SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments in Eucalyptus grandis v201

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1                          s..................................................................
Eucgr.A02065.1|PACid:23563901  l..................................................................
Eucgr.A02065.2|PACid:23563902  l..................................................................
Eucgr.A02065.3|PACid:23563903  l..................................................................
Eucgr.D00264.2|PACid:23574028  lp.................................................................
Eucgr.D00264.1|PACid:23574027  lp.................................................................
Eucgr.F02090.1|PACid:23582845  dfg................................................................
Eucgr.B02480.3|PACid:23567637  pr.................................................................
Eucgr.B02480.2|PACid:23567636  pr.................................................................
Eucgr.B02480.1|PACid:23567635  pr.................................................................
Eucgr.C03293.1|PACid:23572724  lk.................................................................
Eucgr.C03293.2|PACid:23572725  lk.................................................................
Eucgr.G00076.4|PACid:23585851  pe.................................................................
Eucgr.C02178.2|PACid:23571668  al.................................................................
Eucgr.G00076.3|PACid:23585850  pe.................................................................
Eucgr.C02178.1|PACid:23571667  al.................................................................
Eucgr.G00076.1|PACid:23585848  pe.................................................................
Eucgr.G00076.2|PACid:23585849  pe.................................................................
Eucgr.D00588.1|PACid:23574345  ks.................................................................
Eucgr.D00588.2|PACid:23574346  ks.................................................................
Eucgr.E00888.2|PACid:23577619  etp................................................................
Eucgr.E00888.1|PACid:23577618  etp................................................................
Eucgr.D01764.1|PACid:23575524  yl.................................................................
Eucgr.B03551.1|PACid:23568902  ppr................................................................
Eucgr.A02625.1|PACid:23564572  kep................................................................
Eucgr.B03050.1|PACid:23568282  l..................................................................
Eucgr.B03048.1|PACid:23568281  l..................................................................
Eucgr.G02838.1|PACid:23588588  kv.................................................................
Eucgr.L01673.1|PACid:23606585  hl.................................................................
Eucgr.E01093.1|PACid:23577807  e..................................................................
Eucgr.F04380.1|PACid:23585644  ek.................................................................
Eucgr.J00923.1|PACid:23598808  pa.................................................................
Eucgr.L00348.1|PACid:23605637  e..................................................................
Eucgr.K01240.1|PACid:23602718  qdk................................................................
Eucgr.D00053.1|PACid:23573847  hl.................................................................
Eucgr.I01210.1|PACid:23595750  askfpyfmtymkmfslekakml.............................................
Eucgr.L02216.1|PACid:23606980  fesqtphffkiils.....................................................
Eucgr.C00358.1|PACid:23569863  l..................................................................
Eucgr.C00358.2|PACid:23569864  l..................................................................
Eucgr.I01211.1|PACid:23595751  ftsdfpffmsymrrstvekakllpvpskfakehflwrr.............................
Eucgr.H02901.1|PACid:23592218  yepnnpffqvimrpsyvrekflvnlpasfigmhlkgdsrd...........................
Eucgr.H01965.1|PACid:23591351  fesqtphffkivls.....................................................
Eucgr.D00268.3|PACid:23574034  ppssphffkivlsralesgklgipksflrrygkdlsglvllkvpggstwpvkleksddgkvwlwkg.
Eucgr.D00268.2|PACid:23574033  ppssphffkivlsralesgklgipksflrrygkdlsglvllkvpggstwpvkleksddgkvwlwkg.
Eucgr.D00268.1|PACid:23574032  ppssphffkivlsralesgklgipksflrrygkdlsglvllkvpggstwpvkleksddgkvwlwkg.
Eucgr.D00269.1|PACid:23574035  ppssphffkivlsralesgklgipksflrrygkdlsglvllkvpggstwpvkleksddgkvwlwkgw
Eucgr.I01218.1|PACid:23595758  aeipsflktmvrsnvttgfwlhlpm..........................................
Eucgr.I00406.1|PACid:23594955  esphff.............................................................
Eucgr.F02399.3|PACid:23583202  fsshfpyfvrimkkfnisgsytlnipyqfsmehlpvskiti..........................
Eucgr.F02399.4|PACid:23583203  fsshfpyfvrimkkfnisgsytlnipyqfsmehlpvskiti..........................
Eucgr.F02399.1|PACid:23583200  fsshfpyfvrimkkfnisgsytlnipyqfsmehlpvskiti..........................
Eucgr.F02399.2|PACid:23583201  fsshfpyfvrimkkfnisgsytlnipyqfsmehlpvskiti..........................
Eucgr.D00268.1|PACid:23574032  fksdhpffkvviqptyvrksltipreffikhvqknkqiatlrysdr.....................
Eucgr.D00268.3|PACid:23574034  fksdhpffkvviqptyvrksltipreffikhvqknkqiatlrysdr.....................
Eucgr.D00268.2|PACid:23574033  fksdhpffkvviqptyvrksltipreffikhvqknkqiatlrysdr.....................
Eucgr.K02760.1|PACid:23604388  spnvssffkvmigsqfsellyippkfaptisgqlnqnirledsggrqwevtlskvdgsfafqr....
Eucgr.G01458.1|PACid:23587028  lspeypvmvkhmlpshvtggfwlgl..........................................
Eucgr.F02399.1|PACid:23583200  assfpkfvrimkrfnvsgsytlk............................................
Eucgr.F02399.2|PACid:23583201  assfpkfvrimkrfnvsgsytlk............................................
Eucgr.H02009.1|PACid:23591387  leptypsfikalvrshvgscfwmglpgvfcrah..................................
Eucgr.H01651.1|PACid:23591105  leptypsfikalvrshvgscfwmglpgvfcrah..................................
Eucgr.G00890.1|PACid:23586517  ppscphffkiilsqtlesgklgipkrflrrhgkdllglvfl..........................
Eucgr.F02399.3|PACid:23583202  ngkrphffeiysssvssrrlkipdkfvkhmegwmsglallegpsg......................
Eucgr.F02399.4|PACid:23583203  ngkrphffeiysssvssrrlkipdkfvkhmegwmsglallegpsg......................
Eucgr.G01455.1|PACid:23587025  ldaelpsfikpmlqshvtggfwlsl..........................................
Eucgr.F02399.1|PACid:23583200  ngkrphffeiysssvssrrlkipdkfvkhmegwmsglallegpsg......................
Eucgr.F02399.2|PACid:23583201  ngkrphffeiysssvssrrlkipdkfvkhmegwmsglallegpsg......................
Eucgr.F02358.1|PACid:23583166  lepqyptlvksmlpshvsggfwlglsvqfcksslpkndgvitlvdedgee.................
Eucgr.G01236.1|PACid:23586851  srcffkiilsnalesgklgipknflrrcgkdlsnsvllkvpggsawtielekc..............
Eucgr.G01245.1|PACid:23586859  feseypffkvmmqpsylkhhilyvprrfimqhirkikeiailrhsgryldrswplkllrykqdhkaf
Eucgr.H01965.1|PACid:23591351  fqspnpfflaimqpsfirhclsa............................................
Eucgr.G00890.1|PACid:23586517  lesdhpffkvvmrpsyvrkrlsipseffrkhvkknkqvatlsyldrswqvklksydhrg........
Eucgr.G01242.1|PACid:23586858  srcffkiilsnalesgklgipknfirrcgkdlsss................................
Eucgr.G00888.2|PACid:23586515  esphffkiil.........................................................
Eucgr.D00267.1|PACid:23574031  gphffkii...........................................................
Eucgr.G00888.1|PACid:23586514  esphffkiil.........................................................
Eucgr.G01517.2|PACid:23587078  rpyfyklvlsstiqdkrlripenfvkkfrdelssvatlnvpdgh.......................
Eucgr.F00044.1|PACid:23580709  ihfcqflqgdfhqqla...................................................
Eucgr.I01213.1|PACid:23595752  rkipdffkayrpeyssqrmhvpraflaqldgplpgeillrhrmgrqwhvkvtleaqdayfed.....
Eucgr.G01517.1|PACid:23587077  rpyfyklvlsstiqdkrlripenfvkkfrdelssvatlnvpdgh.......................
Eucgr.H02901.1|PACid:23592218  cifyrlmvdslihekqlg.................................................
Eucgr.G01245.1|PACid:23586859  srcffkii...........................................................
Eucgr.D00269.1|PACid:23574035  fksehpffkvvvqptyvrksltipreffikhvqknkqiatlrysdrswqvklrshehmaclsi....
Eucgr.G00890.1|PACid:23586517  fesdhpffkvvmrpsyvrkqlsipsgffrkhvqknkqiatlrysdrl....................
Eucgr.G00889.1|PACid:23586516  fdseypffkvvmrpsymkkeayvprrfiiqhileikeivtlrhsgrswpvklwsnprsvhga.....
Eucgr.G00888.2|PACid:23586515  fdseypffkvvirpsyiehhvvnvprwfirqhiqqikeivtlrhsnrtwpvklrtypsgsmqfs...
Eucgr.G00890.1|PACid:23586517  sdhpffrvvmrpsyiqkylcvpceffrkhvqknk.................................
Eucgr.G00888.1|PACid:23586514  fdseypffkvvirpsyiehhvvnvprwfirqhiqqikeivtlrhsnrtwpvklrtypsgsmqfs...
Eucgr.G01517.1|PACid:23587077  cr.................................................................
Eucgr.K02197.5|PACid:23603737  s..................................................................
Eucgr.K02197.1|PACid:23603733  s..................................................................
Eucgr.K02197.2|PACid:23603734  s..................................................................
Eucgr.K02197.3|PACid:23603735  s..................................................................
Eucgr.K02197.4|PACid:23603736  s..................................................................
Eucgr.H01962.1|PACid:23591348  angipkkfvikygsnlsdlvflqvpsgqawevelvrr..............................
Eucgr.G01240.1|PACid:23586856  srcffkfilsgaidsgklgipknflrrrgkdlsnsvl..............................
Eucgr.L01473.1|PACid:23606430  tp.................................................................
Eucgr.G00890.1|PACid:23586517  feseypffhvvilpnhiytklnipwkfmktyirgdrrmvtlvnsgrswevklhgykrfqiafl....
Eucgr.F02704.3|PACid:23583575  vp.................................................................
Eucgr.F02704.1|PACid:23583573  vp.................................................................
Eucgr.F02704.2|PACid:23583574  vp.................................................................
Eucgr.B04027.1|PACid:23569481  vp.................................................................
Eucgr.G02345.1|PACid:23587947  kgvl...............................................................
Eucgr.G00888.1|PACid:23586514  fdsehpffelviqqshfrkmhvpgqfvrqhiqehkkegtlrysdrswpvklsrytrgmrvffsa...
Eucgr.I01213.1|PACid:23595752  idlknpyfvtvvqalrsscl...............................................
Eucgr.E01478.1|PACid:23578191  lspqfpsfvkrklpshvtrvfwmglpkqfcd....................................
Eucgr.A01956.1|PACid:23563774  idlknpyfvtviqalrssylyvprsvlinyelklpqailfhdptgrtwrgtvkvw............
Eucgr.I00400.1|PACid:23594952  fkskrpmfilvvypsyikgstpsvstkfmrihikrsvqvvtlkhkkdswpvklikspg.........
Eucgr.E02078.1|PACid:23578694  pwkirkkltgsdlsplsrlllpagclqthvfpqmdkkmlrqvkseegmpvvgkdvatgrkhq.....
Eucgr.I00397.1|PACid:23594949  yptfviemspsclrycsvnvpagfmrshiskspqfvtlkymnrswsvklfkhserygsgrfsg....
Eucgr.I00403.1|PACid:23594954  pksphffkiils.......................................................
Eucgr.G01240.1|PACid:23586856  fesehpffkvvirqyhmkhmyvpnqfsqqhiqenkematlrfsdrswpvkllsythn..........
Eucgr.I01210.1|PACid:23595750  kippkfarlfseelphrvilkgpsggkwnaklrkdnagl............................
Eucgr.I01211.1|PACid:23595751  fqkepkpnlripsefselyhhelpdtvifkgpsgnewpaklqkdigsvcvqddgwqn..........
Eucgr.G01238.2|PACid:23586854  fesehpffkvviqqyhmkqmyvpnqfsqqhiqenkematlrfsdrswlvkllsythn..........
Eucgr.G01238.1|PACid:23586853  fesehpffkvviqqyhmkqmyvpnqfsqqhiqenkematlrfsdrswlvkllsythn..........
Eucgr.E01947.1|PACid:23578601  nd.................................................................
Eucgr.G01639.1|PACid:23587184  mgvpseffrkhlrkseqmvtlkcsdr.........................................
Eucgr.F00044.2|PACid:23580710  sflvvmrpthvykrfylsi................................................
Eucgr.F00044.1|PACid:23580709  sflvvmrpthvykrfylsi................................................
Eucgr.H01962.1|PACid:23591348  fqypnpffltlmqpslirhslhipsyrsggdidlyvsnerf..........................
Eucgr.E03465.1|PACid:23579814  ...................................................................
Eucgr.L02178.1|PACid:23606956  fekqvkasdlkdqqnrlllrkedvrefilpllee.................................
Eucgr.E01753.1|PACid:23578440  gkpffdviltkshvqprynlfipsrmhsllpsqdtqtvlaykdktwnvmlytktkrfdy........
Eucgr.L01802.1|PACid:23606676  kik................................................................
Eucgr.E02051.1|PACid:23578669  kik................................................................
Eucgr.G01238.2|PACid:23586854  rcffkfilsgaldsgsscgkdlsnsvllkvpdgstwtielekrnhdmvllgkgw.............
Eucgr.G01238.1|PACid:23586853  rcffkfilsgaldsgsscgkdlsnsvllkvpdgstwtielekrnhdmvllgkgw.............
Eucgr.G01241.1|PACid:23586857  vkfvkqhlhenkqvatlrvpvkfvkqhlhenkqvatlrysdrswpvklirslgqargapala.....
Eucgr.E01934.1|PACid:23578594  itkkltksdvdhsarlllpldclkailrdmddemrrqvestegmgvgvvdlktgneyql........
Eucgr.E01939.1|PACid:23578597  itkkltksdvdhsarlllpldclkailrdmddemrrqvestegmgvgvvdlktgneyql........
Eucgr.E02060.1|PACid:23578677  kik................................................................
Eucgr.E02050.1|PACid:23578668  kik................................................................
Eucgr.E01948.1|PACid:23578602  ik.................................................................
Eucgr.L02104.1|PACid:23606905  vkk................................................................
Eucgr.E02057.1|PACid:23578674  kikkrltqsdlghlsrllirrefvkshflrwmneetvrqvesgkgadvivtdmdtcsehrlvfvfwa
Eucgr.E01933.1|PACid:23578593  kckikkkltksdlsdhlsrlilpgrlveahvlplmgeamagqvksgggmkvvmrdadtrdehklvfc
Eucgr.E02053.1|PACid:23578671  vkkrltqsdlghlsrlligrdlvkshflrwmneetvr..............................
Eucgr.E02048.1|PACid:23578667  kik................................................................
Eucgr.E01937.1|PACid:23578595  dpwkikkkltksdlghlsrlllpwgcvkihvrdwmspemverieskdgmgvvvrd............
