SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments in Citrus clementina v165

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1                                 s...........................................................
clementine0.9_001914m|PACid:19256853  lp..........................................................
clementine0.9_001909m|PACid:19286084  l...........................................................
clementine0.9_004125m|PACid:19286945  pie.........................................................
clementine0.9_003435m|PACid:19286944  pie.........................................................
clementine0.9_002376m|PACid:19286943  pie.........................................................
clementine0.9_001661m|PACid:19270051  dfg.........................................................
clementine0.9_000850m|PACid:19262349  lk..........................................................
clementine0.9_004085m|PACid:19265463  p...........................................................
clementine0.9_003726m|PACid:19281738  pt..........................................................
clementine0.9_002618m|PACid:19281737  pt..........................................................
clementine0.9_003300m|PACid:19271042  ak..........................................................
clementine0.9_000984m|PACid:19262959  al..........................................................
clementine0.9_035244m|PACid:19267613  k...........................................................
clementine0.9_002282m|PACid:19280048  h...........................................................
clementine0.9_004233m|PACid:19263869  lp..........................................................
clementine0.9_002323m|PACid:19266460  p...........................................................
clementine0.9_004725m|PACid:19276701  rp..........................................................
clementine0.9_003997m|PACid:19276700  rp..........................................................
clementine0.9_004743m|PACid:19264442  pkln........................................................
clementine0.9_013531m|PACid:19267713  kep.........................................................
clementine0.9_013116m|PACid:19260019  l...........................................................
clementine0.9_009466m|PACid:19277065  e...........................................................
clementine0.9_012013m|PACid:19265318  e...........................................................
clementine0.9_012015m|PACid:19265319  e...........................................................
clementine0.9_012029m|PACid:19265317  e...........................................................
clementine0.9_003806m|PACid:19280466  et..........................................................
clementine0.9_003933m|PACid:19256371  sse.........................................................
clementine0.9_005981m|PACid:19253286  ee..........................................................
clementine0.9_005984m|PACid:19253284  ee..........................................................
clementine0.9_005990m|PACid:19253285  ee..........................................................
clementine0.9_003537m|PACid:19282578  sek.........................................................
clementine0.9_016767m|PACid:19268866  f...........................................................
clementine0.9_033196m|PACid:19265703  l...........................................................
clementine0.9_014050m|PACid:19262961  l...........................................................
clementine0.9_014064m|PACid:19262960  l...........................................................
clementine0.9_018860m|PACid:19272165  ldsqypsfvkpmlqshvtggfwlglpvhfckehlphsdeivtlvdeeenefptkylaekt
clementine0.9_017696m|PACid:19252647  snnplfrvilrpsyvyrtlll.......................................
clementine0.9_018401m|PACid:19252657  psnpfcrvvlrpsylykgcim.......................................
clementine0.9_028607m|PACid:19285595  tpqsflkvvlpstlrdkeiriprtlvrnfghelsdvatimvpngrvwrvklmkdg.....
clementine0.9_020140m|PACid:19274805  gpehptfikpmlqshvtggfwlglpgyfcrrnlpkrdeaitlidedgdeyptvylp....
clementine0.9_014274m|PACid:19252656  psnpfcrvvlrpsylykgcim.......................................
clementine0.9_016992m|PACid:19286493  f...........................................................
clementine0.9_007602m|PACid:19274452  fnscvphfvrimrkfnisgsytlkipykfamahl..........................
clementine0.9_007611m|PACid:19274451  fnscvphfvrimrkfnisgsytlkipykfamahl..........................
clementine0.9_007612m|PACid:19274449  fnscvphfvrimrkfnisgsytlkipykfamahl..........................
clementine0.9_007619m|PACid:19274450  fnscvphfvrimrkfnisgsytlkipykfamahl..........................
clementine0.9_006512m|PACid:19274447  fnscvphfvrimrkfnisgsytlkipykfamahl..........................
clementine0.9_006518m|PACid:19274448  fnscvphfvrimrkfnisgsytlkipykfamahl..........................
clementine0.9_003518m|PACid:19264226  ll..........................................................
clementine0.9_012255m|PACid:19274454  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_012295m|PACid:19274453  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_014026m|PACid:19274455  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_014032m|PACid:19274457  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_014056m|PACid:19274456  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_016720m|PACid:19280007  rppqffkvilppslehkklrippkfvrdfghelsedatlavpngrpwrvrlkrdeggvw.
clementine0.9_007602m|PACid:19274452  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_007611m|PACid:19274451  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_007612m|PACid:19274449  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_007619m|PACid:19274450  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_006512m|PACid:19274447  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_006518m|PACid:19274448  fpyfvrkmkrfnvsgsytlnipyqfsmahlpnfk..........................
clementine0.9_010284m|PACid:19271821  psypsfwkamvksnv.............................................
clementine0.9_009752m|PACid:19271820  psypsfwkamvksnv.............................................
clementine0.9_015967m|PACid:19252664  ipgffkvylpekssnrlh..........................................
clementine0.9_004348m|PACid:19280049  s...........................................................
clementine0.9_013286m|PACid:19284500  lepqfpsfaksmvrshvascfwmglpgyfckshlpdkdtsvvledesgiqytakyfaekt
clementine0.9_016234m|PACid:19278176  vssphffkiifpfvlaekklriprdfvkkfghelsngaqltvpdgsvwq...........
clementine0.9_009940m|PACid:19284499  lepqfpsfaksmvrshvascfwmglpgyfckshlpdkdtsvvledesgiqytakyfaekt
clementine0.9_013062m|PACid:19272231  ldpqfpsfikfmlrshvtggfwlglsrkfctdnlpkqdtmivledesgseydtkylveki
clementine0.9_007642m|PACid:19284498  lepqfpsfaksmvrshvascfwmglpgyfckshlpdkdtsvvledesgiqytakyfaekt
clementine0.9_023572m|PACid:19252684  epfrffkiieetlqdkklripvdfvkkfgdelcdvatlrvpngcvwkvg...........
clementine0.9_003491m|PACid:19264225  ll..........................................................
clementine0.9_018346m|PACid:19252641  epfrffrvilpsileqkklkipkafvgrfgyeelssdatlktpngcvwqvgvtkdk....
clementine0.9_014623m|PACid:19252640  epfrffrvilpsileqkklkipkafvgrfgyeelssdatlktpngcvwqvgvtkdk....
clementine0.9_015782m|PACid:19252711  ffkriprkfvkrfgdelsavatlnvpngrvwqvglrkdgrkiwlqd..............
clementine0.9_014503m|PACid:19252671  mkktyphfidvildstiedkkmkipqnfvgrfgdelsnvatltnpegyvmrvgitrkdgn
clementine0.9_014528m|PACid:19252673  mkktyphfidvildstiedkkmkipqnfvgrfgdelsnvatltnpegyvmrvgitrkdgn
clementine0.9_014540m|PACid:19252672  mkktyphfidvildstiedkkmkipqnfvgrfgdelsnvatltnpegyvmrvgitrkdgn
clementine0.9_007623m|PACid:19284497  lepqfpsfaksmvrshvascfwmglpgyfckshlpdkdtsvvledesgiqytakyfaekt
clementine0.9_004067m|PACid:19278806  vp..........................................................
clementine0.9_016578m|PACid:19285015  pknphfvsvfsqysryavnvsvrvvrshgiklepe.........................
clementine0.9_001957m|PACid:19278805  vp..........................................................
clementine0.9_014274m|PACid:19252656  rpyfhklilastirdkrlripenfvrnfkddlsaaatlivpngmvsrvglrrl.......
clementine0.9_012751m|PACid:19252655  rpyfhklilastirdkrlripenfvrnfkddlsaaatlivpngmvsrvglrrl.......
clementine0.9_017552m|PACid:19252663  cifyklivpsilhdkklripnkfvkkfgdelstvakltipsgrlwlvelrklnkklwfdi
clementine0.9_002219m|PACid:19267552  vp..........................................................
clementine0.9_001979m|PACid:19267551  vp..........................................................
clementine0.9_002018m|PACid:19271371  tp..........................................................
clementine0.9_009454m|PACid:19274462  qcihfiqylhtgfdhqlaipekvarnlrkklpvtvslkapsgftwvvgit..........
clementine0.9_016578m|PACid:19285015  stdseffkvylpafsskqlaippafakhlnvtvpkhviirdyagrqwrgkmeevegvivi
clementine0.9_012255m|PACid:19274454  pcffnifssnlsaeclklplqfvrhmegrtsgsvtligpswdtwhidliqqddnlffdk.
clementine0.9_012295m|PACid:19274453  pcffnifssnlsaeclklplqfvrhmegrtsgsvtligpswdtwhidliqqddnlffdk.
clementine0.9_017552m|PACid:19252663  ghipsifartylngiqgdvt........................................
clementine0.9_028866m|PACid:19283430  f...........................................................
clementine0.9_012694m|PACid:19277288  ltmyksnhsvplqflppkfaemvsavigkkaviedssgdcwevsvsnvdgspafrqg...
clementine0.9_006512m|PACid:19274447  pcffnifssnlsaeclklplqfvrhmegrtsgsvtligpswdtwhidliqqddnlffdk.
clementine0.9_006518m|PACid:19274448  pcffnifssnlsaeclklplqfvrhmegrtsgsvtligpswdtwhidliqqddnlffdk.
clementine0.9_015782m|PACid:19252711  fkpqnpsfvdilrskkrysymyvpskfskkhlirgtrsi.....................
clementine0.9_029159m|PACid:19252652  sprrippffarkfgheltdaatltlpngrqsqvslkkdgrnvwfrdgwhef.........
clementine0.9_030317m|PACid:19278242  mipqefvrkfghelsavatlavpngcvwrvgltkdegsiwfqngw...............
clementine0.9_012751m|PACid:19252655  lq..........................................................
clementine0.9_031493m|PACid:19269081  mkktnslffqvilavtiedkkmkipqnfvgrfgdelsyvatltnpkgyvvrigitkkegk
clementine0.9_002868m|PACid:19283434  stpp........................................................
clementine0.9_023288m|PACid:19258245  pcfyhvildgkvpqipqeflkhiskessdkatltvqgsarswtvklsetgigvflqdgwl
clementine0.9_033898m|PACid:19252715  mipplfaikfgheltnaatltlpngrqsqvslkkdgrnvwfrdgwhefve..........
clementine0.9_030161m|PACid:19257223  prfvkarllstlrdqklrilnkivrkishelsdvvhiivpngyvwqvklnkeg.......
clementine0.9_035747m|PACid:19272344  pl..........................................................
clementine0.9_014623m|PACid:19252640  feprnpsfmvivrgnerrkaclfipikfvnnylckvpk......................
clementine0.9_009454m|PACid:19274462  dsftvvmrpthvykrfymaipaswmskyltlenqdvilrlnek.................
clementine0.9_014503m|PACid:19252671  pekpsflvflrasnmqlnyv........................................
clementine0.9_014528m|PACid:19252673  pekpsflvflrasnmqlnyv........................................
clementine0.9_014540m|PACid:19252672  pekpsflvflrasnmqlnyv........................................
clementine0.9_035333m|PACid:19265969  ekkltntdlkvnqcrlsmnrgkv.....................................
clementine0.9_033898m|PACid:19252715  klknptfmvillprdkhya.........................................
clementine0.9_029159m|PACid:19252652  knptflvilqpsdknha...........................................
clementine0.9_015967m|PACid:19252664  pnpyfvskawagtrknylhvpshvlkdlglklakkitildergysfhgqld.........
clementine0.9_016234m|PACid:19278176  vqpknssfmvileqhfkscrdvycpikfaakfvkkdskyvkvqisnevkesielqwk...
clementine0.9_034173m|PACid:19277327  tclptssfrgrsrtqrkvvvlrdpdmrmwpvlyhersgf.....................
clementine0.9_014026m|PACid:19274455  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_014032m|PACid:19274457  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_014056m|PACid:19274456  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_007602m|PACid:19274452  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_007611m|PACid:19274451  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_007612m|PACid:19274449  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_007619m|PACid:19274450  sgsvtligpswdtwhidliqqddnlffdk...............................
