SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments in Manihot esculenta v147

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1                              s..............................................................
cassava4.1_002377m|PACid:17972846  fl.............................................................
cassava4.1_001923m|PACid:17979526  fl.............................................................
cassava4.1_001769m|PACid:17972845  fl.............................................................
cassava4.1_001357m|PACid:17970373  l..............................................................
cassava4.1_001328m|PACid:17972625  l..............................................................
cassava4.1_001154m|PACid:17972624  l..............................................................
cassava4.1_001355m|PACid:17990076  dfg............................................................
cassava4.1_001105m|PACid:17990075  dfg............................................................
cassava4.1_001995m|PACid:17968878  lp.............................................................
cassava4.1_001979m|PACid:17980934  p..............................................................
cassava4.1_000609m|PACid:17992784  lk.............................................................
cassava4.1_000604m|PACid:17965279  lk.............................................................
cassava4.1_000610m|PACid:17980095  lk.............................................................
cassava4.1_004521m|PACid:17974505  pe.............................................................
cassava4.1_004533m|PACid:17974506  pe.............................................................
cassava4.1_002969m|PACid:17974504  pe.............................................................
cassava4.1_002399m|PACid:17970035  ks.............................................................
cassava4.1_002408m|PACid:17978468  lp.............................................................
cassava4.1_001567m|PACid:17965008  h..............................................................
cassava4.1_001855m|PACid:17967456  v..............................................................
cassava4.1_001964m|PACid:17967457  v..............................................................
cassava4.1_001542m|PACid:17967454  v..............................................................
cassava4.1_001544m|PACid:17967455  v..............................................................
cassava4.1_002885m|PACid:17975736  e..............................................................
cassava4.1_003285m|PACid:17970763  c..............................................................
cassava4.1_002762m|PACid:17970761  c..............................................................
cassava4.1_002772m|PACid:17970762  c..............................................................
cassava4.1_002216m|PACid:17983384  tr.............................................................
cassava4.1_010157m|PACid:17968962  q..............................................................
cassava4.1_010068m|PACid:17962687  q..............................................................
cassava4.1_004122m|PACid:17971854  dk.............................................................
cassava4.1_002980m|PACid:17967195  pq.............................................................
cassava4.1_012252m|PACid:17992340  kep............................................................
cassava4.1_009838m|PACid:17968724  ekp............................................................
cassava4.1_022877m|PACid:17973703  e..............................................................
cassava4.1_002960m|PACid:17968723  ekp............................................................
cassava4.1_008697m|PACid:17975779  e..............................................................
cassava4.1_002684m|PACid:17967245  nkp............................................................
cassava4.1_012885m|PACid:17963793  ...............................................................
cassava4.1_002668m|PACid:17968894  kgte...........................................................
cassava4.1_004707m|PACid:17980850  kp.............................................................
cassava4.1_004716m|PACid:17980849  kp.............................................................
cassava4.1_021263m|PACid:17975434  e..............................................................
cassava4.1_031993m|PACid:17974501  peq............................................................
cassava4.1_030248m|PACid:17986136  l..............................................................
cassava4.1_023592m|PACid:17988096  l..............................................................
cassava4.1_021579m|PACid:17973413  q..............................................................
cassava4.1_012400m|PACid:17989033  akipqffkiilqstvlegrlripkkfvknhgkclsspmilkvptgntwkvellrsgddvwlak
cassava4.1_013238m|PACid:17989499  kptrffkiilentiregklgiptkfvkdygnclsspvt.........................
cassava4.1_030600m|PACid:17989063  nrphffkiilddnihdkkl............................................
cassava4.1_013029m|PACid:17988785  aphffkiildstirqrklaiprkfvkkygnclsspvilsvpsgtiwrvellkcndd.......
cassava4.1_026645m|PACid:17984680  fkpkcpsfmvvlrqynfnnml..........................................
cassava4.1_025209m|PACid:17989519  fetdrphffkvildetihdkklgiprrfvrkygkdlsspvvl.....................