Eucgr.E02045.1|PACid:23578664  kik................................................................
Eucgr.E02044.1|PACid:23578663  kik................................................................
Eucgr.E03467.1|PACid:23579815  tp.................................................................
Eucgr.K03433.1|PACid:23605172  h..................................................................
Eucgr.L03694.1|PACid:23607997  kik................................................................
Eucgr.E02046.1|PACid:23578665  vkkrltqsdlghlsrlligrdlvkshflrwmseetvr..............................
Eucgr.G01246.1|PACid:23586860  ippsymnclslpvgfikqhiqenkgmatlrfsgeswpvkllsytqtrkilsgythdt..........
Eucgr.G01240.1|PACid:23586856  inseypffikvirrsymsklsipggffkqhklekqrvtlrhanrswsv...................
Eucgr.L01801.1|PACid:23606675  kik................................................................
Eucgr.E02047.1|PACid:23578666  kikkrltqsdlghlsrlligrdlvkshflr.....................................
Eucgr.B02808.1|PACid:23568029  elqcpsftvvirshnllkqnvtvpggilrehingsmqtatlky........................
Eucgr.H00815.1|PACid:23590199  keaethlpeleardgisiamedigts.........................................
Eucgr.E02029.1|PACid:23578652  kikkklkqsdlghlsrlligrdfvtshllrwmseemvrqieggkgadvivrdvdtcsehrlvfvlwa
Eucgr.D00268.2|PACid:23574033  seypfcnvvispshikrqtvtipwqfiktyiqkdhqmvnvvylgrsfevkllvyrhlhiailgig..
Eucgr.E04365.1|PACid:23580648  kikkklkqsdpghlsrlligrdfvtshllrwmseemvrqveggkgadvivrdvdtcsehrlvfvfwa
Eucgr.I00465.1|PACid:23595008  fkskhptfisvaypsyvknstasvsvkfmrthikrsmqvvtikhkneswpaklikf...........
Eucgr.E02054.1|PACid:23578672  ekrlthsdlghlsrlligqdlvkshflrwmseetvrqvesgqgadviv...................
Eucgr.E02074.1|PACid:23578692  yki................................................................
Eucgr.E04373.1|PACid:23580654  vk.................................................................
Eucgr.E01944.1|PACid:23578600  pwdfkkvletsdvdhssrllltkgfvesrvlkekgeemvglvksragmevpvwdadts.........
Eucgr.E02075.1|PACid:23578693  dpyhi..............................................................
Eucgr.D00269.1|PACid:23574035  seypfcnvvispshikrqtvt..............................................
Eucgr.E04371.1|PACid:23580652  vk.................................................................
Eucgr.F00044.2|PACid:23580710  lgpsgatwkvgtvaddenllfkhgwq.........................................
Eucgr.D00268.1|PACid:23574032  feseypfcnvvilpyqierqtvtipwqfiktyiqkdhqmvnvvylgrsfevkllvyrhlhiailgig
Eucgr.L02216.1|PACid:23606980  fqssnpffltlmqpslichslrfwlary.......................................
Eucgr.E01938.1|PACid:23578596  ikkklkksdlsdrlsrlmlsrdsveahvlplmdeemkeqvkskngmkvvvrnadtleehkl......
Eucgr.E02114.1|PACid:23578703  ykikktlkksdldhlsrlmipwavvathsseganivvwdadtrseqq....................
Eucgr.C01014.1|PACid:23570587  fekqlttsdiigiqsrllvnktdfatsilpllekgddievgipvktfnpagkaypmtfkiwc.....
Eucgr.K02760.1|PACid:23604388  vkvvtdchsylelpadlpssffkgsssrdrkvvfltdpskrtwpvlyherlgvr.............
Eucgr.E02039.1|PACid:23578658  kik................................................................
Eucgr.I00399.1|PACid:23594951  svpvkfmrthikrsmqvvtikhkneswpaklikf.................................
Eucgr.E01943.1|PACid:23578599  dpwkirkkltksdldhlsrlllppdcvrihvlrwmkkemvggvhskegmevnvikertegtegteg.
Eucgr.I00407.1|PACid:23594956  qgr................................................................
Eucgr.I00403.1|PACid:23594954  fkskhpmfilvvypsylkdshpvvtlkh.......................................
Eucgr.E01923.1|PACid:23578586  pwkikkklkpsdlghlwrlllprdavrmhvlqwmgeetvrrvksqegmevavrdvd...........
Eucgr.E01941.1|PACid:23578598  dpwsfkkqlkasdvdgssrlllaasfvhdhvlkekgeemvgqvksragkkvpvwdadtsskhqltfg
Eucgr.G01238.2|PACid:23586854  inskypffikvirrsymsklsipggfikqhklekqratlrhanrswsvrlggs..............
Eucgr.G01238.1|PACid:23586853  inskypffikvirrsymsklsipggfikqhklekqratlrhanrswsvrlggs..............
Eucgr.B02809.1|PACid:23568030  tvpgrvlkgcidgrtqtatlkyle...........................................
Eucgr.E02013.1|PACid:23578642  kik................................................................
Eucgr.I00402.1|PACid:23594953  ptfissvsvkfmrthikrsmqvvtikhkneswpaklikf............................
Eucgr.D00268.3|PACid:23574034  feseypfcnvvispshikrqtvfiktyiqkdhqmvnvvylgrsfevnlrvyrhlyiaflgv......
Eucgr.E02109.1|PACid:23578702  dpwkirkkltksdlyhlsrlllprdcvrthvl...................................
Eucgr.E02128.1|PACid:23578709  ksskgadvvvwdadtcsehqlvfaywassgsyvlkg...............................
Eucgr.B02809.1|PACid:23568030  etphffkivlsqtlqigr.................................................
Eucgr.E02134.1|PACid:23578714  sseganvvvwdadtrsehrlvfaywglsg......................................
Eucgr.K01123.1|PACid:23602599  kevlktrdengaqtemkvlllgpsgetchlrlirl................................
Eucgr.I00855.1|PACid:23595366  lvv................................................................
Eucgr.L01474.1|PACid:23606431  dakgsewivq.........................................................


                                                     10        20        30        40         50    
                                                      |         |         |         |          |    
d1na6a1                          ............-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGI.VEKLFPSINH.
Eucgr.A02065.1|PACid:23563901  ............---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA.AEKVFPPL-D.
Eucgr.A02065.2|PACid:23563902  ............---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA.AEKVFPPL-D.
Eucgr.A02065.3|PACid:23563903  ............---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA.AEKVFPPL-D.
Eucgr.D00264.2|PACid:23574028  ............----AELGSPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA.AEKVFPPL-D.
Eucgr.D00264.1|PACid:23574027  ............----AELGSPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA.AEKVFPPL-D.
Eucgr.F02090.1|PACid:23582845  ............-------LRPSKHPSEFFCKTLTASDTSTHG----GFSVPRRA.AEKLFPPL-D.
Eucgr.B02480.3|PACid:23567637  ............------------STPHMFCKTLTASDTSTHG----GFSVPRRA.AEDCFPPL-D.
Eucgr.B02480.2|PACid:23567636  ............------------STPHMFCKTLTASDTSTHG----GFSVPRRA.AEDCFPPL-D.
Eucgr.B02480.1|PACid:23567635  ............------------STPHMFCKTLTASDTSTHG----GFSVPRRA.AEDCFPPL-D.
Eucgr.C03293.1|PACid:23572724  ............---------QSRQPTEFFCKTLTASDTSTHG----GFSVPRRA.AEKIFPSL-D.
Eucgr.C03293.2|PACid:23572725  ............---------QSRQPTEFFCKTLTASDTSTHG----GFSVPRRA.AEKIFPSL-D.
Eucgr.G00076.4|PACid:23585851  ............---------PPRCKVHSFCKTLTASDTSTHG----GFSVLRRH.AEECLPLL-D.
Eucgr.C02178.2|PACid:23571668  ............--------KTTKPQPDFFCKTLTASDTSTHG----GFSVPRRA.AEKIFPPL-D.
Eucgr.G00076.3|PACid:23585850  ............---------PPRCKVHSFCKTLTASDTSTHG----GFSVLRRH.AEECLPLL-D.
Eucgr.C02178.1|PACid:23571667  ............--------KTTKPQPDFFCKTLTASDTSTHG----GFSVPRRA.AEKIFPPL-D.
Eucgr.G00076.1|PACid:23585848  ............---------PPRCKVHSFCKTLTASDTSTHG----GFSVLRRH.AEECLPLL-D.
Eucgr.G00076.2|PACid:23585849  ............---------PPRCKVHSFCKTLTASDTSTHG----GFSVLRRH.AEECLPLL-D.
Eucgr.D00588.1|PACid:23574345  ............------------STPHMFCKTLTASDTSTHG----GFSVPRRA.AEDCFPPL-D.
Eucgr.D00588.2|PACid:23574346  ............------------STPHMFCKTLTASDTSTHG----GFSVPRRA.AEDCFPPL-D.
Eucgr.E00888.2|PACid:23577619  ............-----------RTRVHSFCKVLTASDTSTHG----GFSVLRKH.ATECLPPL-D.
Eucgr.E00888.1|PACid:23577618  ............-----------RTRVHSFCKVLTASDTSTHG----GFSVLRKH.ATECLPPL-D.
Eucgr.D01764.1|PACid:23575524  ............-------PEPPRPRVHSFCKVLTASDTSTHG----GFSVLRKH.ATECLPPL-D.
Eucgr.B03551.1|PACid:23568902  ............------------PRVHSFCKTLTASDTSTHG----GFSVLRRH.ADECLPQL-D.
Eucgr.A02625.1|PACid:23564572  ............----------------MFEKPLTPSDVGKLN----RLVIPKQH.AEKHFPLVGE.
Eucgr.B03050.1|PACid:23568282  ............----------------LFQKEVTQSDVGKLN----RFVIPKQH.AEKHFPLRNR.
Eucgr.B03048.1|PACid:23568281  ............----------------LFEKAVTPSDVGKLN----RLVIPKQH.AEKHFPLRNGt
Eucgr.G02838.1|PACid:23588588  ............---------------ASFAKTLTQSDANNGG----GFSVPRYC.AETIFPRL-D.
Eucgr.L01673.1|PACid:23606585  ............----------------LFQKEVMQSDVGNLN----RFVIPKQH.AEKHFPLHNR.
Eucgr.E01093.1|PACid:23577807  ............---------------HMFDKVVTPSDVGKLN----RLVIPKQH.AEKYFPL--D.
Eucgr.F04380.1|PACid:23585644  ............--------------IVSFAKTLTPSDANNGG----GFSVPRFC.ADTIFPPL-D.
Eucgr.J00923.1|PACid:23598808  ............----------------SFAKTLTQSDANNGG----GFSVPRYC.AETIFPRL-D.
Eucgr.L00348.1|PACid:23605637  ............---------------HMFDKVVTPSDVGKLN----RLVIPKQH.AEKYFPL--D.
Eucgr.K01240.1|PACid:23602718  ............--------------PASFAKTLTQSDANNGG----GFSVPRYC.AETIFPRL-D.
Eucgr.D00053.1|PACid:23573847  ............----------------LFQKEVTRSDVGKLN----RFVIPKQH.AEKHFPLHNR.
Eucgr.I01210.1|PACid:23595750  ............-------------------------------------YIPRAF.AQAHCPLE--.
Eucgr.L02216.1|PACid:23606980  ............-------------------------DALQNG----RLGIPKKF.VRKYGS----.
Eucgr.C00358.1|PACid:23569863  ............-----------------FQKELTPSDVGKLN----RLVIPKKF.AIKYLPRISG.
Eucgr.C00358.2|PACid:23569864  ............-----------------FQKELTPSDVGKLN----RLVIPKKF.AIKYLPRISG.
Eucgr.I01211.1|PACid:23595751  ............-------------------------------------------.----------.
Eucgr.H02901.1|PACid:23592218  ............-------------------------------------------.----------.
Eucgr.H01965.1|PACid:23591351  ............-------------------------DALQNG----RLGIPKKF.VRKYGSSL--.
Eucgr.D00268.3|PACid:23574034  ............-------------------------------------------.----------.
Eucgr.D00268.2|PACid:23574033  ............-------------------------------------------.----------.
Eucgr.D00268.1|PACid:23574032  ............-------------------------------------------.----------.
Eucgr.D00269.1|PACid:23574035  ..........rg-------------------------------------------.----------.
Eucgr.I01218.1|PACid:23595758  ............-------------------------------------------.-------P-F.
Eucgr.I00406.1|PACid:23594955  ............-------------------KII-LSDTLQSG----KLIIPKRF.VAKY------.
Eucgr.F02399.3|PACid:23583202  ............-------------------------------------------.----------.
Eucgr.F02399.4|PACid:23583203  ............-------------------------------------------.----------.
Eucgr.F02399.1|PACid:23583200  ............-------------------------------------------.----------.
Eucgr.F02399.2|PACid:23583201  ............-------------------------------------------.----------.
Eucgr.D00268.1|PACid:23574032  ............-------------------------------------------.----------.
Eucgr.D00268.3|PACid:23574034  ............-------------------------------------------.----------.
Eucgr.D00268.2|PACid:23574033  ............-------------------------------------------.----------.
Eucgr.K02760.1|PACid:23604388  ............-------------------------------------------.----------.
Eucgr.G01458.1|PACid:23587028  ............---------------------------------------PKKF.CDLHLPQQ--.
Eucgr.F02399.1|PACid:23583200  ............--------------------------------------IPHQF.SMDHLPIC--.
Eucgr.F02399.2|PACid:23583201  ............--------------------------------------IPHQF.SMDHLPIC--.
Eucgr.H02009.1|PACid:23591387  ............-------------------------------------------.----------.
Eucgr.H01651.1|PACid:23591105  ............-------------------------------------------.----------.
Eucgr.G00890.1|PACid:23586517  ............-------------------------------------------.----------.
Eucgr.F02399.3|PACid:23583202  ............-------------------------------------------.----------.
Eucgr.F02399.4|PACid:23583203  ............-------------------------------------------.----------.
Eucgr.G01455.1|PACid:23587025  ............---------------------------------------PYNF.CHKHIPHRDD.
Eucgr.F02399.1|PACid:23583200  ............-------------------------------------------.----------.
Eucgr.F02399.2|PACid:23583201  ............-------------------------------------------.----------.
Eucgr.F02358.1|PACid:23583166  ............-------------------------------------------.----------.
Eucgr.G01236.1|PACid:23586851  ............-------------------------------------------.----------.
Eucgr.G01245.1|PACid:23586859  .........fsg-------------------------------------------.----------.
Eucgr.H01965.1|PACid:23591351  ............---------------------------------------PARF.FMKYIPNF-R.
Eucgr.G00890.1|PACid:23586517  ............-------------------------------------------.----------.
Eucgr.G01242.1|PACid:23586858  ............-------------------------------------------.----------.
Eucgr.G00888.2|PACid:23586515  ............------------------------SDTLESG----KLGIPKKF.LRR-------.
Eucgr.D00267.1|PACid:23574031  ............-----------------------LSDTLDSG----KLGIPRRF.LKKY------.
Eucgr.G00888.1|PACid:23586514  ............------------------------SDTLESG----KLGIPKKF.LRR-------.