clementine0.9_031493m|PACid:19269081  pekpsflvflrasnmqlnc.........................................
clementine0.9_026502m|PACid:19278137  vyaparfayqyvdedsksvevqapsgrkwslgihwratggfflakgwa............
clementine0.9_030220m|PACid:19263361  ekc.........................................................
clementine0.9_026634m|PACid:19261720  qsgypsfiksmvrshvyscfwlglpnqfckqnlpktvte.....................
clementine0.9_028259m|PACid:19257262  qknlkntdlnasqcrllmnras......................................
clementine0.9_032295m|PACid:19271047  lq..........................................................
clementine0.9_031701m|PACid:19265383  ............................................................
clementine0.9_030250m|PACid:19257188  prfvkavlpsilrdqklripnkivrkishelsvvahitvrngyvw...............
clementine0.9_031394m|PACid:19269146  pkips.......................................................
clementine0.9_032241m|PACid:19278593  lpsktipaflvykgkew...........................................
clementine0.9_027688m|PACid:19275314  wsi.........................................................
clementine0.9_033247m|PACid:19275420  wsi.........................................................
clementine0.9_031601m|PACid:19274986  wsi.........................................................
clementine0.9_032958m|PACid:19265450  ............................................................
clementine0.9_028333m|PACid:19265019  kllfsktptktdinnkfsvkrkslasfppfgaqtyf........................
clementine0.9_029718m|PACid:19265460  ............................................................
clementine0.9_029756m|PACid:19282207  viqkglfysdisdtharlsipvnqvvstefltgdekrgiegckinvkliepslqvselrf
clementine0.9_030317m|PACid:19278242  ikpekpsflvvlqtrnmmehvvyvpatfaqkylsgdshvvvqdsrggsklatemksss..
clementine0.9_031190m|PACid:19279885  viqkplyksdiskpecrfsipvkqvqqefltkqekilldtcdshkkkasrieatlidpsl
clementine0.9_024750m|PACid:19265376  v...........................................................
clementine0.9_029428m|PACid:19265395  v...........................................................
clementine0.9_017696m|PACid:19252647  wfvelkkcnkqlwfdigwhefiehcsihsgy.............................
clementine0.9_035508m|PACid:19282352  iqkdlfstdvsdhhyrlsipwnqiiskdfltdeekaylentraemkvkliepslqecemt
clementine0.9_016720m|PACid:19280007  liilpsssithnrvyvpatfakhfasrda...............................
clementine0.9_027804m|PACid:19265377  ............................................................
clementine0.9_031182m|PACid:19265459  ............................................................
clementine0.9_030058m|PACid:19251949  kikltaedvggkryyldlkkaaveehivklwsptvvkratiddievllrdldtss.....
clementine0.9_032958m|PACid:19265450  ............................................................
clementine0.9_033187m|PACid:19275809  wni.........................................................
clementine0.9_030641m|PACid:19278088  vmrkqlkntdllknenrllipwgkvrdynflnrqeesildakg.................
clementine0.9_031315m|PACid:19278082  vmqktitgcdlrsnnnrlsipptkvrddnfvnqkeksilntkegievlmippsl......
clementine0.9_028145m|PACid:19283677  skkigktdlnkndnrllipwgnlrdysflnqeeksildsqkgakkgiev...........
clementine0.9_035052m|PACid:19278092  vmqktitgcdlrsnnnrlsipptkvrddnfvnqkeksilntkegievlmipps.......
clementine0.9_033288m|PACid:19278181  mqkkitecdlrsnnnrlsipptkvrddnflnpkekgilnakegievfmippslkhnvplt


                                                          10        20        30        40          
                                                           |         |         |         |          
d1na6a1                                 ..........-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGIVEKL...
clementine0.9_001914m|PACid:19256853  ..........----AELGAPNKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...
clementine0.9_001909m|PACid:19286084  ..........---PAELGTLSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...
clementine0.9_004125m|PACid:19286945  ..........------LGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...
clementine0.9_003435m|PACid:19286944  ..........------LGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...
clementine0.9_002376m|PACid:19286943  ..........------LGIPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...
clementine0.9_001661m|PACid:19270051  ..........-------LKPSKHPSEFFCKTLTASDTSTHG----GFSVPRRAAEKL...
clementine0.9_000850m|PACid:19262349  ..........---------QNRQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI...
clementine0.9_004085m|PACid:19265463  ..........--------EPEKCTVHSFCKTLTASDTSTHG----GFSVLRRHADDC...
clementine0.9_003726m|PACid:19281738  ..........-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...
clementine0.9_002618m|PACid:19281737  ..........-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...
clementine0.9_003300m|PACid:19271042  ..........-----------SSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...
clementine0.9_000984m|PACid:19262959  ..........--------KSNKPQTEFFCKTLTASDTSTHG----GFSVPRRAAEKI...
clementine0.9_035244m|PACid:19267613  ..........-----------SSTTHMFCKTLTASDTSTYG----GFSVPRRAAEDC...
clementine0.9_002282m|PACid:19280048  ..........--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...
clementine0.9_004233m|PACid:19263869  ..........--------EPPKQTVHSFCKILTASDTSTHG----GFSVLRKHATEC...
clementine0.9_002323m|PACid:19266460  ..........--------EPEKCTVHSFCKTLTASDTSTHG----GFSVLHRHADDC...
clementine0.9_004725m|PACid:19276701  ..........-------------KVHSFSKVLTASDTSTHG----GFSVLRKHATEC...
clementine0.9_003997m|PACid:19276700  ..........-------------KVHSFSKVLTASDTSTHG----GFSVLRKHATEC...
clementine0.9_004743m|PACid:19264442  ..........--------------VCSFSKKLTPSDTSTHG----GFSVPKRHADEC...
clementine0.9_013531m|PACid:19267713  ..........----------------MFEKPLTPSDVGKLN----RLVIPKQHAEKY...
clementine0.9_013116m|PACid:19260019  ..........-----------------FEKAVTPSDVGKLN----RLVIPKQHAEKH...
clementine0.9_009466m|PACid:19277065  ..........---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY...
clementine0.9_012013m|PACid:19265318  ..........---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY...
clementine0.9_012015m|PACid:19265319  ..........---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY...
clementine0.9_012029m|PACid:19265317  ..........---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY...
clementine0.9_003806m|PACid:19280466  ..........-----------QDKPASFAKTLTQSDANNGG----GFSVPRYCAETI...
clementine0.9_003933m|PACid:19256371  ..........-------------KPASFAKTLTQSDANNGG----GFSVPRYCAETI...
clementine0.9_005981m|PACid:19253286  ..........------------NNVVAFAKILTPSDANNGG----GFSVPRFCADSI...
clementine0.9_005984m|PACid:19253284  ..........------------NNVVAFAKILTPSDANNGG----GFSVPRFCADSI...
clementine0.9_005990m|PACid:19253285  ..........------------NNVVAFAKILTPSDANNGG----GFSVPRFCADSI...
clementine0.9_003537m|PACid:19282578  ..........--------------PASFAKTLTQSDANNGG----GFSVPRYCAETI...
clementine0.9_016767m|PACid:19268866  ..........----------------LFEKVLTPSDVGKLN----RMVIPKQQAEKH...
clementine0.9_033196m|PACid:19265703  ..........-----------------FQKELTPSDVGKLN----RLVIPKKYAVKY...
clementine0.9_014050m|PACid:19262961  ..........-----------------FQKELTPSDVGKLN----RLVIPKKYAVKY...
clementine0.9_014064m|PACid:19262960  ..........-----------------FQKELTPSDVGKLN----RLVIPKKYAVKY...
clementine0.9_018860m|PACid:19272165  ......glsg-----------------------------------------------...
clementine0.9_017696m|PACid:19252647  ..........-------------------------------------HVPTSFARKY...
clementine0.9_018401m|PACid:19252657  ..........-------------------------------------YLPSCFAEKH...
clementine0.9_028607m|PACid:19285595  ..........-----------------------------------------------...
clementine0.9_020140m|PACid:19274805  ..........-----------------------------------------------...
clementine0.9_014274m|PACid:19252656  ..........-------------------------------------YLPSCFAEKH...
clementine0.9_016992m|PACid:19286493  ..........----------------LFQKELKNSDVSSLR----RMILPKKAAEAH...
clementine0.9_007602m|PACid:19274452  ..........-----------------------------------------------...
clementine0.9_007611m|PACid:19274451  ..........-----------------------------------------------...
clementine0.9_007612m|PACid:19274449  ..........-----------------------------------------------...
clementine0.9_007619m|PACid:19274450  ..........-----------------------------------------------...
clementine0.9_006512m|PACid:19274447  ..........-----------------------------------------------...
clementine0.9_006518m|PACid:19274448  ..........-----------------------------------------------...
clementine0.9_003518m|PACid:19264226  ..........------------------QKVLKQSDVGNLG----RIVLPKKEAETH...
clementine0.9_012255m|PACid:19274454  ..........-----------------------------------------------...
clementine0.9_012295m|PACid:19274453  ..........-----------------------------------------------...
clementine0.9_014026m|PACid:19274455  ..........-----------------------------------------------...
clementine0.9_014032m|PACid:19274457  ..........-----------------------------------------------...
clementine0.9_014056m|PACid:19274456  ..........-----------------------------------------------...
clementine0.9_016720m|PACid:19280007  ..........----------F------------------------------------...
clementine0.9_007602m|PACid:19274452  ..........-----------------------------------------------...
clementine0.9_007611m|PACid:19274451  ..........-----------------------------------------------...
clementine0.9_007612m|PACid:19274449  ..........-----------------------------------------------...
clementine0.9_007619m|PACid:19274450  ..........-----------------------------------------------...
clementine0.9_006512m|PACid:19274447  ..........-----------------------------------------------...
clementine0.9_006518m|PACid:19274448  ..........-----------------------------------------------...
clementine0.9_010284m|PACid:19271821  ..........-------------------------------SHGFWLHLPMRFCKFN...
clementine0.9_009752m|PACid:19271820  ..........-------------------------------SHGFWLHLPMRFCKFN...
clementine0.9_015967m|PACid:19252664  ..........-----------------------------------------------...
clementine0.9_004348m|PACid:19280049  ..........-----------------------------------------------...
clementine0.9_013286m|PACid:19284500  .......gls-----------------------------------------------...
clementine0.9_016234m|PACid:19278176  ..........-----------------------------------------------...
clementine0.9_009940m|PACid:19284499  .......gls-----------------------------------------------...
clementine0.9_013062m|PACid:19272231  ......glsa-----------------------------------------------...
clementine0.9_007642m|PACid:19284498  .......gls-----------------------------------------------...
clementine0.9_023572m|PACid:19252684  ..........-----------------------------------------------...
clementine0.9_003491m|PACid:19264225  ..........------------------QKVLKQSDVGNLG----RIVLPKKEAETH...
clementine0.9_018346m|PACid:19252641  ..........-----------------------------------------------...
clementine0.9_014623m|PACid:19252640  ..........-----------------------------------------------...
clementine0.9_015782m|PACid:19252711  ..........-----------------------------------------------...
clementine0.9_014503m|PACid:19252671  ...iwfdggw-----------------------------------------------...
clementine0.9_014528m|PACid:19252673  ...iwfdggw-----------------------------------------------...
clementine0.9_014540m|PACid:19252672  ...iwfdggw-----------------------------------------------...
clementine0.9_007623m|PACid:19284497  .......gls-----------------------------------------------...
clementine0.9_004067m|PACid:19278806  ..........----------------LFEKILSASDAGRIG----RLVLPKACAEAY...
clementine0.9_016578m|PACid:19285015  ..........-----------------------------------------------...
clementine0.9_001957m|PACid:19278805  ..........----------------LFEKILSASDAGRIG----RLVLPKACAEAY...
clementine0.9_014274m|PACid:19252656  ..........-----------------------------------------------...