cassava4.1_030966m|PACid:17978826  m..............................................................
cassava4.1_013543m|PACid:17989532  hffkiilhstiqqgkleiprkfvrkygnglsspvilhvpsgakws..................
cassava4.1_013045m|PACid:17989531  hffkiilhstiqqgkleiprkfvrkygnglsspvilhvpsgakws..................
cassava4.1_006650m|PACid:17970733  esafpsfvkslvrshvgscfwmglpgpfcrahlpredt.........................
cassava4.1_028222m|PACid:17988718  fnsgnpyfmialqpsylnklsipasfareyfiknrei..........................
cassava4.1_010446m|PACid:17984628  epinpfcrvvlrpsylyrgcim.........................................
cassava4.1_033218m|PACid:17977697  sdnpffkvilrssyvyrgfllhipssfarkyltvtafirlqvs....................
cassava4.1_009699m|PACid:17980107  easlpsfakalvrsnvtvgfwmhlpmrfcklhlpkhdtsvfletengeeyvinyisertalsg
cassava4.1_024894m|PACid:17976320  m..............................................................
cassava4.1_007952m|PACid:17977731  epinpfcrvvlrpsylyrgcim.........................................
cassava4.1_006729m|PACid:17980106  easlpsfakalvrsnvtvgfwmhlpmrfcklhlpkhdtsvfletengeeyvinyisertalsg
cassava4.1_023688m|PACid:17988714  fksdnpfflivmqpsyvhpgek.........................................
cassava4.1_006855m|PACid:17977730  epinpfcrvvlrpsylyrgcim.........................................
cassava4.1_004019m|PACid:17964412  fnsrfpnfvrimrkfnisgsytlk.......................................
cassava4.1_004042m|PACid:17964413  fnsrfpnfvrimrkfnisgsytlk.......................................
cassava4.1_005196m|PACid:17970764  qp.............................................................
cassava4.1_004019m|PACid:17964412  ntsrpcffeifssnltsdrlripvgftkhmegrisglvsltgpsgnvwhayltqqdndvfldh
cassava4.1_004019m|PACid:17964412  fpyfvrimkrfnvsgsytlnipyqfstahlpnckteivlrtvkgacwsvn.............
cassava4.1_004042m|PACid:17964413  ntsrpcffeifssnltsdrlripvgftkhmegrisglvsltgpsgnvwhayltqqdndvfldh
cassava4.1_004042m|PACid:17964413  fpyfvrimkrfnvsgsytlnipyqfstahlpnckteivlrtvkgacwsvn.............
cassava4.1_025302m|PACid:17971686  ll.............................................................
cassava4.1_021232m|PACid:17984355  ll.............................................................
cassava4.1_010400m|PACid:17985434  qclhflqvlhsgfdrqlaipehftknlrkklpqvitlrgpsgrtwqvilttn...........
cassava4.1_031416m|PACid:17959850  sskphflqpvlpgfkhqqfsipvsffkylkgqkcerailrgrtgkiwpvkinsrsfed.....
cassava4.1_025209m|PACid:17989519  fksknpfflvamqpsyvhpavkln.......................................
cassava4.1_023034m|PACid:17973665  pefpsmiklmlpshvsggfwlglnkqfcdehmpkqdtmivlenesgmnyqakylvkkvgls..
cassava4.1_026568m|PACid:17977720  gyfyrlivpsilqqnklm.............................................
cassava4.1_024159m|PACid:17977134  eadfpsfvkpmtqshvtggfwlglpihfckdhlpsrdeyitlvdengdgtetkylalkngls.
cassava4.1_011420m|PACid:17984629  rpyfhklilsntirdkklripdnfvkkfgndlsafgrlsvpggpv..................
cassava4.1_029589m|PACid:17989515  dhqmlprkfarqyanslsnpvtlklssgaawqvellkn.........................
cassava4.1_010446m|PACid:17984628  rpyfhklilsntirdkklripdnfvkkfgndlsafgrlsvpggpv..................