Eucgr.G01517.2|PACid:23587078  ............-------------------------------------------.----------.
Eucgr.F00044.1|PACid:23580709  ............--------------------------------------IPKKF.AENLRSKL--.
Eucgr.I01213.1|PACid:23595752  ............-------------------------------------------.----------.
Eucgr.G01517.1|PACid:23587077  ............-------------------------------------------.----------.
Eucgr.H02901.1|PACid:23592218  ............--------------------------------------IPKKF.ARKYGDELSD.
Eucgr.G01245.1|PACid:23586859  ............-----------------------LSDTLESG----KLGIPKSF.LRRC------.
Eucgr.D00269.1|PACid:23574035  ............-------------------------------------------.----------.
Eucgr.G00890.1|PACid:23586517  ............-------------------------------------------.----------.
Eucgr.G00889.1|PACid:23586516  ............-------------------------------------------.----------.
Eucgr.G00888.2|PACid:23586515  ............-------------------------------------------.----------.
Eucgr.G00890.1|PACid:23586517  ............-------------------------------------------.----------.
Eucgr.G00888.1|PACid:23586514  ............-------------------------------------------.----------.
Eucgr.G01517.1|PACid:23587077  ............-------------------------------------YLPSCF.AEKHLNGV--.
Eucgr.K02197.5|PACid:23603737  ............-------------------------------------------.----------.
Eucgr.K02197.1|PACid:23603733  ............-------------------------------------------.----------.
Eucgr.K02197.2|PACid:23603734  ............-------------------------------------------.----------.
Eucgr.K02197.3|PACid:23603735  ............-------------------------------------------.----------.
Eucgr.K02197.4|PACid:23603736  ............-------------------------------------------.----------.
Eucgr.H01962.1|PACid:23591348  ............-------------------------------------------.----------.
Eucgr.G01240.1|PACid:23586856  ............-------------------------------------------.----------.
Eucgr.L01473.1|PACid:23606430  ............----------------LFEKMLSASDAGKIG----RLVLPRKC.AEAYFPPISQ.
Eucgr.G00890.1|PACid:23586517  ............-------------------------------------------.----------.
Eucgr.F02704.3|PACid:23583575  ............----------------LFEKVLSASDAGRIG----RLVLPKAC.AEAYFPPISQ.
Eucgr.F02704.1|PACid:23583573  ............----------------LFEKVLSASDAGRIG----RLVLPKAC.AEAYFPPISQ.
Eucgr.F02704.2|PACid:23583574  ............----------------LFEKVLSASDAGRIG----RLVLPKAC.AEAYFPPISQ.
Eucgr.B04027.1|PACid:23569481  ............----------------LFEKVLSASDAGRIG----RLVLPKAC.AEAYFPAIAQ.
Eucgr.G02345.1|PACid:23587947  ............-------------------------------------------.----------.
Eucgr.G00888.1|PACid:23586514  ............-------------------------------------------.----------.
Eucgr.I01213.1|PACid:23595752  ............-------------------------------------YVPRSV.-------LID.
Eucgr.E01478.1|PACid:23578191  ............-------------------------------------------.----------.
Eucgr.A01956.1|PACid:23563774  ............-------------------------------------------.----------.
Eucgr.I00400.1|PACid:23594952  ............-------------------------------------------.----------.
Eucgr.E02078.1|PACid:23578694  ............-------------------------------------------.----------.
Eucgr.I00397.1|PACid:23594949  ............-------------------------------------------.----------.
Eucgr.I00403.1|PACid:23594954  ............------------------------S----------GKLIPKRF.LQR-------.
Eucgr.G01240.1|PACid:23586856  ............-------------------------------------------.----------.
Eucgr.I01210.1|PACid:23595750  ............-------------------------------------Y-----.----------.
Eucgr.I01211.1|PACid:23595751  ............-------------------------------------------.----------.
Eucgr.G01238.2|PACid:23586854  ............-------------------------------------------.----------.
Eucgr.G01238.1|PACid:23586853  ............-------------------------------------------.----------.
Eucgr.E01947.1|PACid:23578601  ............--------------PWMIMKELTESDLS----HLSWLLLPGGClKTHVFPQM-D.
Eucgr.G01639.1|PACid:23587184  ............-------------------------------------------.----------.
Eucgr.F00044.2|PACid:23580710  ............---------------------------------------PTDW.ATT------H.
Eucgr.F00044.1|PACid:23580709  ............---------------------------------------PTDW.ATT------H.
Eucgr.H01962.1|PACid:23591348  ............-------------------------------------------.----------.
Eucgr.E03465.1|PACid:23579814  ............---------------------LSASDAGKIG----RLVLPKKC.AEAYFPSISQ.
Eucgr.L02178.1|PACid:23606956  ............-------------------------------------------.----------.
Eucgr.E01753.1|PACid:23578440  ............-------------------------------------------.----------.
Eucgr.L01802.1|PACid:23606676  ............-------------------KRLTQSDLG----HLSRLLIGRDF.VKSHFLR---.
Eucgr.E02051.1|PACid:23578669  ............-------------------KRLTQSDLG----HLSRLLIRRDF.VKSHFLRWM-.
Eucgr.G01238.2|PACid:23586854  ............-------------------------------------------.----------.
Eucgr.G01238.1|PACid:23586853  ............-------------------------------------------.----------.
Eucgr.G01241.1|PACid:23586857  ............-------------------------------------------.----------.
Eucgr.E01934.1|PACid:23578594  ............-------------------------------------------.----------.
Eucgr.E01939.1|PACid:23578597  ............-------------------------------------------.----------.
Eucgr.E02060.1|PACid:23578677  ............-------------------KRLTQSDLG----HLSRLLIGRDF.VKSHFL----.
Eucgr.E02050.1|PACid:23578668  ............-------------------KRLTQSDLG----HLSRLLIGRDF.VKSHF-----.
Eucgr.E01948.1|PACid:23578602  ............-------------------KKLTKSDLS---AHLSRLMLPRGS.VEAHVFRLMD.
Eucgr.L02104.1|PACid:23606905  ............--------------------RLTQSDLG----HLSRLLIGRDL.VKSHFLRWMD.
Eucgr.E02057.1|PACid:23578674  ...ssgcyvlkg-------------------------------------------.----------.
Eucgr.E01933.1|PACid:23578593  .........rwl-------------------------------------------.----------.
Eucgr.E02053.1|PACid:23578671  ............-------------------------------------------.----------.
Eucgr.E02048.1|PACid:23578667  ............-------------------KRLTQSDLG----HLSRLLIRRDF.VKSHFLRWMNe
Eucgr.E01937.1|PACid:23578595  ............-------------------------------------------.----------.
Eucgr.E02045.1|PACid:23578664  ............-------------------KRLTQSDLS----HLSRFLIGRDF.VKSHF-----.
Eucgr.E02044.1|PACid:23578663  ............-------------------KRLTQSDLG----HLSRLLIGRDF.VKSHF-----.
Eucgr.E03467.1|PACid:23579815  ............----------------LFEQTLSASDAGEIE----RIVVPKKC.AEAHFPSISQ.
Eucgr.K03433.1|PACid:23605172  ............-------------------------------------------.----------.
Eucgr.L03694.1|PACid:23607997  ............-------------------KRLTQSDLG----HLSRLLIGRDF.VKSHF-----.
Eucgr.E02046.1|PACid:23578665  ............-------------------------------------------.----------.
Eucgr.G01246.1|PACid:23586860  ............-------------------------------------------.----------.
Eucgr.G01240.1|PACid:23586856  ............-------------------------------------------.----------.
Eucgr.L01801.1|PACid:23606675  ............-------------------KRLTQSDLG----HLSRLLIGRDF.VKSHF-----.
Eucgr.E02047.1|PACid:23578666  ............-------------------------------------------.-------W--.
Eucgr.B02808.1|PACid:23568029  ............-------------------------------------------.----------.
Eucgr.H00815.1|PACid:23590199  ............-------------------------------------------.----------.
Eucgr.E02029.1|PACid:23578652  ..ssgsyvlkgg-------------------------------------------.----------.
Eucgr.D00268.2|PACid:23574033  ............-------------------------------------------.----------.
Eucgr.E04365.1|PACid:23580648  ...ssgsyvlkg-------------------------------------------.----------.
Eucgr.I00465.1|PACid:23595008  ............-------------------------------------------.----------.
Eucgr.E02054.1|PACid:23578672  ............-------------------------------------------.----------.
Eucgr.E02074.1|PACid:23578692  ............------------------KKTLTKSDLGQLS----RLLIPRAGvATYVLPCM-D.
Eucgr.E04373.1|PACid:23580654  ............-------------------KRLTQSDLG----HMSRLLIGRDS.VKSHFL----.
Eucgr.E01944.1|PACid:23578600  ............-------------------------------------------.----------.
Eucgr.E02075.1|PACid:23578693  ............------------------KKTLKKSDLGQLS----RLLIPRAGvATYVLPCM-D.
Eucgr.D00269.1|PACid:23574035  ............-------------------------------------------.----------.
Eucgr.E04371.1|PACid:23580652  ............-------------------KRLTQSDLG----HMSRLLIGRDS.VKSHF-----.
Eucgr.F00044.2|PACid:23580710  ............-------------------------------------------.----------.
Eucgr.D00268.1|PACid:23574032  ............-------------------------------------------.----------.
Eucgr.L02216.1|PACid:23606980  ............-------------------------------------------.----------.
Eucgr.E01938.1|PACid:23578596  ............-------------------------------------------.----------.
Eucgr.E02114.1|PACid:23578703  ............-------------------------------------------.----------.
Eucgr.C01014.1|PACid:23570587  ............-------------------------------------------.----------.
Eucgr.K02760.1|PACid:23604388  ............-------------------------------------------.----------.
Eucgr.E02039.1|PACid:23578658  ............-------------------KRLTQSDLG----HMSRLLIGRDS.VKSQF-----.
Eucgr.I00399.1|PACid:23594951  ............-------------------------------------------.----------.
Eucgr.E01943.1|PACid:23578599  ............-------------------------------------------.----------.
Eucgr.I00407.1|PACid:23594956  ............-------------------------------------------.----------.
Eucgr.I00403.1|PACid:23594954  ............-------------------------------------------.----------.
Eucgr.E01923.1|PACid:23578586  ............-------------------------------------------.----------.
Eucgr.E01941.1|PACid:23578598  cwestngyvlkg-------------------------------------------.----------.
Eucgr.G01238.2|PACid:23586854  ............-------------------------------------------.----------.
Eucgr.G01238.1|PACid:23586853  ............-------------------------------------------.----------.
Eucgr.B02809.1|PACid:23568030  ............-------------------------------------------.----------.
Eucgr.E02013.1|PACid:23578642  ............-------------------KKLTKSDL----GHQSRLLILRARmTTHVLPGM--.
Eucgr.I00402.1|PACid:23594953  ............-------------------------------------------.----------.
Eucgr.D00268.3|PACid:23574034  ............-------------------------------------------.----------.
Eucgr.E02109.1|PACid:23578702  ............-------------------------------------------.----------.
Eucgr.E02128.1|PACid:23578709  ............-------------------------------------------.----------.
Eucgr.B02809.1|PACid:23568030  ............------------------------------------LSIPKRF.VRKY------.
Eucgr.E02134.1|PACid:23578714  ............-------------------------------------------.----------.
Eucgr.K01123.1|PACid:23602599  ............-------------------------------------------.----------.
Eucgr.I00855.1|PACid:23595366  ............------------------EKTLTATDMSRG---QSRLSIPNKQ.IRQSF-----.
Eucgr.L01474.1|PACid:23606431  ............-------------------------------------------.----------.