clementine0.9_012751m|PACid:19252655  ..........-----------------------------------------------...
clementine0.9_017552m|PACid:19252663  .......gwh-----------------------------------------------...
clementine0.9_002219m|PACid:19267552  ..........----------------LFEKVLSASDAGRIG----RLVLPKACAEAY...
clementine0.9_001979m|PACid:19267551  ..........----------------LFEKVLSASDAGRIG----RLVLPKACAEAY...
clementine0.9_002018m|PACid:19271371  ..........----------------LFEKMLSASDAGRIG----RLVLPKKCAEAY...
clementine0.9_009454m|PACid:19274462  ..........-----------------------------------------------...
clementine0.9_016578m|PACid:19285015  .......kdc-----------------------------------------------...
clementine0.9_012255m|PACid:19274454  ..........-----------------------------------------------...
clementine0.9_012295m|PACid:19274453  ..........-----------------------------------------------...
clementine0.9_017552m|PACid:19252663  ..........-----------------------------------------------...
clementine0.9_028866m|PACid:19283430  ..........----------------LFEKQLKNSDVNAAG----RIVLPKKLAETY...
clementine0.9_012694m|PACid:19277288  ..........-----------------------------------------------...
clementine0.9_006512m|PACid:19274447  ..........-----------------------------------------------...
clementine0.9_006518m|PACid:19274448  ..........-----------------------------------------------...
clementine0.9_015782m|PACid:19252711  ..........-----------------------------------------------...
clementine0.9_029159m|PACid:19252652  ..........-----------------------------------------------...
clementine0.9_030317m|PACid:19278242  ..........-----------------------------------------------...
clementine0.9_012751m|PACid:19252655  ..........-------------------------------------YLPSCFAEKH...
clementine0.9_031493m|PACid:19269081  ....iwfddg-----------------------------------------------...
clementine0.9_002868m|PACid:19283434  ..........----------------LFYKKLRASDQSKKK-----IVIRAKDAENV...
clementine0.9_023288m|PACid:19258245  ..........-----------------------------------------------...
clementine0.9_033898m|PACid:19252715  ..........-----------------------------------------------...
clementine0.9_030161m|PACid:19257223  ..........-----------------------------------------------...
clementine0.9_035747m|PACid:19272344  ..........-----------------FEKTMTVSDAEPKNG---RLVVPKKCAKFLtmv
clementine0.9_014623m|PACid:19252640  ..........-----------------------------------------------...
clementine0.9_009454m|PACid:19274462  ..........-----------------------------------------------...
clementine0.9_014503m|PACid:19252671  ..........-------------------------------------YVPTSFARKY...
clementine0.9_014528m|PACid:19252673  ..........-------------------------------------YVPTSFARKY...
clementine0.9_014540m|PACid:19252672  ..........-------------------------------------YVPTSFARKY...
clementine0.9_035333m|PACid:19265969  ..........-------------------------------------------LELL...
clementine0.9_033898m|PACid:19252715  ..........-------------------------------------YVPAKFANEF...
clementine0.9_029159m|PACid:19252652  ..........-------------------------------------YVPAKFANEF...
clementine0.9_015967m|PACid:19252664  ..........-----------------------------------------------...
clementine0.9_016234m|PACid:19278176  ..........-----------------------------------------------...
clementine0.9_034173m|PACid:19277327  ..........-----------------------------------------------...
clementine0.9_014026m|PACid:19274455  ..........-----------------------------------------------...
clementine0.9_014032m|PACid:19274457  ..........-----------------------------------------------...
clementine0.9_014056m|PACid:19274456  ..........-----------------------------------------------...
clementine0.9_007602m|PACid:19274452  ..........-----------------------------------------------...
clementine0.9_007611m|PACid:19274451  ..........-----------------------------------------------...
clementine0.9_007612m|PACid:19274449  ..........-----------------------------------------------...
clementine0.9_007619m|PACid:19274450  ..........-----------------------------------------------...
clementine0.9_031493m|PACid:19269081  ..........------------------------------------VYVPNSFARKY...
clementine0.9_026502m|PACid:19278137  ..........-----------------------------------------------...
clementine0.9_030220m|PACid:19263361  ..........----------------LFSKTLTKTDINN------KFSVKSKSL-AS...
clementine0.9_026634m|PACid:19261720  ..........-----------------------------------------------...
clementine0.9_028259m|PACid:19257262  ..........------------------------------------------VLEFL...
clementine0.9_032295m|PACid:19271047  ..........-------------------KALKNSDVGSLG----RIILPKREAEEN...
clementine0.9_031701m|PACid:19265383  ..........-----------------YSKILTETDVSTR------LAVESNTIDEF...
clementine0.9_030250m|PACid:19257188  ..........-----------------------------------------------...
clementine0.9_031394m|PACid:19269146  ..........-----------------FMVILQSSDITHNA-----VYVPGKFANEF...
clementine0.9_032241m|PACid:19278593  ..........-----------------------------------------------...
clementine0.9_027688m|PACid:19275314  ..........------------------TKILTRSDL----GHLSRLLVQTRLAERYv..
clementine0.9_033247m|PACid:19275420  ..........------------------TKILTRSDL----GHLSRLLVQTRLAERYv..
clementine0.9_031601m|PACid:19274986  ..........------------------TKILTRSDL----GHLSRLLVQTRLAERYv..
clementine0.9_032958m|PACid:19265450  ..........-----------------YSKILTETDVSTR------LAVESNTIDEF...
clementine0.9_028333m|PACid:19265019  ..........-----------------------------------------------...
clementine0.9_029718m|PACid:19265460  ..........-----------------YSKSLTESDVSTR------LAVTSSWLNNL...
clementine0.9_029756m|PACid:19282207  tkwkmpkggg-----------------------------------------------...
clementine0.9_030317m|PACid:19278242  ..........-----------------------------------------------...
clementine0.9_031190m|PACid:19279885  .........t-----------------------------------------------...
clementine0.9_024750m|PACid:19265376  ..........-----------------YLKTLTPTDISIR------LEVNANRLRGF...
clementine0.9_029428m|PACid:19265395  ..........-----------------YLKTLTPTDISIR------LEVNANRLRGF...
clementine0.9_017696m|PACid:19252647  ..........-----------------------------------------------...
clementine0.9_035508m|PACid:19282352  ..........-----------------------------------------------...
clementine0.9_016720m|PACid:19280007  ..........-----------------------------------------------...
clementine0.9_027804m|PACid:19265377  ..........-----------------YSKILTATDISTR------LEVNSSSLGDF...
clementine0.9_031182m|PACid:19265459  ..........-----------------YSKILTATDVSNQ------LEVKSSWINDL...
clementine0.9_030058m|PACid:19251949  ..........-----------------------------------------------...
clementine0.9_032958m|PACid:19265450  ..........----------------VYSKTLSPTDVSTR------LEVNASSLRRF...
clementine0.9_033187m|PACid:19275809  ..........------------------TKILAPSDLG----HLSRLLVQTRLAERYv..
clementine0.9_030641m|PACid:19278088  ..........-----------------------------------------------...
clementine0.9_031315m|PACid:19278082  ..........-----------------------------------------------...
clementine0.9_028145m|PACid:19283677  ..........-----------------------------------------------...
clementine0.9_035052m|PACid:19278092  ..........-----------------------------------------------...
clementine0.9_033288m|PACid:19278181  .....lkkwr-----------------------------------------------...


                                            50                  60        70          80        90  
                                             |                   |         |           |         |  
d1na6a1                                 ...FPSINH....TRELNP......SVFLTAHVSSHD.C.PDSEARAIYYNSAHFGKTR.
clementine0.9_001914m|PACid:19256853  ...FPPL-D....YSQTPP......AQELIAR--DLH.D.NEWKFRHIFRGQ-----PK.
clementine0.9_001909m|PACid:19286084  ...FPPL-D....FSQQPP......AQELIAR--DLH.D.NEWKFRHIFRGQ-----PK.
clementine0.9_004125m|PACid:19286945  ...FPSL-D....FSLQPP......AQELIAR--DLH.D.VEWKFRHIFRGQ-----PK.
clementine0.9_003435m|PACid:19286944  ...FPSL-D....FSLQPP......AQELIAR--DLH.D.VEWKFRHIFRGQ-----PK.
clementine0.9_002376m|PACid:19286943  ...FPSL-D....FSLQPP......AQELIAR--DLH.D.VEWKFRHIFRGQ-----PK.
clementine0.9_001661m|PACid:19270051  ...FPPL-D....YTMQPP......TQELVVR--DLH.D.NTWTFRHIYRGQ-----PK.
clementine0.9_000850m|PACid:19262349  ...FPPL-D....YSMQPP......AQEIVAR--DLH.D.TTWTFRHIYRGQ-----PK.
clementine0.9_004085m|PACid:19265463  ...LPPL-D....MSQQPP......WQELVAT--DLH.G.NEWHFRHIFRGQ-----PR.
clementine0.9_003726m|PACid:19281738  ...FPPL-D....YKQQRP......SQELVAK--DLH.G.VEWRFRHIYRGQ-----PR.
clementine0.9_002618m|PACid:19281737  ...FPPL-D....YKQQRP......SQELVAK--DLH.G.VEWRFRHIYRGQ-----PR.
clementine0.9_003300m|PACid:19271042  ...FPPL-D....YSQQRP......SQELVAK--DLH.G.LEWRFRHIYRGQ-----PR.
clementine0.9_000984m|PACid:19262959  ...FPPL-D....FSMQPP......AQELMAR--DLH.D.NIWTFRHIYRGQ-----PK.
clementine0.9_035244m|PACid:19267613  ...FPPL-D....YMQQRP......SQQLVAK--DLH.G.VEWKFRHIYRGQ-----PR.
clementine0.9_002282m|PACid:19280048  ...LPPL-D....MSRQPP......TQELAAK--DLH.G.NEWRFRHIFRGQ-----PR.
clementine0.9_004233m|PACid:19263869  ...LPPL-D....MTLATP......TQELAAK--DLH.G.YEWRFKHIFRGQ-----PR.
clementine0.9_002323m|PACid:19266460  ...LPPL-D....MSRQPP......WQELVAT--DLH.G.NEWNFRHIFRDQ-----PR.
clementine0.9_004725m|PACid:19276701  ...LPPL-D....MNQSTP......TQELVAK--DLH.G.YEWRFKHIFRGQ-----PR.
clementine0.9_003997m|PACid:19276700  ...LPPL-D....MNQSTP......TQELVAK--DLH.G.YEWRFKHIFRGQ-----PR.
clementine0.9_004743m|PACid:19264442  ...LPPL-D....MSKDPP......LQELVAK--DLH.G.LEWRFRHIYRGQ-----PK.
clementine0.9_013531m|PACid:19267713  ...FPLGGGgad.LGSSSS......DKGLLLSFEDES.G.KCWRFRYSYWNS-----SQ.
clementine0.9_013116m|PACid:19260019  ...FPLQ--....SGSTSK......GLLLNFE--DVT.G.KVWRFRYSYWNS-----SQ.
clementine0.9_009466m|PACid:19277065  ...FPL--D....SSSNEK......GLLLNFE--DRN.G.KPWRFRYSYWNS-----SQ.
clementine0.9_012013m|PACid:19265318  ...FPL--D....SSSNEK......GLLLNFE--DRN.G.KAWRFRYSYWNS-----SQ.
clementine0.9_012015m|PACid:19265319  ...FPL--D....SSSNEK......GLLLNFE--DRN.G.KAWRFRYSYWNS-----SQ.
clementine0.9_012029m|PACid:19265317  ...FPL--D....SSSNEK......GLLLNFE--DRN.G.KAWRFRYSYWNS-----SQ.
clementine0.9_003806m|PACid:19280466  ...FPRL-D....YSADPP......VQTILAK--DVH.G.ETWKFRHIYRGT-----PR.
clementine0.9_003933m|PACid:19256371  ...FPRL-D....YSAEPP......VQTILAK--DVH.G.EVWKFRHIYRGT-----PR.
