV-.......
Mpf_ENSMPUP00000002239 N................KRIKRD.LVLSPD--LAFLYTMTQDKVFRFPV-.......
Mpf_ENSMPUP00000013195 -................GCCGQP.MRPDVSRLGDHLFFASGDQVFQVPI-.......
Mpf_ENSMPUP00000017177 H................PAAIQA.MSLDTE--RRKLYVSSQWEVSQVPL-dlcevy.
Mpf_ENSMPUP00000008420 Pg...............SAISPD.LLVDSS--GHHLYVLTAQQVDRVPV-.......
Mpf_ENSMPUP00000017130 Y................GEPVHH.VMQFDPADPGYLYLMTSHQMARVKV-.......
Mpf_ENSMPUP00000007355 E................ETPIFY.KLVPHPKKNIYIYLTAGKEVRRIR--v......


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048597 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Nicotiana benthamiana 0.4.4
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]