                                                       60        70         80          90         1
                                                        |         |          |           |          
d1na6a1                          ....TRELNP.............SVFLTAHVSSH.DCPDSEARAIYYNSAHF..GKTR..NEKRITR
Eucgr.A02065.1|PACid:23563901  ....YSQQPP.............AQELIAR--DL.HDNEWKFRHIFRGQ---..--PK..RHLLTTG
Eucgr.A02065.2|PACid:23563902  ....YSQQPP.............AQELIAR--DL.HDNEWKFRHIFRGQ---..--PK..RHLLTTG
Eucgr.A02065.3|PACid:23563903  ....YSQQPP.............AQELIAR--DL.HDNEWKFRHIFRGQ---..--PK..RHLLTTG
Eucgr.D00264.2|PACid:23574028  ....YSLQPP.............AQELIAR--DL.HDNEWKFRHIFRGQ---..--PK..RHLLTTG
Eucgr.D00264.1|PACid:23574027  ....YSLQPP.............AQELIAR--DL.HDNEWKFRHIFRGQ---..--PK..RHLLTTG
Eucgr.F02090.1|PACid:23582845  ....FAMQPP.............TQELVVR--DL.HDNTWTFRHIYRGQ---..--PK..RHLLTTG
Eucgr.B02480.3|PACid:23567637  ....YKQQRP.............SQELVAK--DL.HGVEWRFRHIYRGQ---..--PR..RHLLTTG
Eucgr.B02480.2|PACid:23567636  ....YKQQRP.............SQELVAK--DL.HGVEWRFRHIYRGQ---..--PR..RHLLTTG
Eucgr.B02480.1|PACid:23567635  ....YKQQRP.............SQELVAK--DL.HGVEWRFRHIYRGQ---..--PR..RHLLTTG
Eucgr.C03293.1|PACid:23572724  ....FTMQPP.............CQELTAR--DL.HDNSWTFRHIYRGQ---..--PK..RHLLTTG
Eucgr.C03293.2|PACid:23572725  ....FTMQPP.............CQELTAR--DL.HDNSWTFRHIYRGQ---..--PK..RHLLTTG
Eucgr.G00076.4|PACid:23585851  ....MTQQPP.............WQELVAT--DL.HGNEWHFRHIFRGQ---..--PR..RHLLTTG
Eucgr.C02178.2|PACid:23571668  ....FSMQPP.............AQELMAR--DL.HDTMWNFRHIYRGQ---..--PK..RHLLTTG
Eucgr.G00076.3|PACid:23585850  ....MTQQPP.............WQELVAT--DL.HGNEWHFRHIFRGQ---..--PR..RHLLTTG
Eucgr.C02178.1|PACid:23571667  ....FSMQPP.............AQELMAR--DL.HDTMWNFRHIYRGQ---..--PK..RHLLTTG
Eucgr.G00076.1|PACid:23585848  ....MTQQPP.............WQELVAT--DL.HGNEWHFRHIFRGQ---..--PR..RHLLTTG
Eucgr.G00076.2|PACid:23585849  ....MTQQPP.............WQELVAT--DL.HGNEWHFRHIFRGQ---..--PR..RHLLTTG
Eucgr.D00588.1|PACid:23574345  ....YNQQRP.............SQELVAK--DL.HGLEWRFRHIYRGQ---..--PR..RHLLTTG
Eucgr.D00588.2|PACid:23574346  ....YNQQRP.............SQELVAK--DL.HGLEWRFRHIYRAG---..-QPR..RHLLTTG
Eucgr.E00888.2|PACid:23577619  ....MKQATP.............TQELVAK--DL.HGYEWKFKHIFRGQ---..--PR..RHLLTTG
Eucgr.E00888.1|PACid:23577618  ....MKQATP.............TQELVAK--DL.HGYEWKFKHIFRGQ---..--PR..RHLLTTG
Eucgr.D01764.1|PACid:23575524  ....MNQSTP.............TQELAAR--DL.HGYEWKFKHIFRGQ---..--PR..RHLLTTG
Eucgr.B03551.1|PACid:23568902  ....MTKQPP.............TQELVAK--DL.HGNEWRFRHIFRGQ---..--PR..RHLLQSG
Eucgr.A02625.1|PACid:23564572  ....A-----.............TQQLSFE--DE.SGKWWRFRYSYWSS---..--SQ..SYVLTKG
Eucgr.B03050.1|PACid:23568282  ....TSPTT-.............SKGVLLNFIDS.GGKVWRFRYSYWNS---..--SR..SYVLTRG
Eucgr.B03048.1|PACid:23568281  ....SSATSK.............GVLLNFE--DS.GGKVWRFRYSYWNS---..--SQ..SYVLTRG
Eucgr.G02838.1|PACid:23588588  ....YSAEPP.............VQTIVAK--DV.HGESWKFRHIYRGT---..--PR..RHLLTTG
Eucgr.L01673.1|PACid:23606585  ....SSPTTS.............KGTLL-TFIDS.GGKVWRFRYLYWNS---..--SR..SYVLTRG
Eucgr.E01093.1|PACid:23577807  ....SSTSDK.............GLLLNFE--DR.NGKPWRFRYSYWNS---..--SQ..SYVMTKG
Eucgr.F04380.1|PACid:23585644  ....FNADPP.............VQLLSVR--DV.HGAVWNFRHIYRGT---..--PR..RHLLTTG
Eucgr.J00923.1|PACid:23598808  ....YSADPP.............VQTVIAK--DV.HGETWKFRHIYRGT---..--PR..RHLLTTG
Eucgr.L00348.1|PACid:23605637  ....SSTNEK.............GLLLNFE--DR.NGKPWRFRYSYWNS---..--SQ..SYVMTKG
Eucgr.K01240.1|PACid:23602718  ....YSVDPP.............VQTILAK--DV.HGETWKFRHIYRGT---..--PR..RHLLTTG
Eucgr.D00053.1|PACid:23573847  ....SSPTTP.............KGTLLNFI-DG.GGKVWRFRYLYWNS---..--SH..SYVLTLG
Eucgr.I01210.1|PACid:23595750  ....------.............RADIVLR--NL.EGNTWNVVCVINKNRHFfsG---..------G
Eucgr.L02216.1|PACid:23606980  ....------.............-----------.-----------------..----..-------
Eucgr.C00358.1|PACid:23569863  ....GSEAGKddaplqlrtlgldDVQLVFY--DR.SMRSWKFRYCYWSS---..--SH..SFVFTRG
Eucgr.C00358.2|PACid:23569864  ....GSEAGKddaplqlrtlgldDVQLVFY--DR.SMRSWKFRYCYWSS---..--SH..SFVFTRG
Eucgr.I01211.1|PACid:23595751  ....------.............-TNIVLR--DA.EGQTWKVAHHCN-----..--GK..RHYFSRG
Eucgr.H02901.1|PACid:23592218  ....------.............-ITLQV----S.DGKKWRVRCLLFNG---..----..KGKISKG
Eucgr.H01965.1|PACid:23591351  ....------.............-----------.-----------------..----..-------
Eucgr.D00268.3|PACid:23574034  ....------.............-----------.-----------------..----..-------
Eucgr.D00268.2|PACid:23574033  ....------.............-----------.-----------------..----..-------
Eucgr.D00268.1|PACid:23574032  ....------.............-----------.-----------------..----..-------
Eucgr.D00269.1|PACid:23574035  ....------.............-----------.-----------------..----..-------
Eucgr.I01218.1|PACid:23595758  ....CKLHMP.............RNNITVTLEDE.NGDEYPVNYIVDKT---..----..--ALSAG
Eucgr.I00406.1|PACid:23594955  ....------.............-----------.-----------------..----..-------
Eucgr.F02399.3|PACid:23583202  ....------.............----VLR--NL.KGESWTVN-------SV..PTTR..VHTSHTF
Eucgr.F02399.4|PACid:23583203  ....------.............----VLR--NL.KGESWTVN-------SV..PTTR..VHTSHTF
Eucgr.F02399.1|PACid:23583200  ....------.............----VLR--NL.KGESWTVN-------SV..PTTR..VHTSHTF
Eucgr.F02399.2|PACid:23583201  ....------.............----VLR--NL.KGESWTVN-------SV..PTTR..VHTSHTF
Eucgr.D00268.1|PACid:23574032  ....------.............-----------.---SWQVK-------LR..THEH..TACLSTG
Eucgr.D00268.3|PACid:23574034  ....------.............-----------.---SWQVK-------LR..THEH..TACLSTG
Eucgr.D00268.2|PACid:23574033  ....------.............-----------.---SWQVK-------LR..THEH..TACLSTG
Eucgr.K02760.1|PACid:23604388  ....------.............-----------.-----------------..----..------G
Eucgr.G01458.1|PACid:23587028  ....------.............--DVTITLEDE.SSKGYETK--YLGAKMGlsG---..------G
Eucgr.F02399.1|PACid:23583200  ....------.............KTEIVLR--NL.EGESWTVN-------SV..PDSK..GRMLHTF
Eucgr.F02399.2|PACid:23583201  ....------.............KTEIVLR--NL.EGESWTVN-------SV..PDSK..GRMLHTF
Eucgr.H02009.1|PACid:23591387  ....--LPNK.............DTTIVLE--DE.YGKQYEMKYIAHKTG--..----..---LSAG
Eucgr.H01651.1|PACid:23591105  ....--LPNK.............DTTIVLE--DE.YGKQYEMKYIAHKTG--..----..---LSAG
Eucgr.G00890.1|PACid:23586517  ....------.............-----------.-----------------..----..-------
Eucgr.F02399.3|PACid:23583202  ....------.............-----------.--NTWHVELIEENHEL-..----..--FLNSG
Eucgr.F02399.4|PACid:23583203  ....------.............-----------.--NTWHVELIEENHEL-..----..--FLNSG
Eucgr.G01455.1|PACid:23587025  ....------.............----TVTLVDE.DGEEFETKYLIDKNGLS..GG--..-------
Eucgr.F02399.1|PACid:23583200  ....------.............-----------.--NTWHVELIEENHEL-..----..--FLNSG
Eucgr.F02399.2|PACid:23583201  ....------.............-----------.--NTWHVELIEENHEL-..----..--FLNSG
Eucgr.F02358.1|PACid:23583166  ....------.............-----------.------FPTIYLAR---..----..KTGLSGG
Eucgr.G01236.1|PACid:23586851  ....------.............-----------.-----------------..----..NNDLVSL
Eucgr.G01245.1|PACid:23586859  ....------.............-----------.-----------------..----..------G
Eucgr.H01965.1|PACid:23591351  ....---SKG.............D--IILYVSDE.RFWSVRYKFGIYGR---..--RR..QIKFNCG
Eucgr.G00890.1|PACid:23586517  ....------.............-----------.-----------------..----..MAFLTSG
Eucgr.G01242.1|PACid:23586858  ....------.............-VLLKVP--GG.SAWTIELE---------..--TC..NNDLVSL
Eucgr.G00888.2|PACid:23586515  ....------.............-----------.-----------------..----..-------
Eucgr.D00267.1|PACid:23574031  ....------.............-----------.-----------------..----..-------
Eucgr.G00888.1|PACid:23586514  ....------.............-----------.-----------------..----..-------
Eucgr.G01517.2|PACid:23587078  ....------.............-----------.-V---------------..----..-------
Eucgr.F00044.1|PACid:23580709  ....------.............-----------.-----------------..----..-------
Eucgr.I01213.1|PACid:23595752  ....------.............-----------.-----------------..----..------G
Eucgr.G01517.1|PACid:23587077  ....------.............-----------.-V---------------..----..-------
Eucgr.H02901.1|PACid:23592218  ....V-----.............-VRLVAS--DS.SIWLVELR--KHGSRLW..----..---LHDG
Eucgr.G01245.1|PACid:23586859  ....------.............-----------.-----------------..----..-------
Eucgr.D00269.1|PACid:23574035  ....------.............-----------.-----------------..----..------G
Eucgr.G00890.1|PACid:23586517  ....------.............-----------.----W------------..----..-------
Eucgr.G00889.1|PACid:23586516  ....------.............-----------.-----------------..----..--AFSSG
Eucgr.G00888.2|PACid:23586515  ....------.............-----------.-----------------..----..-----S-
Eucgr.G00890.1|PACid:23586517  ....------.............--QLVTL--RY.SDRSWQVKLRSYGH---..--RR..MAFLSTG
Eucgr.G00888.1|PACid:23586514  ....------.............-----------.-----------------..----..-----S-
Eucgr.G01517.1|PACid:23587077  ....------.............SGFIKLQ--ST.DGKQWPVRCLYRGG---..----..RAKLSQG
Eucgr.K02197.5|PACid:23603737  ....--KQPP.............TQELAAK--DL.HGNEWRFRHIFRGQ---..--PR..RHLLQSG
Eucgr.K02197.1|PACid:23603733  ....--KQPP.............TQELAAK--DL.HGNEWRFRHIFRGQ---..--PR..RHLLQSG
Eucgr.K02197.2|PACid:23603734  ....--KQPP.............TQELAAK--DL.HGNEWRFRHIFRGQ---..--PR..RHLLQSG
Eucgr.K02197.3|PACid:23603735  ....--KQPP.............TQELAAK--DL.HGNEWRFRHIFRGQ---..--PR..RHLLQSG
Eucgr.K02197.4|PACid:23603736  ....--KQPP.............TQELAAK--DL.HGNEWRFRHIFRGQ---..--PR..RHLLQSG
Eucgr.H01962.1|PACid:23591348  ....------.............-----------.-----------------..----..-------
Eucgr.G01240.1|PACid:23586856  ....------.............---L-------.-----------------..----..-------
Eucgr.L01473.1|PACid:23606430  ....PEG---.............---LPLKVQDA.KGSEWIFQFRFWPN---..-NNS..RMYVLEG
Eucgr.G00890.1|PACid:23586517  ....------.............-----------.-----------------..----..----AAG
Eucgr.F02704.3|PACid:23583575  ....PEG---.............---LPLRIQDV.KGKEWVFQFRFWPN---..-NNS..RMYVLEG
Eucgr.F02704.1|PACid:23583573  ....PEG---.............---LPLRIQDV.KGKEWVFQFRFWPN---..-NNS..RMYVLEG
Eucgr.F02704.2|PACid:23583574  ....PEG---.............---LPLRIQDV.KGKEWVFQFRFWPN---..-NNS..RMYVLEG
Eucgr.B04027.1|PACid:23569481  ....S-----.............-EGIPVPIRDV.KGNEWTFQFRFWPN---..-NNS..RMYVLEG
Eucgr.G02345.1|PACid:23587947  ....------.............---LNFE--DV.GGKVWRFRYSYWNS---..--SQ..SYVLTKG
Eucgr.G00888.1|PACid:23586514  ....------.............-----------.-----------------..----..------G
Eucgr.I01213.1|PACid:23595752  ....YELKLP.............QAVLFH---DP.TGRTWR------GT-VK..VWTD..RRTWITG
Eucgr.E01478.1|PACid:23578191  ....PHLLKE.............DATIELE--DE.SGDVYETKYLWAKTGLS..GGW-..-------
Eucgr.A01956.1|PACid:23563774  ....------.............-----------.-----------------..--TD..SRTWITG
Eucgr.I00400.1|PACid:23594952  ....------.............-----------.-----------------..----..DHGRLSQ
Eucgr.E02078.1|PACid:23578694  ....------.............-----------.--------FVFR---CW..KSTG..SYVLNGG
Eucgr.I00397.1|PACid:23594949  ....------.............-----------.-----------------..-G--..-------
Eucgr.I00403.1|PACid:23594954  ....------.............-----------.-----------------..----..-------
Eucgr.G01240.1|PACid:23586856  ....------.............-----------.-----------------..-KYQ..GVYFSVG
Eucgr.I01210.1|PACid:23595750  ....------.............-----------.-----------------..----..-------
Eucgr.I01211.1|PACid:23595751  ....------.............-----------.-----------------..----..-------
Eucgr.G01238.2|PACid:23586854  ....------.............-----------.-----------------..-KYQ..GVYFSVG
Eucgr.G01238.1|PACid:23586853  ....------.............-----------.-----------------..-KYQ..GVYFSVG
Eucgr.E01947.1|PACid:23578601  ....EEMLRKvksk.........E-GMQVVGID-.VDTGWKHWFVFR---CW..GSSG..SYVLNGG
Eucgr.G01639.1|PACid:23587184  ....------.............-----------.---LWQVKLKSY-----..-KPRd.TAVLSTG
Eucgr.F00044.2|PACid:23580710  ....MDRRNQ.............DVILRVG----.-EGTWHAR--YRLT---..-GRG..SGGLSSG
Eucgr.F00044.1|PACid:23580709  ....MDRRNQ.............DVILRVG----.-EGTWHAR--YRLT---..-GRG..SGGLSSG
Eucgr.H01962.1|PACid:23591348  ....------.............-----------.--WLARYKFGIYG----..--RK..TQVKING
Eucgr.E03465.1|PACid:23579814  ....PEG---.............---LPLKVQDA.KGSEWIFQFRFWPN---..-NNS..RMYVLEG
Eucgr.L02178.1|PACid:23606956  ....--DDNP.............EQGVEVTT---.-----------YN----..----..------T
Eucgr.E01753.1|PACid:23578440  ....------.............-----------.-----------------..----..------S
Eucgr.L01802.1|PACid:23606676  ....------.............-----------.-----------------..----..-------
Eucgr.E02051.1|PACid:23578669  ....------.............-----------.-----------------..----..-------
Eucgr.G01238.2|PACid:23586854  ....------.............-----------.-----------------..----..-------
Eucgr.G01238.1|PACid:23586853  ....------.............-----------.-----------------..----..-------
Eucgr.G01241.1|PACid:23586857  ....------.............-----------.-----------------..----..---FSTG
Eucgr.E01934.1|PACid:23578594  ....------.............-----------.---------VF---RRW..GSSR..SYVLNSG
Eucgr.E01939.1|PACid:23578597  ....------.............-----------.---------VF---RRW..GSSR..SYVLNSG
Eucgr.E02060.1|PACid:23578677  ....------.............-----------.-----------------..----..-------
Eucgr.E02050.1|PACid:23578668  ....------.............-----------.-----------------..----..-------
Eucgr.E01948.1|PACid:23578602  ....NEMKKQvesk.........DGMKVVV--RN.ADTRREHKLVF------..----..-------