clementine0.9_005981m|PACid:19253286  ...FPPL-N....YQVDPP......VQNISVT--DIH.G.AVWEFRHIYRGT-----PR.
clementine0.9_005984m|PACid:19253284  ...FPPL-N....YQVDPP......VQNISVT--DIH.G.AVWEFRHIYRGT-----PR.
clementine0.9_005990m|PACid:19253285  ...FPPL-N....YQVDPP......VQNISVT--DIH.G.AVWEFRHIYRGT-----PR.
clementine0.9_003537m|PACid:19282578  ...FPRL-D....YTADPP......VQTVVAK--DVH.G.EIWKFRHIYRGT-----PR.
clementine0.9_016767m|PACid:19268866  ...FAL--S....SEIASK......GVLLNFE--DST.Q.KVWRLRYCYWSS-----SQ.
clementine0.9_033196m|PACid:19265703  ...FPFISE....NAEENAinggvdDMELVFF--DKL.M.RPWKFRYCFWRS-----SQ.
clementine0.9_014050m|PACid:19262961  ...FPQISErveeHAENDKad....DVQLDFH--DKS.M.KLWKFRYCYWKS-----SQ.
clementine0.9_014064m|PACid:19262960  ...FPQISErveeHAENDKad....DVQLDFH--DKS.M.KLWKFRYCYWKS-----SQ.
clementine0.9_018860m|PACid:19272165  ...------....------......------------.-.-------------------.
clementine0.9_017696m|PACid:19252647  ...LNGIKG....Y-----......-----ITIIDSN.G.KQWPVRCIFKNG----GAK.
clementine0.9_018401m|PACid:19252657  ...LNGV--....------......CGFIKLQ--LSD.G.KQWPVRCLYRGGRAK----.
clementine0.9_028607m|PACid:19285595  ...------....------......------------.-.------------------R.
clementine0.9_020140m|PACid:19274805  ...------....------......------------.-.------------------R.
clementine0.9_014274m|PACid:19252656  ...LNGV--....------......CGFIKLQ--LSD.G.KQWPVRCLYRGGRAK----.
clementine0.9_016992m|PACid:19286493  ...LPVLES....----KE......GIFISME--DLD.GlHVWTFKYRFWPN----NNS.
clementine0.9_007602m|PACid:19274452  ...-PDC--....------......KTEIVLR--NLK.G.ECWTVN-------SLPDSK.
clementine0.9_007611m|PACid:19274451  ...-PDC--....------......KTEIVLR--NLK.G.ECWTVN-------SLPDSK.
clementine0.9_007612m|PACid:19274449  ...-PDC--....------......KTEIVLR--NLK.G.ECWTVN-------SLPDSK.
clementine0.9_007619m|PACid:19274450  ...-PDC--....------......KTEIVLR--NLK.G.ECWTVN-------SLPDSK.
clementine0.9_006512m|PACid:19274447  ...-PDC--....------......KTEIVLR--NLK.G.ECWTVN-------SLPDSK.
clementine0.9_006518m|PACid:19274448  ...-PDC--....------......KTEIVLR--NLK.G.ECWTVN-------SLPDSK.
clementine0.9_003518m|PACid:19264226  ...LPEL--....--EARD......GISIAME--DIGtS.RVWNMRYRFWPN----NKS.
clementine0.9_012255m|PACid:19274454  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_012295m|PACid:19274453  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_014026m|PACid:19274455  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_014032m|PACid:19274457  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_014056m|PACid:19274456  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_016720m|PACid:19280007  ...------....------......------------.-.-------------------.
clementine0.9_007602m|PACid:19274452  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_007611m|PACid:19274451  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_007612m|PACid:19274449  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_007619m|PACid:19274450  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_006512m|PACid:19274447  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_006518m|PACid:19274448  ...------....------......-TEVVLH--NLK.G.ASWTVN-------SVPTTK.
clementine0.9_010284m|PACid:19271821  ...MPKI--....------......DTVFIVE--NES.G.EEYKINYISQRTALSGG--.
clementine0.9_009752m|PACid:19271820  ...MPKI--....------......DTVFIVE--NES.G.EEYKINYISQRTALSGG--.
clementine0.9_015967m|PACid:19252664  ...IPDA-F....IAHLSP......SKPEKVMLINHI.G.EYWHVDVAYCDK-------.
clementine0.9_004348m|PACid:19280049  ...------....--RQPP......TQELAAK--DLH.G.NEWRFRHIFRGQ-----PR.
clementine0.9_013286m|PACid:19284500  ...------....------......------------.-.-------------------.
clementine0.9_016234m|PACid:19278176  ...------....------......------------.-.-------------------.
clementine0.9_009940m|PACid:19284499  ...------....------......------------.-.-------------------.
clementine0.9_013062m|PACid:19272231  ...------....------......------------.-.-------------------.
clementine0.9_007642m|PACid:19284498  ...------....------......------------.-.-------------------.
clementine0.9_023572m|PACid:19252684  ...------....------......------------.-.LTREGRKIWFNDGWHDFVK.
clementine0.9_003491m|PACid:19264225  ...LPEL--....--EARD......GISIAME--DIG.TsRVWNMRYSF---RFWPNNKs
clementine0.9_018346m|PACid:19252641  ...------....------......------------.-.-------------------.
clementine0.9_014623m|PACid:19252640  ...------....------......------------.-.-------------------.
clementine0.9_015782m|PACid:19252711  ...------....------......------------.-.-------------------.
clementine0.9_014503m|PACid:19252671  ...------....------......------------.-.-------------------.
clementine0.9_014528m|PACid:19252673  ...------....------......------------.-.-------------------.
clementine0.9_014540m|PACid:19252672  ...------....------......------------.-.-------------------.
clementine0.9_007623m|PACid:19284497  ...------....------......------------.-.-------------------.
clementine0.9_004067m|PACid:19278806  ...FPHI-S....QSE---......--GVPLRVQDVK.G.KEWVFQFRFWPN----NNS.
clementine0.9_016578m|PACid:19285015  ...------....------......---MMLR--DQN.G.RKWPVKISFRTN-------.
clementine0.9_001957m|PACid:19278805  ...FPHI-S....QSE---......--GVPLRVQDVK.G.KEWVFQFRFWPN----NNS.
clementine0.9_014274m|PACid:19252656  ...------....------......------------.-.-------------------.
clementine0.9_012751m|PACid:19252655  ...------....------......------------.-.-------------------.
clementine0.9_017552m|PACid:19252663  ...------....------......---------E--.-.-------------------.
clementine0.9_002219m|PACid:19267552  ...FPPISQ....PEG---......---LPLRIQDVK.G.KEWVFQFRFWPN----NNS.
clementine0.9_001979m|PACid:19267551  ...FPPISQ....PEG---......---LPLRIQDVK.G.KEWVFQFRFWPN----NNS.
clementine0.9_002018m|PACid:19271371  ...FPPISQ....PEG---......---LPLKVQDSK.G.KEWIFQFRFWPN----NNS.
clementine0.9_009454m|PACid:19274462  ...------....------......------------.-.-----------------TR.
clementine0.9_016578m|PACid:19285015  ...------....------......------------.-.-------------------.
clementine0.9_012255m|PACid:19274454  ...------....------......------------.-.-------------------.
clementine0.9_012295m|PACid:19274453  ...------....------......------------.-.-------------------.
clementine0.9_017552m|PACid:19252663  ...------....------......-------LTGPN.G.KQWRVRCISQKGKAKFGQ-.
clementine0.9_028866m|PACid:19283430  ...LPPVN-....-----E......KAGFWMHLEDMDfN.KVWTFKFRFWPN-----NR.
clementine0.9_012694m|PACid:19277288  ...------....------......------------.-.-------------------.
clementine0.9_006512m|PACid:19274447  ...------....------......------------.-.-------------------.
clementine0.9_006518m|PACid:19274448  ...------....------......------------.-.-------------------.
clementine0.9_015782m|PACid:19252711  ...------....------......------KLQDSD.G.KEWPAQLTWSSG-------.
clementine0.9_029159m|PACid:19252652  ...------....------......------------.-.-------------------.
clementine0.9_030317m|PACid:19278242  ...------....------......------------.-.-------------------.
clementine0.9_012751m|PACid:19252655  ...LNGV--....------......CGFIKLQ--LSD.G.KQWPVRCLYRGGRAK----.
clementine0.9_031493m|PACid:19269081  ...------....------......------------.-.-------------------.
clementine0.9_002868m|PACid:19283434  ...FPFLAH....LDYKKQi.....NYSVIAK--DVH.G.VAWKFNFV------DGKSR.
clementine0.9_023288m|PACid:19258245  ...------....------......------------.-.-------------------.
clementine0.9_033898m|PACid:19252715  ...------....------......------------.-.-------------------.
clementine0.9_030161m|PACid:19257223  ...------....------......------------.-.------------------R.
clementine0.9_035747m|PACid:19272344  qeyLPEL--....----SE......PQGFPIRMQDTN.G.KDWEFHFRFWPN----NNS.
clementine0.9_014623m|PACid:19252640  ...------....------......--FIKVQASDGR.E.WSIQTRYSHTGALHLSG--.
clementine0.9_009454m|PACid:19274462  ...------....------......------------.-.-TWITRFQFCK--------.
clementine0.9_014503m|PACid:19252671  ...LNGE--....------......-ECVTVQDSDGR.K.LAVKVK----------QSR.
clementine0.9_014528m|PACid:19252673  ...LNGE--....------......-ECVTVQDSDGR.K.LAVKVK----------QSR.
clementine0.9_014540m|PACid:19252672  ...LNGE--....------......-ECVTVQDSDGR.K.LAVKVK----------QSR.
clementine0.9_035333m|PACid:19265969  ...VPLLNEee..YRVLKE......GIPVTVYDLDGN.A.FPMSFK-------VWSESK.
clementine0.9_033898m|PACid:19252715  ...FSRD--....------......AQSVKVQVLNET.E.RSLHIHWRHKGGFFLSK--.
clementine0.9_029159m|PACid:19252652  ...FSRD--....------......AKSVKVQVLNET.E.RSLLIRWRHKGGFFLSK--.
clementine0.9_015967m|PACid:19252664  ...------....------......------------.-.-------I-----------.
clementine0.9_016234m|PACid:19278176  ...------....------......------------.-.-----------------PK.
clementine0.9_034173m|PACid:19277327  ...------....------......------------.-.-------------------.
clementine0.9_014026m|PACid:19274455  ...------....------......------------.-.-------------------.
clementine0.9_014032m|PACid:19274457  ...------....------......------------.-.-------------------.
clementine0.9_014056m|PACid:19274456  ...------....------......------------.-.-------------------.
clementine0.9_007602m|PACid:19274452  ...------....------......------------.-.-------------------.
clementine0.9_007611m|PACid:19274451  ...------....------......------------.-.-------------------.
clementine0.9_007612m|PACid:19274449  ...------....------......------------.-.-------------------.
clementine0.9_007619m|PACid:19274450  ...------....------......------------.-.-------------------.
clementine0.9_031493m|PACid:19269081  ...FNGEEC....VT----......-----IQ--DSD.G.RKLAVKVKV--------SC.
clementine0.9_026502m|PACid:19278137  ...------....------......------------.-.-------------------.
clementine0.9_030220m|PACid:19263361  ...FPPF--....-GAQTY......AQDFNAE--DEE.G.KKWLFRLIIRKG----KHK.
clementine0.9_026634m|PACid:19261720  ...------....------......-----MVLEDEN.G.--REFEAVYIG--------.
clementine0.9_028259m|PACid:19257262  ...VPFLNE....GECQTL......KEGIQVTTYDLD.G.NAYTMSFKVWAD------K.
clementine0.9_032295m|PACid:19271047  ...LPSLSD....KEG---......-IHIVIR-----.-.------DVY----------.
clementine0.9_031701m|PACid:19265383  ...FLAF--....-EAGQY......SQNLVVE--DEN.G.ERWPFRLFIRQG----PYR.