cassava4.1_026835m|PACid:17970017  ls.............................................................
cassava4.1_010015m|PACid:17977732  mprpyfyklilantirdkklripdnfvkkfgndlsafgrisv.....................
cassava4.1_007952m|PACid:17977731  mprpyfyklilantirdkklripdnfvkkfgndlsafgrisv.....................
cassava4.1_006855m|PACid:17977730  mprpyfyklilantirdkklripdnfvkkfgndlsafgrisv.....................
cassava4.1_021264m|PACid:17985936  ehpffvvtvtfyrarfynfkqnvpmkfaqandlknrsckivlmdqearawpaklghkksdgq.
cassava4.1_032875m|PACid:17989505  sdaprffkyihentireeklmvpqkfvsrhgnclssrvtlevpsgan................
cassava4.1_027517m|PACid:17989062  riysgdfyvyqgiprkfarrygsemsspvflkvpsgekwevqlvkcddeiw............
cassava4.1_023093m|PACid:17985435  qyvhfsrflhagfdqclcmklqaipenftrnlprklpntvtlkspsgikweigltandn....
cassava4.1_026568m|PACid:17977720  esvnpfcrvvlrasylyrgcilh........................................
cassava4.1_028222m|PACid:17988718  tirsrklrihsgdfyvyqgiprkfvrrygselsspvflkmpsgakweiqllkcdd........
cassava4.1_012186m|PACid:17992633  eipkkfirkhgkdlpspvilkvangsiwkielskchgevwlekgwqefakhh...........
cassava4.1_001569m|PACid:17970131  tp.............................................................
cassava4.1_001573m|PACid:17990861  tp.............................................................
cassava4.1_026585m|PACid:17992650  fqsekifffkiiledtvrdkklaiprsfvkkygnalsnrailripdgv...............
cassava4.1_001576m|PACid:17984754  vp.............................................................
cassava4.1_022865m|PACid:17992636  tpenphfvtimtrstqytvhihksvvkahniklqek...........................
cassava4.1_033218m|PACid:17977697  ripgkfvkkygdelssiatltvpngriwlvelekvdkklwfhngwhef...............
cassava4.1_023688m|PACid:17988714  yfksfcqgvpkrfarkyggflsnpvvlkvpggriwqvevtkfdgevwfqn.............
cassava4.1_026585m|PACid:17992650  sknpffsvvmqesylhlylhipagfarrhlkhwkkntitlqvedrswiatlknfdsc......
cassava4.1_001408m|PACid:17965912  vp.............................................................
cassava4.1_013029m|PACid:17988785  kypsftvlmkryhwengivvlpssffvrhfecktqsimlqnadrfwpvklisssds.......
cassava4.1_028119m|PACid:17992629  idpkhphfdmdlkhnqkyil...........................................
cassava4.1_013968m|PACid:17985433  yspkgpyfittittssgaddgsyldipaefassnnlvrasivvlq..................
cassava4.1_027517m|PACid:17989062  fksgnpyfmivmqqthlhrlnipasfkrehfnnrkaatfitkeekawfvefvsigkaiarsrd
cassava4.1_026645m|PACid:17984680  rpsqhffkiilpstihekklripnkfvskfgdelsdfaniivpngcawkv.............
cassava4.1_028119m|PACid:17992629  kffkilfgdftkklaipplfiktfkknipkepilktekgkflvsvkfddnryffk........
cassava4.1_031416m|PACid:17959850  hpyfyvtvkayhiqnsylqipsdfarrndligkcsemiltnergns.................
cassava4.1_013968m|PACid:17985433  rhffkvivagfrsklslpvafcrrlkgkrldkavvrssqgswhikvgkcrkgllyfeq.....
cassava4.1_031982m|PACid:17968160  r..............................................................
cassava4.1_013045m|PACid:17989531  kypsfkvvvkpyhwdhnnvsmpagffrryfkcqtqnvilqiadtlwsvklirpsrrcaatlsa
cassava4.1_012186m|PACid:17992633  ffksvvwldkrknsivcvpvsfsrrnikdcvanltlqfgdrlwpvkliryskwnvvr......