Eucgr.L02104.1|PACid:23606905  ....------.............-----------.-----------------..----..-------
Eucgr.E02057.1|PACid:23578674  ....------.............-----------.-----------------..----..------G
Eucgr.E01933.1|PACid:23578593  ....------.............-----------.-----------------..-SSR..SYVLKCG
Eucgr.E02053.1|PACid:23578671  ....Q-----.............-----------.-----------------..----..-------
Eucgr.E02048.1|PACid:23578667  etvrQVESGK.............GADVIVR--DMdTCSEHRLVFVFWAS---..--SG..SHVLKGG
Eucgr.E01937.1|PACid:23578595  ....------.............--------ADT.GDEHWLV-FRYWE----..-SSK..SYVLNGN
Eucgr.E02045.1|PACid:23578664  ....------.............-----------.-----------------..----..-------
Eucgr.E02044.1|PACid:23578663  ....------.............-----------.-----------------..----..-------
Eucgr.E03467.1|PACid:23579815  ....PEG---.............---LPLKVQNA.KGLEWIFQFKFQPN---..-NNS..RTYFLEG
Eucgr.K03433.1|PACid:23605172  ....----HP.............VQDLVTK--DL.RGNLWCFRHIYRGK---..--PE..RHLLTRG
Eucgr.L03694.1|PACid:23607997  ....------.............-----------.-----------------..----..-------
Eucgr.E02046.1|PACid:23578665  ....------.............-----------.-----------------..----..-------
Eucgr.G01246.1|PACid:23586860  ....------.............-----------.-----------------..----..RVFFTTG
Eucgr.G01240.1|PACid:23586856  ....------.............-----------.-----------------..----..-------
Eucgr.L01801.1|PACid:23606675  ....------.............-----------.-----------------..----..-------
Eucgr.E02047.1|PACid:23578666  ....------.............-----------.-----------------..----..-------
Eucgr.B02808.1|PACid:23568029  ....------.............-----------.RDGSWPVKLLYYPQ---..--HG..SGKLLAG
Eucgr.H00815.1|PACid:23590199  ....------.............-----------.--KVWNMRYRFWPN---..-NKS..RMYLLEN
Eucgr.E02029.1|PACid:23578652  ....------.............-----------.-----------------..----..-------
Eucgr.D00268.2|PACid:23574033  ....------.............-----------.-----------------..----..-------
Eucgr.E04365.1|PACid:23580648  ....------.............-----------.-----------------..----..------G
Eucgr.I00465.1|PACid:23595008  ....------.............-----------.-----------------..--PW..DHGKLSG
Eucgr.E02054.1|PACid:23578672  ....------.............-----------.-----------------..----..-------
Eucgr.E02074.1|PACid:23578692  ....------.............-----------.-----------------..----..-------
Eucgr.E04373.1|PACid:23580654  ....------.............-----------.-----------------..----..-------
Eucgr.E01944.1|PACid:23578600  ....------.............-----------.-----------------..----..-------
Eucgr.E02075.1|PACid:23578693  ....------.............-----------.-----------------..----..-------
Eucgr.D00269.1|PACid:23574035  ....----IP.............WQFIRTYIQKD.HQM---VNVVYLGQSFE..VNLRvyQHLHIAI
Eucgr.E04371.1|PACid:23580652  ....------.............-----------.-----------------..----..-------
Eucgr.F00044.2|PACid:23580710  ....------.............-----------.-----------------..----..-------
Eucgr.D00268.1|PACid:23574032  ....------.............-----------.-----------------..----..-------
Eucgr.L02216.1|PACid:23606980  ....------.............-----------.-------KFG-----IY..GRKT..QVKINSG
Eucgr.E01938.1|PACid:23578596  ....------.............-----------.-----------------..----..-------
Eucgr.E02114.1|PACid:23578703  ....------.............-----------.------LVFAYWAS---..--SR..SYVLKGC
Eucgr.C01014.1|PACid:23570587  ....------.............-----------.-----------------..--GR..SHVITSG
Eucgr.K02760.1|PACid:23604388  ....------.............-----------.-----------------..----..--SLTSG
Eucgr.E02039.1|PACid:23578658  ....------.............-----------.-----------------..----..-------
Eucgr.I00399.1|PACid:23594951  ....------.............-----------.-----------------..--PW..DHGKLSG
Eucgr.E01943.1|PACid:23578599  ....------.............-----------.--KDQEHRHVFRYWASS..---G..CYVLNGG
Eucgr.I00407.1|PACid:23594956  ....------.............-----------.---SWTVKFFNYPNYYC..GKFQ..-----SG
Eucgr.I00403.1|PACid:23594954  ....------.............-----------.KKDSWPVKLIKYRGDLG..KLSQ..------G
Eucgr.E01923.1|PACid:23578586  ....------.............-----------.-----------------..----..-------
Eucgr.E01941.1|PACid:23578598  ....------.............-----------.-----------------..----..------S
Eucgr.G01238.2|PACid:23586854  ....------.............-----------.-----------------..----..-------
Eucgr.G01238.1|PACid:23586853  ....------.............-----------.-----------------..----..-------
Eucgr.B02809.1|PACid:23568030  ....------.............-----------.--RSWTVKLLYYRQHGL..GK--..---LSAG
Eucgr.E02013.1|PACid:23578642  ....------.............S----------.-----------------..----..-------
Eucgr.I00402.1|PACid:23594953  ....------.............-----------.-----------------..--PW..DHGKLSG
Eucgr.D00268.3|PACid:23574034  ....------.............-----------.-----------------..----..------G
Eucgr.E02109.1|PACid:23578702  ....------.............-----------.-----------------..----..-------
Eucgr.E02128.1|PACid:23578709  ....------.............-----------.-----------------..----..------C
Eucgr.B02809.1|PACid:23568030  ....------.............-----------.-----------------..----..-------
Eucgr.E02134.1|PACid:23578714  ....------.............-----------.-----------------..----..SYVLKGC
Eucgr.K01123.1|PACid:23602599  ....------.............-----------.-----------------..----..-------
Eucgr.I00855.1|PACid:23595366  ....------.............-----------.-----------------..----..-------
Eucgr.L01474.1|PACid:23606431  ....------.............-----------.------FGFRFRPN---..-NNS..RMYVLDG


                                 00          110       120       130       140       150       160  
                                  |            |         |         |         |         |         |  
d1na6a1                          WGRG...SPLQDPENTGALTLLAFKLDEQGGDCKEVNIWVCASTDEEDVIETAIGEVIPGALISGPA
Eucgr.A02065.1|PACid:23563901  W-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT-------------VMPSSVLSSDS
Eucgr.A02065.2|PACid:23563902  W-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT-------------VMPSSVLSSDS
Eucgr.A02065.3|PACid:23563903  W-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT-------------VMPSSVLSSDS
Eucgr.D00264.2|PACid:23574028  W-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGVRRANRPQT-------------VMPSSVLSCDS
Eucgr.D00264.1|PACid:23574027  W-SV...FVSAKRLVAGDSVLFIWNEKNQL-LLGVRRANRPQT-------------VMPSSVLSCDS
Eucgr.F02090.1|PACid:23582845  W-SL...FVGAKRLRAGDSVLFIRDEKSQL-MVGVRRANRQQT-------------TLPSSVLSTDS
Eucgr.B02480.3|PACid:23567637  W-SV...FVSQKNLVSGDAVLFLRGEDGEL-RLGIRRAHRPRN-------------VLPGSTV----
Eucgr.B02480.2|PACid:23567636  W-SV...FVSQKNLVSGDAVLFLRGEDGEL-RLGIRRAHRPRN-------------VLPGSTV----
Eucgr.B02480.1|PACid:23567635  W-SV...FVSQKNLVSGDAVLFLRGEDGEL-RLGIRRAHRPRN-------------VLPGSTV----
Eucgr.C03293.1|PACid:23572724  W-SV...FVSTKRLFAGDSVLFIRDEKSQL-LLGIRRANRQQP-------------ALSSSVISSDS
Eucgr.C03293.2|PACid:23572725  W-SV...FVSTKRLFAGDSVLFIRDEKSQL-LLGIRRANRQQP-------------ALSSSVISSDS
Eucgr.G00076.4|PACid:23585851  W-SV...FVSSKKLIAGDAFIFLRGEDGEL-RVGVRRLMRQQS-------------NMPSSVISSHS
Eucgr.C02178.2|PACid:23571668  W-SL...FVSGKRLFAGDSVLFIRDDKQQL-LLGIRRANRQPT-------------NLSSSVLSSDS
Eucgr.G00076.3|PACid:23585850  W-SV...FVSSKKLIAGDAFIFLRGEDGEL-RVGVRRLMRQQS-------------NMPSSVISSHS
Eucgr.C02178.1|PACid:23571667  W-SL...FVSGKRLFAGDSVLFIRDDKQQL-LLGIRRANRQPT-------------NLSSSVLSSDS
Eucgr.G00076.1|PACid:23585848  W-SV...FVSSKKLIAGDAFIFLRGEDGEL-RVGVRRLMRQQS-------------NMPSSVISSHS
Eucgr.G00076.2|PACid:23585849  W-SV...FVSSKKLIAGDAFIFLRGEDGEL-RVGVRRLMRQQS-------------NMPSSVISSHS
Eucgr.D00588.1|PACid:23574345  W-SA...FVNRKKLVSGDAVLFLRASNGEL-RLGVRRAI----------------------------
Eucgr.D00588.2|PACid:23574346  W-SA...FVNRKKLVSGDAVLFLRASNGEL-RLGVRRAI----------------------------
Eucgr.E00888.2|PACid:23577619  W-ST...FVTSKRLVAGDSFVFLRGDNGEL-RVGVKRVARQQS-------------SMPSSVISSQS
Eucgr.E00888.1|PACid:23577618  W-ST...FVTSKRLVAGDSFVFLRGDNGEL-RVGVKRVARQQS-------------SMPSSVISSQS
Eucgr.D01764.1|PACid:23575524  W-ST...FVTSKRLVAGDSFVFLRGESGEL-RVGVRRMARQQS-------------TMPASVISSQS
Eucgr.B03551.1|PACid:23568902  W-SL...FVSSKKLVAGDAFIFLRGENGEL-RVGVRRAMRQLN-------------NVPSSIMPSHS
Eucgr.A02625.1|PACid:23564572  W-SR...FVKDKRLDAGDVVLFHRDRADA--------------------------------------
Eucgr.B03050.1|PACid:23568282  W-TR...FVKEKSLRTGDIVSFHRSAGPEK-------------------------------------
Eucgr.B03048.1|PACid:23568281  W-SR...FVKEKGLTAGDIVSFHQSAGP---------------------------------------
Eucgr.G02838.1|PACid:23588588  W-GN...FVNQKKLVAGDSIVFLRAENGDL-CVGIRRA-----------------------------
Eucgr.L01673.1|PACid:23606585  W-SR...FVKEKSLRAGDIISFHRSAGPE--------------------------------------
Eucgr.E01093.1|PACid:23577807  W-SR...FVKEKKLDAGDIVSFQRGAGESG-------------------------------------
Eucgr.F04380.1|PACid:23585644  W-SK...FVNNKKLVAGDSVVFMKNSKGDM-FVGIRRAVRNSG------------------------
Eucgr.J00923.1|PACid:23598808  W-ST...FVNQKKLVAGDSIVFLRAENGDL-CVGIRRAKRGI-------------------------
Eucgr.L00348.1|PACid:23605637  W-SR...FVKEKKLDAGDIVSFQRGVGEFG-------------------------------------
Eucgr.K01240.1|PACid:23602718  W-ST...FVNHKKLVAGDSIVFMRAENGDL-CVGIRRA-----------------------------
Eucgr.D00053.1|PACid:23573847  W-SR...FVKEKSLRAGDIISFHQSAGPE--------------------------------------
Eucgr.I01210.1|PACid:23595750  W-PA...FIQDNKLGTGDICVFELISSKEF-------------------------------------
Eucgr.L02216.1|PACid:23606980  ----...------------------------------------------------------------
Eucgr.C00358.1|PACid:23569863  W-NR...FVKEKELRANDTVAFYMC------------------------------------------
Eucgr.C00358.2|PACid:23569864  W-NR...FVKEKELRANDTVAFYMC------------------------------------------
Eucgr.I01211.1|PACid:23595751  W-RA...FLYDNELKIGDVCIFEVRNKKEV-------------------------------------
Eucgr.H02901.1|PACid:23592218  W-RE...FVADNKLEIGDVCIFELLQREDI-------------------------------------
Eucgr.H01965.1|PACid:23591351  ----...------------------------------------------------------------
Eucgr.D00268.3|PACid:23574034  ---W...------------------------------------------------------------
Eucgr.D00268.2|PACid:23574033  ---W...------------------------------------------------------------
Eucgr.D00268.1|PACid:23574032  ---W...------------------------------------------------------------
Eucgr.D00269.1|PACid:23574035  ----...--FMEHYSIGHGHLLVFKY-----------------------------------------
Eucgr.I01218.1|PACid:23595758  W-KK...FSSARELMEGDVLVFQLVR-----------------------------------------
Eucgr.I00406.1|PACid:23594955  ----...------------------------------------------------------------
Eucgr.F02399.3|PACid:23583202  CGGW...------------------------------------------------------------
Eucgr.F02399.4|PACid:23583203  CGGW...------------------------------------------------------------
Eucgr.F02399.1|PACid:23583200  CGGW...------------------------------------------------------------
Eucgr.F02399.2|PACid:23583201  CGGW...------------------------------------------------------------
Eucgr.D00268.1|PACid:23574032  W-SS...FARENDLLVGDCCVFELIDRDDI-------------------------------------
Eucgr.D00268.3|PACid:23574034  W-SS...FARENDLLVGDCCVFELIDRDDI-------------------------------------
Eucgr.D00268.2|PACid:23574033  W-SS...FARENDLLVGDCCVFELIDRDDI-------------------------------------
Eucgr.K02760.1|PACid:23604388  W-NA...FSRDHGLEVGYFLLF---------------------------------------------
Eucgr.G01458.1|PACid:23587028  W-RG...FSIAHNLQEGDALVFQLVKP----------------------------------------
Eucgr.F02399.1|PACid:23583200  CGGWls.FVRGNGIKIGDTCIFEL-------------------------------------------
Eucgr.F02399.2|PACid:23583201  CGGWls.FVRGNGIKIGDTCIFEL-------------------------------------------
Eucgr.H02009.1|PACid:23591387  W-RQ...FSVGHNLLEGDVLVFQLVEPNKF-------------------------------------
Eucgr.H01651.1|PACid:23591105  W-RQ...FSVGHNLLEGDVLVFQLVEPNKF-------------------------------------
Eucgr.G00890.1|PACid:23586517  ----...------------------------------------------------------------
Eucgr.F02399.3|PACid:23583202  W-HS...FIRDHSIVSGDLLVFRHDGN----------------------------------------
Eucgr.F02399.4|PACid:23583203  W-HS...FIRDHSIVSGDLLVFRHDGN----------------------------------------
Eucgr.G01455.1|PACid:23587025  W-RG...FSIAHDLVDGDALVFQL-------------------------------------------
Eucgr.F02399.1|PACid:23583200  W-HS...FIRDHSIVSGDLLVFRHDGN----------------------------------------
Eucgr.F02399.2|PACid:23583201  W-HS...FIRDHSIVSGDLLVFRHDGN----------------------------------------
Eucgr.F02358.1|PACid:23583166  W-KG...FSVAHELTDGDAVVFQLIKP----------------------------------------
Eucgr.G01236.1|PACid:23586851  WKGW...REFMEHYSIGHGHLIVFKYKGNSTF-----------------------------------
Eucgr.G01245.1|PACid:23586859  W-PA...FARENCLHVGDVCMFELIDR----------------------------------------
Eucgr.H01965.1|PACid:23591351  W-KR...FVQDNNLKLGDVCVFEIMWK----------------------------------------
Eucgr.G00890.1|PACid:23586517  W-PS...FTRETGLRLGDVCVFELIDRDDI-------------------------------------
Eucgr.G01242.1|PACid:23586858  WKGW...REFMEHYSIGHGHLIVFKYKGNSTF-----------------------------------
Eucgr.G00888.2|PACid:23586515  ----...------------------------------------------------------------
Eucgr.D00267.1|PACid:23574031  ----...------------------------------------------------------------
Eucgr.G00888.1|PACid:23586514  ----...------------------------------------------------------------