clementine0.9_030250m|PACid:19257188  ...------....------......------------.-.-------------------.
clementine0.9_031394m|PACid:19269146  ...FSRDV-....------......-KSIKIE--DDK.K.REHTLSNNWR--------R.
clementine0.9_032241m|PACid:19278593  ...------....------......------------.-.-----EMVYLGEDF--QKR.
clementine0.9_027688m|PACid:19275314  ...MPFLDEasr.SEVIGN......PEGLRVSVWDCD.T.NS-MHRLVFKKW---ATSN.
clementine0.9_033247m|PACid:19275420  ...MPFL-D....EASRNEvign..PEGLRVSVWDCD.T.NSM-HRLVFKKW---ATSN.
clementine0.9_031601m|PACid:19274986  ...MPFLDEasr.SEVIGN......PEGLRVSVWDCD.T.NS-MHRLVFKKW---ATSN.
clementine0.9_032958m|PACid:19265450  ...FPAF-E....AGQY--......SQNLVVE--DEN.G.ERWPFRLFIRQG----PYR.
clementine0.9_028333m|PACid:19265019  ...------....------......-QDFNAE--DEK.G.KKWLFRLRIRKG----KHK.
clementine0.9_029718m|PACid:19265460  ...FPPF-P....AGQY--......HQVLDVE--DEN.G.KKWKFVLCIRQEGQYDK--.
clementine0.9_029756m|PACid:19282207  ...------....------......------------.-.------------------Ky
clementine0.9_030317m|PACid:19278242  ...------....------......------------.-.-------------------.
clementine0.9_031190m|PACid:19279885  ...------....------......------------.-.-E-----------------.
clementine0.9_024750m|PACid:19265376  ...FPAF-E....AGQY--......RQVLDVE--DED.R.KNWKFVLCIRQGQ---YEK.
clementine0.9_029428m|PACid:19265395  ...FPAF-E....AGQY--......RQVLDVE--DED.R.KNWKFVLCIRQGQ---YEK.
clementine0.9_017696m|PACid:19252647  ...------....------......------------.-.-------------------.
clementine0.9_035508m|PACid:19282352  ...------....------......------------.-.----F--------------.
clementine0.9_016720m|PACid:19280007  ...------....------......-KSMEVRVSNER.H.KFMNMNVCWRENGGF----.
clementine0.9_027804m|PACid:19265377  ...FPPF-P....PGQY--......QQVLDVE--DEN.G.KNWKFVLCIRQQGQYEKP-.
clementine0.9_031182m|PACid:19265459  ...FPAF-E....AGQYH-......-QDLVVE--DEK.G.EKWEFVLRIRQKKH---KK.
clementine0.9_030058m|PACid:19251949  ...------....------......------------.-.-KHNVNFRYYKH-------.
clementine0.9_032958m|PACid:19265450  ...FPAF-P....AGQY--......DQHLVVE--DEN.G.KNSGFSLCIRRGQ---YEK.
clementine0.9_033187m|PACid:19275809  ...MPFL--....------......------------.-.-------------------.
clementine0.9_030641m|PACid:19278088  ...------....------......------------.-.-------------------.
clementine0.9_031315m|PACid:19278082  ...------....------......------------.-.-------------------.
clementine0.9_028145m|PACid:19283677  ...------....-S----......------------.-.-------------------.
clementine0.9_035052m|PACid:19278092  ...------....------......------------.-.-------------------.
clementine0.9_033288m|PACid:19278181  ...------....------......------------.-.-------------------.


                                                  100         110       120       130       140     
                                                    |           |         |         |         |     
d1na6a1                                 ..NEKRITR..WGRG..SPLQDPENTGALTLLAFKLDEQGGDCKEVNIWVCASTDEEDVI
clementine0.9_001914m|PACid:19256853  ..RHLLTTG..W-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRATRPQT-------
clementine0.9_001909m|PACid:19286084  ..RHLLTTG..W-SV..FVSAKRLVAGDSVLFIWNDKNQL-LLGIRRANRPPT-------
clementine0.9_004125m|PACid:19286945  ..RHLLTTG..W-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRAIRPPT-------
clementine0.9_003435m|PACid:19286944  ..RHLLTTG..W-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRAIRPPT-------
clementine0.9_002376m|PACid:19286943  ..RHLLTTG..W-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRAIRPPT-------
clementine0.9_001661m|PACid:19270051  ..RHLLTTG..W-SL..FVGSKRLRAGDSVLFIRDEKSQL-MVGVRRANRQQT-------
clementine0.9_000850m|PACid:19262349  ..RHLLTTG..W-SV..FVSTKRLFAGDSVLFIRDEKSQL-LLGIRRANRQQP-------
clementine0.9_004085m|PACid:19265463  ..RHLLTTG..W-SV..FVSSKKLVAGDAFIFLRGENEEL-RVGVRRHMRQQT-------
clementine0.9_003726m|PACid:19281738  ..RHLLTTG..W-SI..FVSQKNLVSGDAVLFLRGKDGEL-RLGIRRSVQPRN-------
clementine0.9_002618m|PACid:19281737  ..RHLLTTG..W-SI..FVSQKNLVSGDAVLFLRGKDGEL-RLGIRRSVQPRN-------
clementine0.9_003300m|PACid:19271042  ..RHLLTTG..W-SA..FVNKKKLVSGDAVLFLRGEDGEL-RLGIRRAPHVKS-------
clementine0.9_000984m|PACid:19262959  ..RHLLTTG..W-SL..FVSGKRLFAGDSVLFIRDEKQQL-LLGIRRANRQPA-------
clementine0.9_035244m|PACid:19267613  ..RHLLTTG..W-SA..FVNKKKLVSGDAVLFLRGEDGEL-KIGIRRAAQVKNG------
clementine0.9_002282m|PACid:19280048  ..RHLLQSG..W-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG-------
clementine0.9_004233m|PACid:19263869  ..RHLLTTG..W-ST..FVTSKRLVAGDAFVFLRGENGEL-RVGVRRLAHQQS-------
clementine0.9_002323m|PACid:19266460  ..RHLLTIG..W-SV..FVSSKKLVAGDAFIFLRGENEEL-RVGVRRHMRQQT-------
clementine0.9_004725m|PACid:19276701  ..RHLLTTG..W-ST..FVTSKRLVAGDTFVFLRGENGEL-HVGVRCLARQQS-------
clementine0.9_003997m|PACid:19276700  ..RHLLTTG..W-ST..FVTSKRLVAGDTFVFLRGENGEL-HVGVRCLARQQS-------
clementine0.9_004743m|PACid:19264442  ..RHLLTSG..W-SV..FVTSKKLVAGDVCIFLRGGDGEL-RVGVRRAMKLQNNASTSVI
clementine0.9_013531m|PACid:19267713  ..SYVLTKG..W-SR..YVKEKRLDAGDVILFERHRTDSE--------------------
clementine0.9_013116m|PACid:19260019  ..SYVLTKG..W-SR..FVKEKNLKAGDIVSFHRSTGGDR--------------------
clementine0.9_009466m|PACid:19277065  ..SYVMTKG..W-SR..FVKDKKLDAGDVVSFHR--------------------------
clementine0.9_012013m|PACid:19265318  ..SYVMTKG..W-SR..FVKDKKLDAGDTVSFQR--------------------------
clementine0.9_012015m|PACid:19265319  ..SYVMTKG..W-SR..FVKDKKLDAGDTVSFQR--------------------------
clementine0.9_012029m|PACid:19265317  ..SYVMTKG..W-SR..FVKDKKLDAGDTVSFQR--------------------------
clementine0.9_003806m|PACid:19280466  ..RHLLTTG..W-ST..FVNHKKLVAGDSIVFLRAENGDL-CVGIRRA------------
clementine0.9_003933m|PACid:19256371  ..RHLLTTG..W-SN..FVNQKKLVAGDSIVFLRAENGDL-CVG----------------
clementine0.9_005981m|PACid:19253286  ..RHLLTTG..W-SK..FVNRKKLIAGDSVVFMRDSRGKM-YIGLRRSVRYGNN------
clementine0.9_005984m|PACid:19253284  ..RHLLTTG..W-SK..FVNRKKLIAGDSVVFMRDSRGKM-YIGLRRSVRYGNN------
clementine0.9_005990m|PACid:19253285  ..RHLLTTG..W-SK..FVNRKKLIAGDSVVFMRDSRGKM-YIGLRRSVRYGNN------
clementine0.9_003537m|PACid:19282578  ..RHLLTTG..W-ST..FVNQKKLVAGDSIVFLRAQDGDL-CVGIRR-------------
clementine0.9_016767m|PACid:19268866  ..SYVLTKG..W-SR..FVKEKGVKAGDTVSFWR--------------------------
clementine0.9_033196m|PACid:19265703  ..SYVFTRG..W-NR..FVKEKKLKEKDIITFY---------------------------
clementine0.9_014050m|PACid:19262961  ..SFVFTRG..W-NR..FVKENQLKANDTICFY---------------------------
clementine0.9_014064m|PACid:19262960  ..SFVFTRG..W-NR..FVKENQLKANDTICFY---------------------------
clementine0.9_018860m|PACid:19272165  ..------G..W-RG..FSIDHELVDGDCLVFQLI-------------------------
clementine0.9_017696m|PACid:19252647  ..FSK---G..W-PE..FVWENNLDESDVCVFELIKSNDV--------------------
clementine0.9_018401m|PACid:19252657  ..---FSQG..W-YE..FTVENRLGEGDVCVFEVLRAREF--------------------
clementine0.9_028607m|PACid:19285595  ..RVSFGDG..W-QD..FVASNSISVGYFLVFRYEKN-----------------------
clementine0.9_020140m|PACid:19274805  ..KTGLSGG..W-KA..FAVAHGLVDGDALVFQLIRN-----------------------
clementine0.9_014274m|PACid:19252656  ..---FSQG..W-YE..FTVENRLGEGDVCVFEVLRAREF--------------------
clementine0.9_016992m|PACid:19286493  ..RMYVLEN..T-GD..FVNAHGLQLGDFIIVYQDDHNQNYV------------------
clementine0.9_007602m|PACid:19274452  ..GRMVHTF..CGGWmaFVRGNDIKIGDVCIFELIS------------------------
clementine0.9_007611m|PACid:19274451  ..GRMVHTF..CGGWmaFVRGNDIKIGDVCIFELIS------------------------
clementine0.9_007612m|PACid:19274449  ..GRMVHTF..CGGWmaFVRGNDIKIGDVCIFELIS------------------------
clementine0.9_007619m|PACid:19274450  ..GRMVHTF..CGGWmaFVRGNDIKIGDVCIFELIS------------------------
clementine0.9_006512m|PACid:19274447  ..GRMVHTF..CGGWmaFVRGNDIKIGDVCIFELIS------------------------
clementine0.9_006518m|PACid:19274448  ..GRMVHTF..CGGWmaFVRGNDIKIGDVCIFELIS------------------------
clementine0.9_003518m|PACid:19264226  ..RMYLLEN..T-GD..FVKANGLQEGDFIVIYSD-------------------------
clementine0.9_012255m|PACid:19274454  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_012295m|PACid:19274453  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_014026m|PACid:19274455  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_014032m|PACid:19274457  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_014056m|PACid:19274456  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_016720m|PACid:19280007  ..-------..----..-------------------------------------------
clementine0.9_007602m|PACid:19274452  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_007611m|PACid:19274451  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_007612m|PACid:19274449  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_007619m|PACid:19274450  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_006512m|PACid:19274447  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_006518m|PACid:19274448  ..VHTSHTF..CGGWlaFVRGNEIKLGDICIFELVHKCEL--------------------
clementine0.9_010284m|PACid:19271821  ..-------..W-KA..FSDANQLYEGDVLVFHLVEPT----------------------
clementine0.9_009752m|PACid:19271820  ..-------..W-KA..FSDANQLYEGDVLVFHLVEPT----------------------
clementine0.9_015967m|PACid:19252664  ..GVFFLDG..W-QK..FVKDNSLETADILVLKYD-------------------------
clementine0.9_004348m|PACid:19280049  ..RHLLQSG..W-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG-------
clementine0.9_013286m|PACid:19284500  ..-----AG..W-RQ..FSTAHNLVEGDVLVFQLI-------------------------
clementine0.9_016234m|PACid:19278176  ..--V----..----..-------------------------------------------
clementine0.9_009940m|PACid:19284499  ..-----AG..W-RQ..FSTAHNLVEGDVLVFQLI-------------------------