Eucgr.G01517.2|PACid:23587078  ----...------------------------------------------------------------
Eucgr.F00044.1|PACid:23580709  ----...------------------------------------------------------------
Eucgr.I01213.1|PACid:23595752  W-QE...FVRE--------------------------------------------------------
Eucgr.G01517.1|PACid:23587077  ----...------------------------------------------------------------
Eucgr.H02901.1|PACid:23592218  W-QR...FLEHHSIHSGHFLIFK--------------------------------------------
Eucgr.G01245.1|PACid:23586859  ----...------------------------------------------------------------
Eucgr.D00269.1|PACid:23574035  W-SS...FARETGLLLGDCCVFELIDRDDI-------------------------------------
Eucgr.G00890.1|PACid:23586517  ----...------------------------------------------------------------
Eucgr.G00889.1|PACid:23586516  W-GA...FVRGTRLHVGNVCVFELIDRDDI-------------------------------------
Eucgr.G00888.2|PACid:23586515  ----...------------------------------------------------------------
Eucgr.G00890.1|PACid:23586517  W-SS...FVRETGLHVSDVCVFELIDRNDI-------------------------------------
Eucgr.G00888.1|PACid:23586514  ----...------------------------------------------------------------
Eucgr.G01517.1|PACid:23587077  W-YD...FSLENNLEEGDVCVFELMRARE--------------------------------------
Eucgr.K02197.5|PACid:23603737  W-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMKQQG-------------NVSPSVISSHS
Eucgr.K02197.1|PACid:23603733  W-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMKQQG-------------NVSPSVISSHS
Eucgr.K02197.2|PACid:23603734  W-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMKQQG-------------NVSPSVISSHS
Eucgr.K02197.3|PACid:23603735  W-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMKQQG-------------NVSPSVISSHS
Eucgr.K02197.4|PACid:23603736  W-SV...FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMKQQG-------------NVSPSVISSHS
Eucgr.H01962.1|PACid:23591348  ----...---------------------------------------------T--------------
Eucgr.G01240.1|PACid:23586856  ----...------------------------------------------------------------
Eucgr.L01473.1|PACid:23606430  V-TP...CIQSMQLQAGDIVTFSRLEPEGKLVMGFR-------------------------------
Eucgr.G00890.1|PACid:23586517  W-SA...FVREARLCIGDACVFELIDRDNI-------------------------------------
Eucgr.F02704.3|PACid:23583575  V-TP...CIQSMQLQAGDTVTFSRMDPEAKLIMGFRK------------------------------
Eucgr.F02704.1|PACid:23583573  V-TP...CIQSMQLQAGDTVTFSRMDPEAKLIMGFRK------------------------------
Eucgr.F02704.2|PACid:23583574  V-TP...CIQSMQLQAGDTVTFSRMDPEAKLIMGFRK------------------------------
Eucgr.B04027.1|PACid:23569481  V-TP...CIQSMQLRAGDTVIFSKIDPGGKLIMGFR-------------------------------
Eucgr.G02345.1|PACid:23587947  W-SR...FVKEKSLKAGDTVCFQRSTGPDK-------------------------------------
Eucgr.G00888.1|PACid:23586514  W-RA...FARETHLCEGNVCVF---------------------------------------------
Eucgr.I01213.1|PACid:23595752  WGAL...C-RH--------------------------------------------------------
Eucgr.E01478.1|PACid:23578191  --RG...FSIAHSIMEGNAVVFQLVM-----------------------------------------
Eucgr.A01956.1|PACid:23563774  W-EA...L-----------------------------------------------------------
Eucgr.I00400.1|PACid:23594952  GWFA...FARATSLCEGDVCVFELTKPSPT-------------------------------------
Eucgr.E02078.1|PACid:23578694  WTKE...FVEEKRLKVGDEIEMVWVMSSRM-------------------------------------
Eucgr.I00397.1|PACid:23594949  W-LM...FARETFLRRGDACVFELVEK----------------------------------------
Eucgr.I00403.1|PACid:23594954  ----...------------------------------------------------------------
Eucgr.G01240.1|PACid:23586856  W-KE...FARETHLCVGNICMFELIDSD---------------------------------------
Eucgr.I01210.1|PACid:23595750  ----...------------------------------------------------------------
Eucgr.I01211.1|PACid:23595751  ----...F-----------------------------------------------------------
Eucgr.G01238.2|PACid:23586854  W-KE...FARETHLCVGNICMFELIDSDD--------------------------------------
Eucgr.G01238.1|PACid:23586853  W-KE...FARETHLCVGNICMFELIDSDD--------------------------------------
Eucgr.E01947.1|PACid:23578601  WTKE...FVEKKRLKVGDEIGMVWFMSSRM-------------------------------------
Eucgr.G01639.1|PACid:23587184  W-SL...FARETGLRARDVCVFELTDRDNI-------------------------------------
Eucgr.F00044.2|PACid:23580710  W-KN...FTLENNLEQSDVCVFN--------------------------------------------
Eucgr.F00044.1|PACid:23580709  W-KN...FTLENNLEQSDVCVFN--------------------------------------------
Eucgr.H01962.1|PACid:23591348  GWKL...FVQDNNLKVGDVCVFELTRK----------------------------------------
Eucgr.E03465.1|PACid:23579814  V-TP...CIQSMQLQAGDIVTFSRLEPEGKLVMGFR-------------------------------
Eucgr.L02178.1|PACid:23606956  LGET...FPMQFKMWSGKVYVLMRNWKEFA-------------------------------------
Eucgr.E01753.1|PACid:23578440  W-KQ...FVDDNHLKAGDACVFE--------------------------------------------
Eucgr.L01802.1|PACid:23606676  ----...------------------------------------------------------------
Eucgr.E02051.1|PACid:23578669  ----...------------------------------------------------------------
Eucgr.G01238.2|PACid:23586854  ----...REFMEHYSIGHGHFIVFKYKEN--------------------------------------
Eucgr.G01238.1|PACid:23586853  ----...REFMEHYSIGHGHFIVFKYKEN--------------------------------------
Eucgr.G01241.1|PACid:23586857  W-CV...FARETDLHAGNVCSFELID-----------------------------------------
Eucgr.E01934.1|PACid:23578594  WTKL...FVKRQGLKVGDEVGMCWDKGS---------------------------------------
Eucgr.E01939.1|PACid:23578597  WTKL...FVKRQGLKVGDEVGMCWDKGS---------------------------------------
Eucgr.E02060.1|PACid:23578677  ----...------------------------------------------------------------
Eucgr.E02050.1|PACid:23578668  ----...------------------------------------------------------------
Eucgr.E01948.1|PACid:23578602  ----...------------------------------------------------------------
Eucgr.L02104.1|PACid:23606905  ----...------------------------------------------------------------
Eucgr.E02057.1|PACid:23578674  WIKE...FVKRRGLVAGDEVGIYWDPF----------------------------------------
Eucgr.E01933.1|PACid:23578593  WTNL...FVKRRGLEVGDEIGIYWDK-----------------------------------------
Eucgr.E02053.1|PACid:23578671  ----...------------------------------------------------------------
Eucgr.E02048.1|PACid:23578667  WIKE...FVKRRGLAAGDEVGIYW-------------------------------------------
Eucgr.E01937.1|PACid:23578595  WNKP...FVKGRELKVGDEIGMFWD------------------------------------------
Eucgr.E02045.1|PACid:23578664  ----...------------------------------------------------------------
Eucgr.E02044.1|PACid:23578663  ----...------------------------------------------------------------
Eucgr.E03467.1|PACid:23579815  V-TP...CIQSMQLQAGDIVTFSRLEPEG--------------------------------------
Eucgr.K03433.1|PACid:23605172  W-SD...FLTSKKLVTGDACIFLSGRDGDV-RIGVRRLM----------------------------
Eucgr.L03694.1|PACid:23607997  ----...------------------------------------------------------------
Eucgr.E02046.1|PACid:23578665  ----...--------------------------------Q---------------------------
Eucgr.G01246.1|PACid:23586860  W-TA...FARETHMRMGNLCVFELIDRDDV-------------------------------------
Eucgr.G01240.1|PACid:23586856  ---S...FGRSNRHVRGALCLFFSAG-----------------------------------------
Eucgr.L01801.1|PACid:23606675  ----...------------------------------------------------------------
Eucgr.E02047.1|PACid:23578666  ----...------------------------------------------------------------
Eucgr.B02808.1|PACid:23568029  W-AS...FHRGTYLKEGDVCLFELVRIDNV-------------------------------------
Eucgr.H00815.1|PACid:23590199  T-GD...FVRANGLEEGDFIVIYSDV-----------------------------------------
Eucgr.E02029.1|PACid:23578652  WIKE...FVKRRGLVAGDEVGIYWDPS----------------------------------------
Eucgr.D00268.2|PACid:23574033  W-SA...LAREAHLREGDVCMFELLDRDN--------------------------------------
Eucgr.E04365.1|PACid:23580648  WIKE...FVKRRGLAAGDEVGIYWDP-----------------------------------------
Eucgr.I00465.1|PACid:23595008  W-FP...FARATSLCEGDVCVFE--------------------------------------------
Eucgr.E02054.1|PACid:23578672  ----...--------------------------------------------R---------------
Eucgr.E02074.1|PACid:23578692  ----...------------------------------------------------------------
Eucgr.E04373.1|PACid:23580654  ----...------------------------------------------------------------
Eucgr.E01944.1|PACid:23578600  ----...-------------------------------------T----------------------
Eucgr.E02075.1|PACid:23578693  ----...------------------------------------------------------------
Eucgr.D00269.1|PACid:23574035  LGVGwsaLAREAHLRKGDVCMFELLDRDNI-------------------------------------
Eucgr.E04371.1|PACid:23580652  ----...------------------------------------------------------------
Eucgr.F00044.2|PACid:23580710  ---D...FVKDHALEKNDILVFRYN------------------------------------------
Eucgr.D00268.1|PACid:23574032  W-SA...LAREAHLREGDVCMFELLDRDN--------------------------------------
Eucgr.L02216.1|PACid:23606980  W-KL...FVQDNNLKVGDICIFELLDSDL--------------------------------------
Eucgr.E01938.1|PACid:23578596  ----...------------------------------------------V-----------------
Eucgr.E02114.1|PACid:23578703  WMKV...FVQRRGLAEGDKIGIYWDP-----------------------------------------
Eucgr.C01014.1|PACid:23570587  W-NL...FVKDNRLEVSDIVR----------------------------------------------
Eucgr.K02760.1|PACid:23604388  W-DG...FRQANGIQRGDDCVFQ--------------------------------------------
Eucgr.E02039.1|PACid:23578658  ----...------------------------------------------------------------
Eucgr.I00399.1|PACid:23594951  W-FP...FARATSVCEGDVCVFELTKRSPT-------------------------------------
Eucgr.E01943.1|PACid:23578599  WSEL...FVNGGDLNVGDEIGMYWNTNSCKFHFKVLRKV----------------------------
Eucgr.I00407.1|PACid:23594956  W-AM...FASDNSLSAGDVCVFEMIKKTPL-------------------------------------
Eucgr.I00403.1|PACid:23594954  W-FA...FARATSLCEGDVCVLELTKPS---------------------------------------
Eucgr.E01923.1|PACid:23578586  ----...--------T---------------------------------------------------
Eucgr.E01941.1|PACid:23578598  WKPQ...FVIRRRLVVGDEIGMFWDEREQM-------------------------------------
Eucgr.G01238.2|PACid:23586854  ----...----NRHVRGALCLF---------------------------------------------
Eucgr.G01238.1|PACid:23586853  ----...----NRHVRGALCLF---------------------------------------------
Eucgr.B02809.1|PACid:23568030  W-SA...FQRGTSLKEGDVCVF---------------------------------------------
Eucgr.E02013.1|PACid:23578642  ----...------------------------------------------------------------
Eucgr.I00402.1|PACid:23594953  W-FP...FSRATSLCEGDVCVFE--------------------------------------------
Eucgr.D00268.3|PACid:23574034  W-SA...LAREAHLRKGDVCMFELLDRDNI-------------------------------------
Eucgr.E02109.1|PACid:23578702  ----...--------------------------------R---------------------------
Eucgr.E02128.1|PACid:23578709  WMKE...FVQRRGLAEGDEIRIHWDP-----------------------------------------
Eucgr.B02809.1|PACid:23568030  ----...------------------------------------------------------------
Eucgr.E02134.1|PACid:23578714  WTKE...FVQRRGLAEG--------------------------------------------------
Eucgr.K01123.1|PACid:23602599  ----...----------------------------------D-------------------------
Eucgr.I00855.1|PACid:23595366  ----...------------------------------------------------------------
Eucgr.L01474.1|PACid:23606431  V-TP...CIQSMQLQAGDTVTFSRLEPEGKLVMGF--------------------------------


                                      170                                                           
                                        |                                                           
d1na6a1                          GQILGGLSLQQ--ap....................................................
Eucgr.A02065.1|PACid:23563901  MHIGLLAAAAH--a.....................................................
Eucgr.A02065.2|PACid:23563902  MHIGLLAAAAH--a.....................................................
Eucgr.A02065.3|PACid:23563903  MHIGLLAAAAH--a.....................................................
Eucgr.D00264.2|PACid:23574028  MHLGLLAAAAH--a.....................................................
Eucgr.D00264.1|PACid:23574027  MHLGLLAAAAH--a.....................................................
Eucgr.F02090.1|PACid:23582845  MHIGILAAAAH--a.....................................................
Eucgr.B02480.3|PACid:23567637  -------------geqn..................................................
Eucgr.B02480.2|PACid:23567636  -------------geqn..................................................
Eucgr.B02480.1|PACid:23567635  -------------geqn..................................................
Eucgr.C03293.1|PACid:23572724  MHIGILAAAAH--a.....................................................
Eucgr.C03293.2|PACid:23572725  MHIGILAAAAH--a.....................................................
Eucgr.G00076.4|PACid:23585851  MHLGVLATASH--a.....................................................
Eucgr.C02178.2|PACid:23571668  MHIGILAAAAH--a.....................................................
Eucgr.G00076.3|PACid:23585850  MHLGVLATASH--a.....................................................
Eucgr.C02178.1|PACid:23571667  MHIGILAAAAH--a.....................................................
Eucgr.G00076.1|PACid:23585848  MHLGVLATASH--a.....................................................
Eucgr.G00076.2|PACid:23585849  MHLGVLATASH--a.....................................................
Eucgr.D00588.1|PACid:23574345  -------------qvkg..................................................