clementine0.9_013062m|PACid:19272231  ..------G..W-RG..FSIAHKLVEGDALVFHLVTPSKF--------------------
clementine0.9_007642m|PACid:19284498  ..-----AG..W-RQ..FSTAHNLVEGDVLVFQLI-------------------------
clementine0.9_023572m|PACid:19252684  ..NHSILKD..Y-FL..VFEYAKN------------------------------------
clementine0.9_003491m|PACid:19264225  ..RMYLLEN..T-GD..FVKANGLQEGDFIVIYSD-------------------------
clementine0.9_018346m|PACid:19252641  ..-------..----..---------G---------------------------------
clementine0.9_014623m|PACid:19252640  ..-------..----..---------G---------------------------------
clementine0.9_015782m|PACid:19252711  ..------G..W-DN..FAEYHSIAVGY--------------------------------
clementine0.9_014503m|PACid:19252671  ..-------..--NE..FVEDHSIDVGYFVLFQYR-------------------------
clementine0.9_014528m|PACid:19252673  ..-------..--NE..FVEDHSIDVGYFVLFQYR-------------------------
clementine0.9_014540m|PACid:19252672  ..-------..--NE..FVEDHSIDVGYFVLFQYR-------------------------
clementine0.9_007623m|PACid:19284497  ..-----AG..W-RQ..FSTAHNLVEGDVLVFQL--------------------------
clementine0.9_004067m|PACid:19278806  ..RMYVLEG..V-TP..CIQSMQLQAGDTITFSRIDPGGKLVMGFR--------------
clementine0.9_016578m|PACid:19285015  ..GRIVITG..GWSD..FWREQKLEAGDKCVFEFVLTRGNMS------------------
clementine0.9_001957m|PACid:19278805  ..RMYVLEG..V-TP..CIQSMQLQAGDTITFSRIDPGGKLVMGFR--------------
clementine0.9_014274m|PACid:19252656  ..-------..----..-------------------------------------------
clementine0.9_012751m|PACid:19252655  ..-------..----..-------------------------------------------
clementine0.9_017552m|PACid:19252663  ..-------..----..-------------------------------------------
clementine0.9_002219m|PACid:19267552  ..RMYVLEG..V-TP..CIQSMQLQAGDTVTFSRMDPEGKLVMGFR--------------
clementine0.9_001979m|PACid:19267551  ..RMYVLEG..V-TP..CIQSMQLQAGDTVTFSRMDPEGKLVMGFR--------------
clementine0.9_002018m|PACid:19271371  ..RMYVLEG..V-TP..CIQNMQLQAGDIVTFSRLEPEGKLVMGFR--------------
clementine0.9_009454m|PACid:19274462  ..DHTLYFS..H-GW..PEFVKDHFLGENDILFFKYNGGS--------------------
clementine0.9_016578m|PACid:19285015  ..-------..W-ER..FACVHSLELGDFLVFKYNG------------------------
clementine0.9_012255m|PACid:19274454  ..------G..W-PV..FLRDNFIECGDLLVFRY--------------------------
clementine0.9_012295m|PACid:19274453  ..------G..W-PV..FLRDNFIECGDLLVFRY--------------------------
clementine0.9_017552m|PACid:19252663  ..------G..W-SE..FVWENNLDESDVCVFELIKT-----------------------
clementine0.9_028866m|PACid:19283430  ..GRMYI--..----..-------------------------------------------
clementine0.9_012694m|PACid:19277288  ..-------..W-NA..FSAYHRLEIGDFLVFD---------------------------
clementine0.9_006512m|PACid:19274447  ..------G..W-PV..FLRDNFIECGDLLVFRY--------------------------
clementine0.9_006518m|PACid:19274448  ..------G..W-PV..FLRDNFIECGDLLVFRY--------------------------
clementine0.9_015782m|PACid:19252711  ..-------..----..-------------------------------------------
clementine0.9_029159m|PACid:19252652  ..-------..----..-V-----------------------------------------
clementine0.9_030317m|PACid:19278242  ..-------..--HA..FVEYHSISAGYFV------------------------------
clementine0.9_012751m|PACid:19252655  ..---FSQG..W-YE..FTVENRLGEGDVCVFEVLRAREF--------------------
clementine0.9_031493m|PACid:19269081  ..-------..W---..-------------------------------------------
clementine0.9_002868m|PACid:19283434  ..RHYLTVG..W-KY..FVRQKNLVPGDTVIFIRDENNKLR-------------------
clementine0.9_023288m|PACid:19258245  ..-------..----..-KFLRDNSLGDSEFLLFTYDGNMC-------------------
clementine0.9_033898m|PACid:19252715  ..-------..----..---I---------------------------------------
clementine0.9_030161m|PACid:19257223  ..NVRFDDG..W-QD..FVEAYSISVGSLVLFEYESNS----------------------
clementine0.9_035747m|PACid:19272344  ..IMYVLEG..L-KD..YLISNQCQAGDKVTFYRIEPEG---------------------
clementine0.9_014623m|PACid:19252640  ..------G..W-PG..FVVDINLDRGDICIFGLIKMD----------------------
clementine0.9_009454m|PACid:19274462  ..-------..----..-------------------------------------------
clementine0.9_014503m|PACid:19252671  ..RKYLLTR..W-GK..FFKKTNVKEGDILFFEMIQ------------------------
clementine0.9_014528m|PACid:19252673  ..RKYLLTR..W-GK..FFKKTNVKEGDILFFEMIQ------------------------
clementine0.9_014540m|PACid:19252672  ..RKYLLTR..W-GK..FFKKTNVKEGDILFFEMIQ------------------------
clementine0.9_035333m|PACid:19265969  ..YYVLTSG..W-TK..FHQNKGLADKHVVTLW---------------------------
clementine0.9_033898m|PACid:19252715  ..------G..W-AE..LSKDKKLAEGDICVFQ---------------------------
clementine0.9_029159m|PACid:19252652  ..------G..W-AE..LSKDKKLAEGDICIFQLIRKED---------------------
clementine0.9_015967m|PACid:19252664  ..-------..----..-------------------------------------------
clementine0.9_016234m|PACid:19278176  ..GGFFLTR..GWAK..ISRVKNLKEGDICIFELIRKQDL--------------------
clementine0.9_034173m|PACid:19277327  ..-KVLTSG..W-EA..FSKANNIQPGDGCIFGV--------------------------
clementine0.9_014026m|PACid:19274455  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_014032m|PACid:19274457  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_014056m|PACid:19274456  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_007602m|PACid:19274452  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_007611m|PACid:19274451  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_007612m|PACid:19274449  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_007619m|PACid:19274450  ..------G..W-PV..FLRDNFIECGDLLVFRYD-------------------------
clementine0.9_031493m|PACid:19269081  ..SKCLLTR..W-GK..FFKKTNVKEGDILFFEMIQMKNI--------------------
clementine0.9_026502m|PACid:19278137  ..-------..---G..VSDYVHLTEGDICIFELVKHPD---------------------
clementine0.9_030220m|PACid:19263361  ..KPVISAG..W-RS..FVRQKKLKIDDKVLFF---------------------------
clementine0.9_026634m|PACid:19261720  ..-------..----..-------------------------------------------
clementine0.9_028259m|PACid:19257262  ..YYVLTSG..W-TK..FHQDN--------------------------------------
clementine0.9_032295m|PACid:19271047  ..-------..----..-------------------------------------------
clementine0.9_031701m|PACid:19265383  ..KPTISAG..W-RC..FVMSKQAEVGDQVVFIK--------------------------
clementine0.9_030250m|PACid:19257188  ..-------..--QD..FVEAYSISVGSLVLFEYESNS----------------------
clementine0.9_031394m|PACid:19269146  ..NGGFVLL..W-AK..LMRNNSLQKGDICIFDFVPRNDF--------------------
clementine0.9_032241m|PACid:19278593  ..NKRFGSE..W-KT..FAIDNKLKVGDACVFELMECRN---------------------
clementine0.9_027688m|PACid:19275314  ..SYVLINH..WTAD..FVRRRELAAGDEIGMCWDS------------------------
clementine0.9_033247m|PACid:19275420  ..SYVLINH..WTAD..FVRRRELAAGDEIGMCWDS------------------------
clementine0.9_031601m|PACid:19274986  ..SYVLINH..WTAD..FVRRRELAAGDEIGMCWDS------------------------
clementine0.9_032958m|PACid:19265450  ..KPTISAG..W-LG..FVMSKQAKVGDLVVFI---------------------------
clementine0.9_028333m|PACid:19265019  ..KPVISAG..W-RR..FVRQKGLKIHD--------------------------------
clementine0.9_029718m|PACid:19265460  ..--PVISQatW-RP..FVVHKQAEVGDEVEFSRK-------------------------
clementine0.9_029756m|PACid:19282207  syNYALISG..W-KN..VKNKNRLQEGDTVQ-----------------------------
clementine0.9_030317m|PACid:19278242  ..------G..W-LG..FFEENHVTEGDILI-----------------------------
clementine0.9_031190m|PACid:19279885  ..-------..----..-------------------------------------------
clementine0.9_024750m|PACid:19265376  ..PFISQAT..W-RP..FVEEKQAEVGDAVEFSRE-------------------------
clementine0.9_029428m|PACid:19265395  ..PFISQAT..W-RP..FVEEKQAEVGDAVEFSRE-------------------------
clementine0.9_017696m|PACid:19252647  ..-------..----..-----------F-------------------------------
clementine0.9_035508m|PACid:19282352  ..-------..----..-------------------------------------------
clementine0.9_016720m|PACid:19280007  ..-ALSM--..--TE..LVEDENLKEGDIFIFE---------------------------
clementine0.9_027804m|PACid:19265377  ..-YISQAT..W-HP..FVLEKQAEVGDEVEFSR--------------------------
clementine0.9_031182m|PACid:19265459  ..PSISQAT..W-HP..FVVAKQAEVDDRVEFSRKT------------------------
clementine0.9_030058m|PACid:19251949  ..-------..----..-------------------------------------------
clementine0.9_032958m|PACid:19265450  ..PYISQGT..W-HP..FVVEKQAEVGDGVEFSRKTAGRY--------------------
clementine0.9_033187m|PACid:19275809  ..-------..----..-------------------------------------------
clementine0.9_030641m|PACid:19278088  ..-------..----..-------------------------------------------
clementine0.9_031315m|PACid:19278082  ..-------..----..-------------------------------------------
clementine0.9_028145m|PACid:19283677  ..-------..----..-------------------------------------------
clementine0.9_035052m|PACid:19278092  ..-------..----..-------------------------------------------
clementine0.9_033288m|PACid:19278181  ..-------..----..-------------------M-----------------------


                                          150       160       170                                   
                                            |         |         |                                   
d1na6a1                                 ETAIGEVIPGALISGPAGQILGGLSLQQ--ap............................
clementine0.9_001914m|PACid:19256853  ------VMPSSVLSSDSMHIGLLAAAAH--a.............................
clementine0.9_001909m|PACid:19286084  ------VMPSSVLSSDSMHLGLLAAAAH--a.............................
clementine0.9_004125m|PACid:19286945  ------VMPSSVLSSDSMHIGLLAAAAH--a.............................
clementine0.9_003435m|PACid:19286944  ------VMPSSVLSSDSMHIGLLAAAAH--a.............................
clementine0.9_002376m|PACid:19286943  ------VMPSSVLSSDSMHIGLLAAAAH--a.............................
clementine0.9_001661m|PACid:19270051  ------ALPSSVLSADSMHIGVLAAAAH--a.............................
clementine0.9_000850m|PACid:19262349  ------ALSSSVISSDSMHIGILAAAAH--a.............................
clementine0.9_004085m|PACid:19265463  ------NMPSSVISSHSMHLGVLATASH--a.............................
clementine0.9_003726m|PACid:19281738  ------------------------------glpdsilsk.....................
clementine0.9_002618m|PACid:19281737  ------------------------------glpdsilsk.....................
clementine0.9_003300m|PACid:19271042  ------------------------------gatfpsf.......................
clementine0.9_000984m|PACid:19262959  ------NLSSSVLSSDSMHIGILAAAAH--a.............................
clementine0.9_035244m|PACid:19267613  ------------------------------atfpsfcnq.....................
clementine0.9_002282m|PACid:19280048  ------NVPSSVISSHSMHLGVLATAWH--a.............................
clementine0.9_004233m|PACid:19263869  ------SMPSSVISSQSMHLGVLATAAH--a.............................
clementine0.9_002323m|PACid:19266460  ------NMPSSVISSHSMHLGVLAIASH--a.............................
clementine0.9_004725m|PACid:19276701  ------SMPSSVISSQSMHLGVLATASH--a.............................
clementine0.9_003997m|PACid:19276700  ------SMPSSVISSQSMHLGVLATASH--a.............................
clementine0.9_004743m|PACid:19264442  ------------------------------sslsmq........................
clementine0.9_013531m|PACid:19267713  ------------------------------rlfigwrr......................
clementine0.9_013116m|PACid:19260019  ------------------------------qlyidwka......................
clementine0.9_009466m|PACid:19277065  ------------------------------g.............................
clementine0.9_012013m|PACid:19265318  ------------------------------g.............................
clementine0.9_012015m|PACid:19265319  ------------------------------g.............................
clementine0.9_012029m|PACid:19265317  ------------------------------g.............................
clementine0.9_003806m|PACid:19280466  ------------------------------kr............................
clementine0.9_003933m|PACid:19256371  ------------------------------irr...........................
clementine0.9_005981m|PACid:19253286  ------------------------------gds...........................
clementine0.9_005984m|PACid:19253284  ------------------------------gds...........................
clementine0.9_005990m|PACid:19253285  ------------------------------gds...........................
clementine0.9_003537m|PACid:19282578  ------------------------------akk...........................
clementine0.9_016767m|PACid:19268866  ------------------------------s.............................
clementine0.9_033196m|PACid:19265703  ------------------------------ace...........................
clementine0.9_014050m|PACid:19262961  ------------------------------lce...........................
clementine0.9_014064m|PACid:19262960  ------------------------------lce...........................
clementine0.9_018860m|PACid:19272165  ------------------------------kpatfkvyiir...................
clementine0.9_017696m|PACid:19252647  ------------------------------tlkatifrvle...................
clementine0.9_018401m|PACid:19252657  ------------------------------vlkvtvfrvse...................
clementine0.9_028607m|PACid:19285595  ------------------------------stfqvlihdmtac.................
clementine0.9_020140m|PACid:19274805  ------------------------------tafkvyiirvng..................
clementine0.9_014274m|PACid:19252656  ------------------------------vlkvtvfrvse...................
clementine0.9_016992m|PACid:19286493  ------------------------------iq............................
clementine0.9_007602m|PACid:19274452  ------------------------------kldmrvhitg....................
clementine0.9_007611m|PACid:19274451  ------------------------------kldmrvhitg....................
clementine0.9_007612m|PACid:19274449  ------------------------------kldmrvhitg....................
clementine0.9_007619m|PACid:19274450  ------------------------------kldmrvhitg....................
clementine0.9_006512m|PACid:19274447  ------------------------------kldmrvhitg....................
clementine0.9_006518m|PACid:19274448  ------------------------------kldmrvhitg....................
clementine0.9_003518m|PACid:19264226  ------------------------------vkcgk.........................
clementine0.9_012255m|PACid:19274454  ------------------------------hvyilrv.......................
clementine0.9_012295m|PACid:19274453  ------------------------------hvyilrv.......................
clementine0.9_014026m|PACid:19274455  ------------------------------hvyilrv.......................
clementine0.9_014032m|PACid:19274457  ------------------------------hvyilrv.......................
clementine0.9_014056m|PACid:19274456  ------------------------------hvyilrv.......................
clementine0.9_016720m|PACid:19280007  ------------------------------ddgwydfakyysvsagyfsvfkydknsnfc
clementine0.9_007602m|PACid:19274452  ------------------------------hvyilrv.......................
clementine0.9_007611m|PACid:19274451  ------------------------------hvyilrv.......................
clementine0.9_007612m|PACid:19274449  ------------------------------hvyilrv.......................
clementine0.9_007619m|PACid:19274450  ------------------------------hvyilrv.......................
clementine0.9_006512m|PACid:19274447  ------------------------------hvyilrv.......................
clementine0.9_006518m|PACid:19274448  ------------------------------hvyilrv.......................
clementine0.9_010284m|PACid:19271821  ------------------------------rfkayivrang...................
clementine0.9_009752m|PACid:19271820  ------------------------------rfkayivrang...................
clementine0.9_015967m|PACid:19252664  ------------------------------gdcwfnvkimgksg................
clementine0.9_004348m|PACid:19280049  ------NVPSSVISSHSMHLGVLATAWH--a.............................
clementine0.9_013286m|PACid:19284500  ------------------------------aplklkvyiiran.................
clementine0.9_016234m|PACid:19278176  ------------------------------altrkgkdiwfhygwedfvesysisagyfl
clementine0.9_009940m|PACid:19284499  ------------------------------aplklkvyiiran.................
clementine0.9_013062m|PACid:19272231  ------------------------------kvyivrs.......................
clementine0.9_007642m|PACid:19284498  ------------------------------aplklkvyiiran.................
clementine0.9_023572m|PACid:19252684  ------------------------------stfdvlifdktac.................
clementine0.9_003491m|PACid:19264225  ------------------------------vkcgk.........................
clementine0.9_018346m|PACid:19252641  ------------------------------killddgwhdfvkdhsicvayflvfkyakn
clementine0.9_014623m|PACid:19252640  ------------------------------killddgwhdfvkdhsicvayflvfkyakn
clementine0.9_015782m|PACid:19252711  ------------------------------flvfkyaknstfdvlvfdmtac........
clementine0.9_014503m|PACid:19252671  ------------------------------knskfrvfiyntttc...............
clementine0.9_014528m|PACid:19252673  ------------------------------knskfrvfiyntttc...............
clementine0.9_014540m|PACid:19252672  ------------------------------knskfrvfiyntttc...............
clementine0.9_007623m|PACid:19284497  ------------------------------iaplklkvvy....................
clementine0.9_004067m|PACid:19278806  ------------------------------k.............................
clementine0.9_016578m|PACid:19285015  ------------------------------kemkvqvvr.....................
clementine0.9_001957m|PACid:19278805  ------------------------------k.............................
clementine0.9_014274m|PACid:19252656  ---------------------D--------nkvwfydgwqefmeryfirigyflvfryeg
clementine0.9_012751m|PACid:19252655  ---------------------D--------nkvwfydgwqefmeryfirigyflvfryeg
clementine0.9_017552m|PACid:19252663  ------------------------------fiehcsiragyfmifryqgnsdfnvyiyd.
clementine0.9_002219m|PACid:19267552  ------------------------------k.............................
clementine0.9_001979m|PACid:19267551  ------------------------------k.............................
clementine0.9_002018m|PACid:19271371  ------------------------------k.............................
clementine0.9_009454m|PACid:19274462  ------------------------------hfdvlmfd......................
clementine0.9_016578m|PACid:19285015  ------------------------------sslfdvkiygingc................
clementine0.9_012255m|PACid:19274454  ------------------------------dgelhftvqifdqsgc..............
clementine0.9_012295m|PACid:19274453  ------------------------------dgelhftvqifdqsgc..............
clementine0.9_017552m|PACid:19252663  ------------------------------ddvtlkvtifr...................
clementine0.9_028866m|PACid:19283430  ------------------------------fentrafikryclelgdyimvykdeleg..
clementine0.9_012694m|PACid:19277288  ------------------------------yirgsrfivkifdktgc.............
clementine0.9_006512m|PACid:19274447  ------------------------------dgelhftvqifdqsgc..............
clementine0.9_006518m|PACid:19274448  ------------------------------dgelhftvqifdqsgc..............
clementine0.9_015782m|PACid:19252711  ------------------------------cgikggwpafskyknlkqghvcvfelikak
clementine0.9_029159m|PACid:19252652  ------------------------------eihsitpgyflvfkyeknsrfqvhifdtta
clementine0.9_030317m|PACid:19278242  ------------------------------vfryrknssfqvfild..............
clementine0.9_012751m|PACid:19252655  ------------------------------vlkvtvfrvs....................
clementine0.9_031493m|PACid:19269081  ------------------------------nefvqyhsigvgyfvvfqyrknskfqvfvf
clementine0.9_002868m|PACid:19283434  ------------------------------lgi...........................
clementine0.9_023288m|PACid:19258245  ------------------------------fsvqifnkngc...................
clementine0.9_033898m|PACid:19252715  ------------------------------hsitpgyflvfkyeknsrfrvhifdttac.
clementine0.9_030161m|PACid:19257223  ------------------------------tfqahiyd......................
clementine0.9_035747m|PACid:19272344  ------------------------------klvig.........................
clementine0.9_014623m|PACid:19252640  ------------------------------dvimkvsvfsa...................
clementine0.9_009454m|PACid:19274462  ------------------------------prcsgglsggwknfavdnhldefdvcvfgp
clementine0.9_014503m|PACid:19252671  ------------------------------mkkillkvsvf...................
clementine0.9_014528m|PACid:19252673  ------------------------------mkkillkvsvf...................
clementine0.9_014540m|PACid:19252672  ------------------------------mkkillkvsvf...................
clementine0.9_035333m|PACid:19265969  ------------------------------mfrhaetqklcfviswr.............
clementine0.9_033898m|PACid:19252715  ------------------------------lirke.........................
clementine0.9_029159m|PACid:19252652  ------------------------------fvl...........................
clementine0.9_015967m|PACid:19252664  ------------------------------wkdgrqgikgwsafcrakklkkddicicef
clementine0.9_016234m|PACid:19278176  ------------------------------lfklsvf.......................
clementine0.9_034173m|PACid:19277327  ------------------------------esys..........................
clementine0.9_014026m|PACid:19274455  ------------------------------gelhftvqifdqsgc...............
clementine0.9_014032m|PACid:19274457  ------------------------------gelhftvqifdqsgc...............
clementine0.9_014056m|PACid:19274456  ------------------------------gelhftvqifdqsgc...............
clementine0.9_007602m|PACid:19274452  ------------------------------gelhftvqifdqsgc...............
clementine0.9_007611m|PACid:19274451  ------------------------------gelhftvqifdqsgc...............
clementine0.9_007612m|PACid:19274449  ------------------------------gelhftvqifdqsgc...............
clementine0.9_007619m|PACid:19274450  ------------------------------gelhftvqifdqsgc...............
clementine0.9_031493m|PACid:19269081  ------------------------------llkvsv........................
clementine0.9_026502m|PACid:19278137  ------------------------------vvfklhvfh.....................
clementine0.9_030220m|PACid:19263361  ------------------------------keqn..........................
clementine0.9_026634m|PACid:19261720  ------------------------------pkkglsggwrafa.................
clementine0.9_028259m|PACid:19257262  ------------------------------gltdkhgltlwmfrhvet............
clementine0.9_032295m|PACid:19271047  ------------------------------svkhwtlkfnqfsssvstfsrfrytvdfvk
clementine0.9_031701m|PACid:19265383  ------------------------------erag..........................
clementine0.9_030250m|PACid:19257188  ------------------------------tfqahiydetac..................
clementine0.9_031394m|PACid:19269146  ------------------------------llkl..........................