Eucgr.D00588.2|PACid:23574346  -------------qvkg..................................................
Eucgr.E00888.2|PACid:23577619  MHLGVLATASH--a.....................................................
Eucgr.E00888.1|PACid:23577618  MHLGVLATASH--a.....................................................
Eucgr.D01764.1|PACid:23575524  MHLGVLATASH--a.....................................................
Eucgr.B03551.1|PACid:23568902  MHIGVLATAWH--a.....................................................
Eucgr.A02625.1|PACid:23564572  -------------erlfigwrrrge..........................................
Eucgr.B03050.1|PACid:23568282  -------------qlhikcmrrs............................................
Eucgr.B03048.1|PACid:23568281  -------------ekqlhigyr.............................................
Eucgr.G02838.1|PACid:23588588  -------------kr....................................................
Eucgr.L01673.1|PACid:23606585  -------------kqlhinymr.............................................
Eucgr.E01093.1|PACid:23577807  -------------kdrlyidwr.............................................
Eucgr.F04380.1|PACid:23585644  -------------vdcarwre..............................................
Eucgr.J00923.1|PACid:23598808  -------------ggesq.................................................
Eucgr.L00348.1|PACid:23605637  -------------kdrlfidwrrrp..........................................
Eucgr.K01240.1|PACid:23602718  -------------kr....................................................
Eucgr.D00053.1|PACid:23573847  -------------kqfhinymr.............................................
Eucgr.I01210.1|PACid:23595750  -------------rvtifrs...............................................
Eucgr.L02216.1|PACid:23606980  -------------nlsdlvflqvpsgqawevelvrrtdgvwlrrgwpdfvkhyaikhghflvfryeg
Eucgr.C00358.1|PACid:23569863  -------------eyr...................................................
Eucgr.C00358.2|PACid:23569864  -------------eyr...................................................
Eucgr.I01211.1|PACid:23595751  -------------qvhiyrl...............................................
Eucgr.H02901.1|PACid:23592218  -------------vlkvtifrv.............................................
Eucgr.H01965.1|PACid:23591351  -------------sdlvflhlasgdvwevellrgndgaflrrgwpdfvkhyaiehghflvfryeggs
Eucgr.D00268.3|PACid:23574034  -------------rgfmehysighghllvfkyegdsvfhviifdks.....................
Eucgr.D00268.2|PACid:23574033  -------------rgfmehysighghllvfkyegdsvfhviifdks.....................
Eucgr.D00268.1|PACid:23574032  -------------rgfmehysighghllvfkyegdsvfhviifdks.....................
Eucgr.D00269.1|PACid:23574035  -------------kgdsvfhviifdks........................................
Eucgr.I01218.1|PACid:23595758  -------------asvfkvhivrg...........................................
Eucgr.I00406.1|PACid:23594955  -------------gnrlpnqlllkvagdgnwpvelekcdgrvwickgwrnfmdyysidhghlivfrl
Eucgr.F02399.3|PACid:23583202  -------------mafvrangieledvcvfelvrkcemrvhilg.......................
Eucgr.F02399.4|PACid:23583203  -------------mafvrangieledvcvfelvrkcemrvhilg.......................
Eucgr.F02399.1|PACid:23583200  -------------mafvrangieledvcvfelvrkcemrvhilg.......................
Eucgr.F02399.2|PACid:23583201  -------------mafvrangieledvcvfelvrkcemrvhilg.......................
Eucgr.D00268.1|PACid:23574032  -------------vfrvsifrsdg...........................................
Eucgr.D00268.3|PACid:23574034  -------------vfrvsifrsd............................................
Eucgr.D00268.2|PACid:23574033  -------------vfrvsifrsd............................................
Eucgr.K02760.1|PACid:23604388  -------------yylgshfrvdiydrtgc.....................................
Eucgr.G01458.1|PACid:23587028  -------------trfkvyivrrs...........................................
Eucgr.F02399.1|PACid:23583200  -------------vgklemrvhise..........................................
Eucgr.F02399.2|PACid:23583201  -------------vgklemrvhise..........................................
Eucgr.H02009.1|PACid:23591387  -------------kvyiika...............................................
Eucgr.H01651.1|PACid:23591105  -------------kvyiika...............................................
Eucgr.G00890.1|PACid:23586517  ---------K---veggltwpvkleksedgmvwlwkgwrkfmehysigfghllvfryegdsvfrvii
Eucgr.F02399.3|PACid:23583202  -------------lhfyvqvfeqssc.........................................
Eucgr.F02399.4|PACid:23583203  -------------lhfyvqvfeqssc.........................................
Eucgr.G01455.1|PACid:23587025  -------------iqpltfkcvpfg..........................................
Eucgr.F02399.1|PACid:23583200  -------------lhfyvqvfeqssc.........................................
Eucgr.F02399.2|PACid:23583201  -------------lhfyvqvfeqssc.........................................
Eucgr.F02358.1|PACid:23583166  -------------ttmkvyiirvng..........................................
Eucgr.G01236.1|PACid:23586851  -------------hviifdks..............................................
Eucgr.G01245.1|PACid:23586859  -------------edfvfevsifcs..........................................
Eucgr.H01965.1|PACid:23591351  -------------vhqisfrvlifran........................................
Eucgr.G00890.1|PACid:23586517  -------------vfrvsifssd............................................
Eucgr.G01242.1|PACid:23586858  -------------hviifdks..............................................
Eucgr.G00888.2|PACid:23586515  -------------ygkdlsslvllevlgnstwsmgveklndgtvwlwkgwqefmqhysigpghlvvf
Eucgr.D00267.1|PACid:23574031  -------------gnhlsslaflkvslgsnwpielkkcnngtvwlqkgwrefmeyysighghlivfk
Eucgr.G00888.1|PACid:23586514  -------------ygkdlsslvllevlgnstwsmgveklndgtvwlwkgwqefmqhysigpghlvvf
Eucgr.G01517.2|PACid:23587078  -------------whvgirksesklwfhegwqefvqhysigigyflvfryeggttfqvfiyn.....
Eucgr.F00044.1|PACid:23580709  -------------penvvlkgpsgatwkvgtvaddenllfkhgwqdfvkdhalekndilvfrynges
Eucgr.I01213.1|PACid:23595752  -------------nlvetndymvfsyqspgvfrvviyghsac.........................
Eucgr.G01517.1|PACid:23587077  -------------whvgirksesklwfhegwqefvqhysigigyflvfryeggttfqvfiyn.....
Eucgr.H02901.1|PACid:23592218  -------------yegdstfhvyvyn.........................................
Eucgr.G01245.1|PACid:23586859  -------------gkdlsnsvllqvpggstwtielekcnndmvslwkgwqdfmeyysighghlivfk
Eucgr.D00269.1|PACid:23574035  -------------vfrvsifrsd............................................
Eucgr.G00890.1|PACid:23586517  -------------qvklrsfehrgtaflsngwcsfvretglrlrdvcvfelidrddivfsvyifksd
Eucgr.G00889.1|PACid:23586516  -------------vfrvyifssk............................................
Eucgr.G00888.2|PACid:23586515  -------------gwiafvrgthlrvgnvcvfelidrddivfrvyifs...................
Eucgr.G00890.1|PACid:23586517  -------------mfrv..................................................
Eucgr.G00888.1|PACid:23586514  -------------gwiafvrgthlrvgnvcvfelidrddivfrvyifs...................
Eucgr.G01517.1|PACid:23587077  -------------vvlqvtvfr.............................................
Eucgr.K02197.5|PACid:23603737  MHLGVLATAWH--a.....................................................
Eucgr.K02197.1|PACid:23603733  MHLGVLATAWH--a.....................................................
Eucgr.K02197.2|PACid:23603734  MHLGVLATAWH--a.....................................................
Eucgr.K02197.3|PACid:23603735  MHLGVLATAWH--a.....................................................
Eucgr.K02197.4|PACid:23603736  MHLGVLATAWH--a.....................................................
Eucgr.H01962.1|PACid:23591348  -------------dgvwlrrgwpdfvkhyaikhghflvfryeggsafrvvifdks............
Eucgr.G01240.1|PACid:23586856  -------------kvpgsstwtielekhnhdmvllgkgwrefmehysighghfivfkykenstfrvi
Eucgr.L01473.1|PACid:23606430  -------------k.....................................................
Eucgr.G00890.1|PACid:23586517  -------------vfrisif...............................................
Eucgr.F02704.3|PACid:23583575  -------------as....................................................
Eucgr.F02704.1|PACid:23583573  -------------as....................................................
Eucgr.F02704.2|PACid:23583574  -------------as....................................................
Eucgr.B04027.1|PACid:23569481  -------------ka....................................................
Eucgr.G02345.1|PACid:23587947  -------------qlyid.................................................
Eucgr.G00888.1|PACid:23586514  -------------elidrddvvfkvsifss.....................................
Eucgr.I01213.1|PACid:23595752  -------------nnlkindrcicelleengvtdriikvhiig........................
Eucgr.E01478.1|PACid:23578191  -------------ptqf..................................................
Eucgr.A01956.1|PACid:23563774  -------------crhtnlkkndwcicelleengvagciikvhiig.....................
Eucgr.I00400.1|PACid:23594952  -------------vlevsifrns............................................
Eucgr.E02078.1|PACid:23578694  -------------fhfkvl................................................
Eucgr.I00397.1|PACid:23594949  -------------nrvvfevsifrrs.........................................
Eucgr.I00403.1|PACid:23594954  -------------hgndipgsvflkvpsstilwpvemewsdgmarlgqgwqkftdyysigfgqllvf
Eucgr.G01240.1|PACid:23586856  -------------dvvfqvsvfs............................................
Eucgr.I01210.1|PACid:23595750  -------------ihdgwrefhmdnslgnkefllfeyngkrsfevdifdpt................
Eucgr.I01211.1|PACid:23595751  -------------yrdnalgnseflifwydgkkyfnvqvfdpt........................
Eucgr.G01238.2|PACid:23586854  -------------vvfqvsvfs.............................................
Eucgr.G01238.1|PACid:23586853  -------------vvfqvsvfs.............................................
Eucgr.E01947.1|PACid:23578601  -------------fyfkvl................................................
Eucgr.G01639.1|PACid:23587184  -------------vfevsifssd............................................
Eucgr.F00044.2|PACid:23580710  -------------ladsiskniildvtifr.....................................
Eucgr.F00044.1|PACid:23580709  -------------ladsiskniildvtifr.....................................
Eucgr.H01962.1|PACid:23591348  -------------vgqvsfrvvifran........................................
Eucgr.E03465.1|PACid:23579814  -------------k.....................................................
Eucgr.L02178.1|PACid:23606956  -------------renklkesdtlniwafrnvqmkrlcfvisrtpk.....................
Eucgr.E01753.1|PACid:23578440  -------------lmeclstkvt............................................
Eucgr.L01802.1|PACid:23606676  -------------wmneetvrqvesskgadvivrdmdtcsehrlvfvfwassgsyvlkggwikefvk
Eucgr.E02051.1|PACid:23578669  -------------neetvrqvesskgadvivrdmdtcsehrmvfvfwassgshvfkggwikefvkrr
Eucgr.G01238.2|PACid:23586854  -------------stfrviifdksasemdys....................................
Eucgr.G01238.1|PACid:23586853  -------------stfrviifdksasemdys....................................
Eucgr.G01241.1|PACid:23586857  -------------rdetvfkvsilr..........................................
Eucgr.E01934.1|PACid:23578594  -------------rkfyfkv...............................................
Eucgr.E01939.1|PACid:23578597  -------------rkfyfkv...............................................
Eucgr.E02060.1|PACid:23578677  -------------rwmneetvrqvesgegadvivrdldtcsehrlvfvfwassgsyvlkggwikefv
Eucgr.E02050.1|PACid:23578668  -------------lrwmseetvrqvesgrgadvivrdldtcsehrlvfvfwassgsyvlkggwikef
Eucgr.E01948.1|PACid:23578602  -------------rrwgspgtyvlnggwhklfvkerelevgheigmfwdkyerkffitvhr......
Eucgr.L02104.1|PACid:23606905  -------------eetvrqvesgkgadvivrdmdtgsehrlvfvfwassgsyalkggwikefvkrra
Eucgr.E02057.1|PACid:23578674  -------------askfhfsvlrk...........................................
Eucgr.E01933.1|PACid:23578593  -------------skfhftvhr.............................................
Eucgr.E02053.1|PACid:23578671  -------------vengkgadvivrdmdtgsehrlvfvfwassgcyalkggwikefvkrralevgde
Eucgr.E02048.1|PACid:23578667  -------------daiaskfhfsvlrk........................................
Eucgr.E01937.1|PACid:23578595  -------------tvsckfhfsvlr..........................................
Eucgr.E02045.1|PACid:23578664  -------------lrwmseemvrqvesgkgadvivrdmdtcsehrlvfvfwassgcyvlkggwikef
Eucgr.E02044.1|PACid:23578663  -------------lrwmseetvrqvesskgadvivrdmdtcsehrlvfvfwassgsyvlkggwikef
Eucgr.E03467.1|PACid:23579815  -------------klvm..................................................
Eucgr.K03433.1|PACid:23605172  -------------ksq...................................................
Eucgr.L03694.1|PACid:23607997  -------------lrwmseetvrqvesgrgadvivrdldtcsehrlvfvfwassgsyvlkggwikef
Eucgr.E02046.1|PACid:23578665  -------------vesgkgadvivrdmdtgsehrlvfvfwassgcyalkggwikefvkrralevgde
Eucgr.G01246.1|PACid:23586860  -------------vfqvsnfs..............................................
Eucgr.G01240.1|PACid:23586856  -------------wdafarethlhigdvcmfklidrddivfevsv......................
Eucgr.L01801.1|PACid:23606675  -------------lrwmseetvrqvesgkgadvivrdvdtcsenglvfvfwassgsyvlkggwikef
Eucgr.E02047.1|PACid:23578666  -------------mseetvrqvesgegadvivrdldtcsehrlvfvfwassgsyvlkggwikefvkr
Eucgr.B02808.1|PACid:23568029  -------------elkvsnfrrn............................................
Eucgr.H00815.1|PACid:23590199  -------------kcgky.................................................
Eucgr.E02029.1|PACid:23578652  -------------askfhfsll.............................................
Eucgr.D00268.2|PACid:23574033  -------------ivlrvsvf..............................................
Eucgr.E04365.1|PACid:23580648  -------------saskfhfsll............................................
Eucgr.I00465.1|PACid:23595008  -------------ltkrs.................................................
Eucgr.E02054.1|PACid:23578672  -------------dmdtssehrlvfvfwassgsyvlkggwikefvkrrglatgdevgiywepiasef
Eucgr.E02074.1|PACid:23578692  -------------eerarrakssegaevvvwdadtrsehqlvfaywassgsyvlkgcwmkefvqrrg
Eucgr.E04373.1|PACid:23580654  -------------rwvneetarqvesskgadvivrdmdtcsehrlvfvfwassgsyvlkggwikefv
Eucgr.E01944.1|PACid:23578600  -------------ehplvfgywkstkgyvlkggwipefverrglvvgdkigmfwdermfyfkvlr..
Eucgr.E02075.1|PACid:23578693  -------------eerarrvksnegaevvvwdedthsehqlvfaywassgsyvlkgcwmkefvqrrg
Eucgr.D00269.1|PACid:23574035  -------------vlrvsvf...............................................