clementine0.9_032241m|PACid:19278593  ------------------------------dclkfrvqilrgd.................
clementine0.9_027688m|PACid:19275314  ------------------------------fy............................
clementine0.9_033247m|PACid:19275420  ------------------------------fys...........................
clementine0.9_031601m|PACid:19274986  ------------------------------fys...........................
clementine0.9_032958m|PACid:19265450  ------------------------------ker...........................
clementine0.9_028333m|PACid:19265019  ------------------------------kvsffig.......................
clementine0.9_029718m|PACid:19265460  ------------------------------t.............................
clementine0.9_029756m|PACid:19282207  ------------------------------vwsfrnle......................
clementine0.9_030317m|PACid:19278242  ------------------------------lemikkkn......................
clementine0.9_031190m|PACid:19279885  ------------------------------kkislrkwetkkkhhmygsgnssssyssss
clementine0.9_024750m|PACid:19265376  ------------------------------td............................
clementine0.9_029428m|PACid:19265395  ------------------------------td............................
clementine0.9_017696m|PACid:19252647  ------------------------------lifkyqgnsnfnvyifdlaiseieyp....
clementine0.9_035508m|PACid:19282352  ------------------------------krwvkpneknckerakssfsyvlinkwnql
clementine0.9_016720m|PACid:19280007  ------------------------------liskr.........................
clementine0.9_027804m|PACid:19265377  ------------------------------et............................
clementine0.9_031182m|PACid:19265459  ------------------------------dg............................
clementine0.9_030058m|PACid:19251949  ------------------------------rdsyflqglwrknfikrrslkaedei....
clementine0.9_032958m|PACid:19265450  ------------------------------kirv..........................
clementine0.9_033187m|PACid:19275809  ------------------------------deasrsevivnpeglrvsvwdcdtnsmhcl
clementine0.9_030641m|PACid:19278088  ----G-------------------------velkkwkigyslvekwhslvvsnrdnrlre
clementine0.9_031315m|PACid:19278082  ------------K-----------------hsvpltlkkwkmgdnytynlmktwhdlvvd
clementine0.9_028145m|PACid:19283677  ------------------------------vippslesnvklklkkwktgycltekwhsl
clementine0.9_035052m|PACid:19278092  -----------L------------------khsvpltlkkwkmgdnytynliktwhdlvv
clementine0.9_033288m|PACid:19278181  ------------------------------gdnytynlmntwhalvvddkdnglelgsev


                                                                    
                                                                    
d1na6a1                                 ............................
clementine0.9_001914m|PACid:19256853  ............................
clementine0.9_001909m|PACid:19286084  ............................
clementine0.9_004125m|PACid:19286945  ............................
clementine0.9_003435m|PACid:19286944  ............................
clementine0.9_002376m|PACid:19286943  ............................
clementine0.9_001661m|PACid:19270051  ............................
clementine0.9_000850m|PACid:19262349  ............................
clementine0.9_004085m|PACid:19265463  ............................
clementine0.9_003726m|PACid:19281738  ............................
clementine0.9_002618m|PACid:19281737  ............................
clementine0.9_003300m|PACid:19271042  ............................
clementine0.9_000984m|PACid:19262959  ............................
clementine0.9_035244m|PACid:19267613  ............................
clementine0.9_002282m|PACid:19280048  ............................
clementine0.9_004233m|PACid:19263869  ............................
clementine0.9_002323m|PACid:19266460  ............................
clementine0.9_004725m|PACid:19276701  ............................
clementine0.9_003997m|PACid:19276700  ............................
clementine0.9_004743m|PACid:19264442  ............................
clementine0.9_013531m|PACid:19267713  ............................
clementine0.9_013116m|PACid:19260019  ............................
clementine0.9_009466m|PACid:19277065  ............................
clementine0.9_012013m|PACid:19265318  ............................
clementine0.9_012015m|PACid:19265319  ............................
clementine0.9_012029m|PACid:19265317  ............................
clementine0.9_003806m|PACid:19280466  ............................
clementine0.9_003933m|PACid:19256371  ............................
clementine0.9_005981m|PACid:19253286  ............................
clementine0.9_005984m|PACid:19253284  ............................
clementine0.9_005990m|PACid:19253285  ............................
clementine0.9_003537m|PACid:19282578  ............................
clementine0.9_016767m|PACid:19268866  ............................
clementine0.9_033196m|PACid:19265703  ............................
clementine0.9_014050m|PACid:19262961  ............................
clementine0.9_014064m|PACid:19262960  ............................
clementine0.9_018860m|PACid:19272165  ............................
clementine0.9_017696m|PACid:19252647  ............................
clementine0.9_018401m|PACid:19252657  ............................
clementine0.9_028607m|PACid:19285595  ............................
clementine0.9_020140m|PACid:19274805  ............................
clementine0.9_014274m|PACid:19252656  ............................
clementine0.9_016992m|PACid:19286493  ............................
clementine0.9_007602m|PACid:19274452  ............................
clementine0.9_007611m|PACid:19274451  ............................
clementine0.9_007612m|PACid:19274449  ............................
clementine0.9_007619m|PACid:19274450  ............................
clementine0.9_006512m|PACid:19274447  ............................
clementine0.9_006518m|PACid:19274448  ............................
clementine0.9_003518m|PACid:19264226  ............................
clementine0.9_012255m|PACid:19274454  ............................
clementine0.9_012295m|PACid:19274453  ............................
clementine0.9_014026m|PACid:19274455  ............................
clementine0.9_014032m|PACid:19274457  ............................
clementine0.9_014056m|PACid:19274456  ............................
clementine0.9_016720m|PACid:19280007  vlifdftac...................
clementine0.9_007602m|PACid:19274452  ............................
clementine0.9_007611m|PACid:19274451  ............................
clementine0.9_007612m|PACid:19274449  ............................
clementine0.9_007619m|PACid:19274450  ............................
clementine0.9_006512m|PACid:19274447  ............................
clementine0.9_006518m|PACid:19274448  ............................
clementine0.9_010284m|PACid:19271821  ............................
clementine0.9_009752m|PACid:19271820  ............................
clementine0.9_015967m|PACid:19252664  ............................
clementine0.9_004348m|PACid:19280049  ............................
clementine0.9_013286m|PACid:19284500  ............................
clementine0.9_016234m|PACid:19278176  ffsyeknstfhiiifnldac........
clementine0.9_009940m|PACid:19284499  ............................
clementine0.9_013062m|PACid:19272231  ............................
clementine0.9_007642m|PACid:19284498  ............................
clementine0.9_023572m|PACid:19252684  ............................
clementine0.9_003491m|PACid:19264225  ............................
clementine0.9_018346m|PACid:19252641  stfdvlifdmtac...............
clementine0.9_014623m|PACid:19252640  stfdvlifdmtac...............
clementine0.9_015782m|PACid:19252711  ............................
clementine0.9_014503m|PACid:19252671  ............................
clementine0.9_014528m|PACid:19252673  ............................
clementine0.9_014540m|PACid:19252672  ............................
clementine0.9_007623m|PACid:19284497  ............................
clementine0.9_004067m|PACid:19278806  ............................
clementine0.9_016578m|PACid:19285015  ............................
clementine0.9_001957m|PACid:19278805  ............................
clementine0.9_014274m|PACid:19252656  nsafnvyifn..................
clementine0.9_012751m|PACid:19252655  nsafnvyifn..................
clementine0.9_017552m|PACid:19252663  ............................
clementine0.9_002219m|PACid:19267552  ............................
clementine0.9_001979m|PACid:19267551  ............................
clementine0.9_002018m|PACid:19271371  ............................
clementine0.9_009454m|PACid:19274462  ............................
clementine0.9_016578m|PACid:19285015  ............................
clementine0.9_012255m|PACid:19274454  ............................
clementine0.9_012295m|PACid:19274453  ............................
clementine0.9_017552m|PACid:19252663  ............................
clementine0.9_028866m|PACid:19283430  ............................
clementine0.9_012694m|PACid:19277288  ............................
clementine0.9_006512m|PACid:19274447  ............................
clementine0.9_006518m|PACid:19274448  ............................
clementine0.9_015782m|PACid:19252711  dillkvsi....................
clementine0.9_029159m|PACid:19252652  c...........................
clementine0.9_030317m|PACid:19278242  ............................
clementine0.9_012751m|PACid:19252655  ............................
clementine0.9_031493m|PACid:19269081  nt..........................
clementine0.9_002868m|PACid:19283434  ............................
clementine0.9_023288m|PACid:19258245  ............................
clementine0.9_033898m|PACid:19252715  ............................
clementine0.9_030161m|PACid:19257223  ............................
clementine0.9_035747m|PACid:19272344  ............................
clementine0.9_014623m|PACid:19252640  ............................
clementine0.9_009454m|PACid:19274462  dnpgtkpm....................
clementine0.9_014503m|PACid:19252671  ............................
clementine0.9_014528m|PACid:19252673  ............................
clementine0.9_014540m|PACid:19252672  ............................
clementine0.9_035333m|PACid:19265969  ............................
clementine0.9_033898m|PACid:19252715  ............................
clementine0.9_029159m|PACid:19252652  ............................
clementine0.9_015967m|PACid:19252664  thsrkmqntikvhi..............
clementine0.9_016234m|PACid:19278176  ............................
clementine0.9_034173m|PACid:19277327  ............................
clementine0.9_014026m|PACid:19274455  ............................
clementine0.9_014032m|PACid:19274457  ............................
clementine0.9_014056m|PACid:19274456  ............................
clementine0.9_007602m|PACid:19274452  ............................
clementine0.9_007611m|PACid:19274451  ............................
clementine0.9_007612m|PACid:19274449  ............................
clementine0.9_007619m|PACid:19274450  ............................
clementine0.9_031493m|PACid:19269081  ............................
clementine0.9_026502m|PACid:19278137  ............................
clementine0.9_030220m|PACid:19263361  ............................
clementine0.9_026634m|PACid:19261720  ............................
clementine0.9_028259m|PACid:19257262  ............................
clementine0.9_032295m|PACid:19271047  qngleigdsltlyedeskn.........
clementine0.9_031701m|PACid:19265383  ............................
clementine0.9_030250m|PACid:19257188  ............................
clementine0.9_031394m|PACid:19269146  ............................
clementine0.9_032241m|PACid:19278593  ............................
clementine0.9_027688m|PACid:19275314  ............................
clementine0.9_033247m|PACid:19275420  ............................
clementine0.9_031601m|PACid:19274986  ............................
clementine0.9_032958m|PACid:19265450  ............................
clementine0.9_028333m|PACid:19265019  ............................
clementine0.9_029718m|PACid:19265460  ............................
clementine0.9_029756m|PACid:19282207  ............................
clementine0.9_030317m|PACid:19278242  ............................
clementine0.9_031190m|PACid:19279885  yvlmnkwyniveenqlkkgdvvqvwafr
clementine0.9_024750m|PACid:19265376  ............................
clementine0.9_029428m|PACid:19265395  ............................
clementine0.9_017696m|PACid:19252647  ............................
clementine0.9_035508m|PACid:19282352  karnnlklgdtiqlwkfrsk........
clementine0.9_016720m|PACid:19280007  ............................
clementine0.9_027804m|PACid:19265377  ............................
clementine0.9_031182m|PACid:19265459  ............................
clementine0.9_030058m|PACid:19251949  ............................
clementine0.9_032958m|PACid:19265450  ............................
clementine0.9_033187m|PACid:19275809  vfkkwatsksyvlinhwtkdfvr.....
clementine0.9_030641m|PACid:19278088  gttvnlwsfrnksse.............
clementine0.9_031315m|PACid:19278082  dkdnglelgsevqlwsfrknn.......
clementine0.9_028145m|PACid:19283677  vvnnqenglemgvtvnlwsfrnns....
clementine0.9_035052m|PACid:19278092  ddkdnglelgsevqlwsfrknn......
clementine0.9_033288m|PACid:19278181  qlwsfrknn...................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]