Eucgr.E04371.1|PACid:23580652  -------------lrwvneetarqvesskgadvivrdmdtcsehrlvfvfwassgsyvlkggwikef
Eucgr.F00044.2|PACid:23580710  -------------gessfnvlvfnq..........................................
Eucgr.D00268.1|PACid:23574032  -------------ivlrvsvfs.............................................
Eucgr.L02216.1|PACid:23606980  -------------ivlkvsifrys...........................................
Eucgr.E01938.1|PACid:23578596  -------------frrwetsgsyvlncgwtklfvkgrgleekdeigmfwdtddrkfhftvhrk....
Eucgr.E02114.1|PACid:23578703  -------------iaskfhfsllc...........................................
Eucgr.C01014.1|PACid:23570587  -------------vwafrdvwtrelclli......................................
Eucgr.K02760.1|PACid:23604388  -------------lq....................................................
Eucgr.E02039.1|PACid:23578658  -------------lrwmneetvrqvesskgadvivrdmdtcsehrlvfvfwassgsyvlkggwikef
Eucgr.I00399.1|PACid:23594951  -------------vlevsifrns............................................
Eucgr.E01943.1|PACid:23578599  -------------acg...................................................
Eucgr.I00407.1|PACid:23594956  -------------vfkvsifrht............................................
Eucgr.I00403.1|PACid:23594954  -------------ptvlevsifrss..........................................
Eucgr.E01923.1|PACid:23578586  -------------gdehrlvfrhwaswnsyllngdwnrrfvqrrgpgkddeigmlwdtnacvvhftv
Eucgr.E01941.1|PACid:23578598  -------------fyfkvl................................................
Eucgr.G01238.2|PACid:23586854  -------------fsagrdafarethlhvghvcmfklidrddivfevsil.................
Eucgr.G01238.1|PACid:23586853  -------------fsagrdafarethlhvghvcmfklidrddivfevsil.................
Eucgr.B02809.1|PACid:23568030  -------------epvri.................................................
Eucgr.E02013.1|PACid:23578642  -------------eemetqvmsgeganvvvwdadtrwehqlvfsfwassgayvlkrcwikefvqrrg
Eucgr.I00402.1|PACid:23594953  -------------ltkqs.................................................
Eucgr.D00268.3|PACid:23574034  -------------vlrvsvfs..............................................
Eucgr.E02109.1|PACid:23578702  -------------wmkkemvgevhskegmevnvikertggtegkdqehwlvfrywassgcymlnggw
Eucgr.E02128.1|PACid:23578709  -------------vaskfhfsllr...........................................
Eucgr.B02809.1|PACid:23568030  -------------gknlpktlrerippalpmggceghllvfkyvensdfhvlifdks..........
Eucgr.E02134.1|PACid:23578714  -------------deigihwdpiv...........................................
Eucgr.K01123.1|PACid:23602599  -------------lknksetvyhlvgqgwvdivarnglekdqvvrlyccriasnlcfal........
Eucgr.I00855.1|PACid:23595366  -------------lreeeirildrkegikvsliepclevshglqlkrwnyksrnfsyvlterwngva
Eucgr.L01474.1|PACid:23606431  -------------kk....................................................


                                                             
                                                             
d1na6a1                          ............................
Eucgr.A02065.1|PACid:23563901  ............................
Eucgr.A02065.2|PACid:23563902  ............................
Eucgr.A02065.3|PACid:23563903  ............................
Eucgr.D00264.2|PACid:23574028  ............................
Eucgr.D00264.1|PACid:23574027  ............................
Eucgr.F02090.1|PACid:23582845  ............................
Eucgr.B02480.3|PACid:23567637  ............................
Eucgr.B02480.2|PACid:23567636  ............................
Eucgr.B02480.1|PACid:23567635  ............................
Eucgr.C03293.1|PACid:23572724  ............................
Eucgr.C03293.2|PACid:23572725  ............................
Eucgr.G00076.4|PACid:23585851  ............................
Eucgr.C02178.2|PACid:23571668  ............................
Eucgr.G00076.3|PACid:23585850  ............................
Eucgr.C02178.1|PACid:23571667  ............................
Eucgr.G00076.1|PACid:23585848  ............................
Eucgr.G00076.2|PACid:23585849  ............................
Eucgr.D00588.1|PACid:23574345  ............................
Eucgr.D00588.2|PACid:23574346  ............................
Eucgr.E00888.2|PACid:23577619  ............................
Eucgr.E00888.1|PACid:23577618  ............................
Eucgr.D01764.1|PACid:23575524  ............................
Eucgr.B03551.1|PACid:23568902  ............................
Eucgr.A02625.1|PACid:23564572  ............................
Eucgr.B03050.1|PACid:23568282  ............................
Eucgr.B03048.1|PACid:23568281  ............................
Eucgr.G02838.1|PACid:23588588  ............................
Eucgr.L01673.1|PACid:23606585  ............................
Eucgr.E01093.1|PACid:23577807  ............................
Eucgr.F04380.1|PACid:23585644  ............................
Eucgr.J00923.1|PACid:23598808  ............................
Eucgr.L00348.1|PACid:23605637  ............................
Eucgr.K01240.1|PACid:23602718  ............................
Eucgr.D00053.1|PACid:23573847  ............................
Eucgr.I01210.1|PACid:23595750  ............................
Eucgr.L02216.1|PACid:23606980  gsafrvvifdks................
Eucgr.C00358.1|PACid:23569863  ............................
Eucgr.C00358.2|PACid:23569864  ............................
Eucgr.I01211.1|PACid:23595751  ............................
Eucgr.H02901.1|PACid:23592218  ............................
Eucgr.H01965.1|PACid:23591351  afrvvifdks..................
Eucgr.D00268.3|PACid:23574034  ............................
Eucgr.D00268.2|PACid:23574033  ............................
Eucgr.D00268.1|PACid:23574032  ............................
Eucgr.D00269.1|PACid:23574035  ............................
Eucgr.I01218.1|PACid:23595758  ............................
Eucgr.I00406.1|PACid:23594955  egasffhvlifdks..............
Eucgr.F02399.3|PACid:23583202  ............................
Eucgr.F02399.4|PACid:23583203  ............................
Eucgr.F02399.1|PACid:23583200  ............................
Eucgr.F02399.2|PACid:23583201  ............................
Eucgr.D00268.1|PACid:23574032  ............................
Eucgr.D00268.3|PACid:23574034  ............................
Eucgr.D00268.2|PACid:23574033  ............................
Eucgr.K02760.1|PACid:23604388  ............................
Eucgr.G01458.1|PACid:23587028  ............................
Eucgr.F02399.1|PACid:23583200  ............................
Eucgr.F02399.2|PACid:23583201  ............................
Eucgr.H02009.1|PACid:23591387  ............................
Eucgr.H01651.1|PACid:23591105  ............................
Eucgr.G00890.1|PACid:23586517  fdks........................
Eucgr.F02399.3|PACid:23583202  ............................
Eucgr.F02399.4|PACid:23583203  ............................
Eucgr.G01455.1|PACid:23587025  ............................
Eucgr.F02399.1|PACid:23583200  ............................
Eucgr.F02399.2|PACid:23583201  ............................
Eucgr.F02358.1|PACid:23583166  ............................
Eucgr.G01236.1|PACid:23586851  ............................
Eucgr.G01245.1|PACid:23586859  ............................
Eucgr.H01965.1|PACid:23591351  ............................
Eucgr.G00890.1|PACid:23586517  ............................
Eucgr.G01242.1|PACid:23586858  ............................
Eucgr.G00888.2|PACid:23586515  kykgnstfrvmifdrs............
Eucgr.D00267.1|PACid:23574031  yegdstfraiifdks.............
Eucgr.G00888.1|PACid:23586514  kykgnstfrvmifdrs............
Eucgr.G01517.2|PACid:23587078  ............................
Eucgr.F00044.1|PACid:23580709  sfnvlvfnq...................
Eucgr.I01213.1|PACid:23595752  ............................
Eucgr.G01517.1|PACid:23587077  ............................
Eucgr.H02901.1|PACid:23592218  ............................
Eucgr.G01245.1|PACid:23586859  yignstfgiiifdks.............
Eucgr.D00269.1|PACid:23574035  ............................
Eucgr.G00890.1|PACid:23586517  ............................
Eucgr.G00889.1|PACid:23586516  ............................
Eucgr.G00888.2|PACid:23586515  ............................
Eucgr.G00890.1|PACid:23586517  ............................
Eucgr.G00888.1|PACid:23586514  ............................
Eucgr.G01517.1|PACid:23587077  ............................
Eucgr.K02197.5|PACid:23603737  ............................
Eucgr.K02197.1|PACid:23603733  ............................
Eucgr.K02197.2|PACid:23603734  ............................
Eucgr.K02197.3|PACid:23603735  ............................
Eucgr.K02197.4|PACid:23603736  ............................
Eucgr.H01962.1|PACid:23591348  ............................
Eucgr.G01240.1|PACid:23586856  ifdks.......................
Eucgr.L01473.1|PACid:23606430  ............................
Eucgr.G00890.1|PACid:23586517  ............................
Eucgr.F02704.3|PACid:23583575  ............................
Eucgr.F02704.1|PACid:23583573  ............................
Eucgr.F02704.2|PACid:23583574  ............................
Eucgr.B04027.1|PACid:23569481  ............................
Eucgr.G02345.1|PACid:23587947  ............................
Eucgr.G00888.1|PACid:23586514  ............................
Eucgr.I01213.1|PACid:23595752  ............................
Eucgr.E01478.1|PACid:23578191  ............................
Eucgr.A01956.1|PACid:23563774  ............................
Eucgr.I00400.1|PACid:23594952  ............................
Eucgr.E02078.1|PACid:23578694  ............................
Eucgr.I00397.1|PACid:23594949  ............................
Eucgr.I00403.1|PACid:23594954  ryepssifhvviidts............
Eucgr.G01240.1|PACid:23586856  ............................
Eucgr.I01210.1|PACid:23595750  ............................
Eucgr.I01211.1|PACid:23595751  ............................
Eucgr.G01238.2|PACid:23586854  ............................
Eucgr.G01238.1|PACid:23586853  ............................
Eucgr.E01947.1|PACid:23578601  ............................
Eucgr.G01639.1|PACid:23587184  ............................
Eucgr.F00044.2|PACid:23580710  ............................
Eucgr.F00044.1|PACid:23580709  ............................
Eucgr.H01962.1|PACid:23591348  ............................
Eucgr.E03465.1|PACid:23579814  ............................
Eucgr.L02178.1|PACid:23606956  ............................
Eucgr.E01753.1|PACid:23578440  ............................
Eucgr.L01802.1|PACid:23606676  rrglavgdevgiywepsaskfhfsll..
Eucgr.E02051.1|PACid:23578669  glavgdevgiywepsaskfhfsll....
Eucgr.G01238.2|PACid:23586854  ............................
Eucgr.G01238.1|PACid:23586853  ............................
Eucgr.G01241.1|PACid:23586857  ............................
Eucgr.E01934.1|PACid:23578594  ............................
Eucgr.E01939.1|PACid:23578597  ............................
Eucgr.E02060.1|PACid:23578677  krrglatgdevgiywepsasefhfsll.
Eucgr.E02050.1|PACid:23578668  vkrrglaagdevgiywepsasefhfsll
Eucgr.E01948.1|PACid:23578602  ............................
Eucgr.L02104.1|PACid:23606905  levgdevgiywdpserkfhfs.......
Eucgr.E02057.1|PACid:23578674  ............................
Eucgr.E01933.1|PACid:23578593  ............................
Eucgr.E02053.1|PACid:23578671  vgiywdpserkfhfs.............
Eucgr.E02048.1|PACid:23578667  ............................
Eucgr.E01937.1|PACid:23578595  ............................
Eucgr.E02045.1|PACid:23578664  vkrrglavgdevgmywepsaskfhfsll
Eucgr.E02044.1|PACid:23578663  vkrrglaagdevgiywepsaskfhfsl.
Eucgr.E03467.1|PACid:23579815  ............................
Eucgr.K03433.1|PACid:23605172  ............................
Eucgr.L03694.1|PACid:23607997  vkrrglaagdevgiywepsasefhfsll
Eucgr.E02046.1|PACid:23578665  vgiywdpserkfhfs.............
Eucgr.G01246.1|PACid:23586860  ............................
Eucgr.G01240.1|PACid:23586856  ............................
Eucgr.L01801.1|PACid:23606675  akrrglavgdeiglywdpitskfhf...
Eucgr.E02047.1|PACid:23578666  rglaagdevgiywepsasefhfsll...
Eucgr.B02808.1|PACid:23568029  ............................
Eucgr.H00815.1|PACid:23590199  ............................
Eucgr.E02029.1|PACid:23578652  ............................
Eucgr.D00268.2|PACid:23574033  ............................
Eucgr.E04365.1|PACid:23580648  ............................
Eucgr.I00465.1|PACid:23595008  ............................
Eucgr.E02054.1|PACid:23578672  hf..........................
Eucgr.E02074.1|PACid:23578692  laegdeigicwdsiaskfhfsl......
Eucgr.E04373.1|PACid:23580654  krrglavgdevgiywepiaskfhfsllh
Eucgr.E01944.1|PACid:23578600  ............................
Eucgr.E02075.1|PACid:23578693  laegdeigihwdpi..............
Eucgr.D00269.1|PACid:23574035  ............................
Eucgr.E04371.1|PACid:23580652  vkrrglavgdevgiywepia........
Eucgr.F00044.2|PACid:23580710  ............................
Eucgr.D00268.1|PACid:23574032  ............................
Eucgr.L02216.1|PACid:23606980  ............................
Eucgr.E01938.1|PACid:23578596  ............................
Eucgr.E02114.1|PACid:23578703  ............................
Eucgr.C01014.1|PACid:23570587  ............................
Eucgr.K02760.1|PACid:23604388  ............................
Eucgr.E02039.1|PACid:23578658  vkrrdlavgdeigiywepias.......
Eucgr.I00399.1|PACid:23594951  ............................
Eucgr.E01943.1|PACid:23578599  ............................
Eucgr.I00407.1|PACid:23594956  ............................
Eucgr.I00403.1|PACid:23594954  ............................
Eucgr.E01923.1|PACid:23578586  lrraac......................
Eucgr.E01941.1|PACid:23578598  ............................
Eucgr.G01238.2|PACid:23586854  ............................
Eucgr.G01238.1|PACid:23586853  ............................
Eucgr.B02809.1|PACid:23568030  ............................
Eucgr.E02013.1|PACid:23578642  laardeigiywdpttnrfhfsllck...
Eucgr.I00402.1|PACid:23594953  ............................
Eucgr.D00268.3|PACid:23574034  ............................
Eucgr.E02109.1|PACid:23578702  sel.........................
Eucgr.E02128.1|PACid:23578709  ............................
Eucgr.B02809.1|PACid:23568030  ............................
Eucgr.E02134.1|PACid:23578714  ............................
Eucgr.K01123.1|PACid:23602599  ............................
Eucgr.I00855.1|PACid:23595366  ............................
Eucgr.L01474.1|PACid:23606431  ............................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]