cassava4.1_021264m|PACid:17985936  sthpcfyvtvktyhfkny.............................................
cassava4.1_031416m|PACid:17959850  qhipikfarthglcnsnckmilmnekgrswpavswnkksdgqvyigr................
cassava4.1_023815m|PACid:17977737  kpqnpaflvilgksyirtnllhvpsafavkylrnisetikvedcyggewiihtfcs.......
cassava4.1_028222m|PACid:17988718  fssanpffkviigsyhleqsllyvplnivaksttrrrnnamlqvenkrwpvklf.........
cassava4.1_029589m|PACid:17989515  enpsfhlvvksyhlerenvyvpnsfm.....................................
cassava4.1_012400m|PACid:17989033  tssypyfeailgangtgqiyvrvptsfirahmkcethavklkvaektwrvnlyinlqnsaskl
cassava4.1_013238m|PACid:17989499  nypffkvllrrtldvnvpfslirrymkcesqilmlhvaekswpvkln................
cassava4.1_030600m|PACid:17989063  npffkliissghltrpivhvprnfisnikkstkkaklqvenrw....................
cassava4.1_022637m|PACid:17989488  ipgeflrkckeglsspvvlklpdgaiwhlellvcghevwlgng....................
cassava4.1_010400m|PACid:17985434  fmvvmkpthvyrrfym...............................................
cassava4.1_032875m|PACid:17989505  sqypsfkkilqpdhlehwnmnipfsfvqkhle...............................
cassava4.1_022637m|PACid:17989488  wkhcnvvqiftmdhcliciqtiprrffrryiehraehamlqvadrmypvqfkpatssgs....
cassava4.1_026340m|PACid:17986296  lpr............................................................
cassava4.1_031416m|PACid:17959850  yipttfarlnnlnnrrckmilv.........................................
cassava4.1_027543m|PACid:17993392  fekqltssdvrpdqsrltmnkad........................................
cassava4.1_032104m|PACid:17993510  fekqltssdvrpdqsrltmnkad........................................
cassava4.1_021168m|PACid:17971073  wkikkrltgsdlgnlcrllvasalvkdhilpfmssetlekirgegaefcfwdfdtktelnval
cassava4.1_022865m|PACid:17992636  na.............................................................
cassava4.1_021291m|PACid:17971078  wkikkrltgsdlgnhcrllvtsalvknhifpfmgseiiekirgegaefcfwdcdtntelnlvl
cassava4.1_026028m|PACid:17971072  wkikkrltgsdlgnlcrllvasalvkdhilpfmnsetlekirgegaefcfwdcdtktelnvvl
cassava4.1_013543m|PACid:17989532  sfksmpagffrryfkcqtqnvilqiadtlwsvklirpsrrcaatlsa................
cassava4.1_025743m|PACid:17965438  wkikkrltgsdlgnhcrllvasalvknhifpfmgseivekirgegaefcfwdcdtntglnlvl
cassava4.1_032495m|PACid:17977842  pwkikkrltgsdlgnhcrllvasalvknhifpfmgseivekirgegaefcfwdcdtntglnlv
cassava4.1_023815m|PACid:17977737  swrsffikvrtttiedkklnlplkfarkfgdelsdvaklivpngliwevgltkge........
cassava4.1_026201m|PACid:17962468  lfrkkltdtdvkyrmvvpmdnyrdafqipegdfseeidvidmdddsvkkfncskrrkghp...
cassava4.1_030107m|PACid:17962538  ilfrkkltntdvkfrmvfpiksyrevlqiqngdlsqgidvidgednsvkkfictkrhkghhkp
cassava4.1_031569m|PACid:17992125  wkikkrltgsdlgnhcrllvasalvknhifpfmgsemvekirgegaefcfwdcdtniglnlvl
cassava4.1_033082m|PACid:17962430  tvlfrkklthtdvkfrmvfpmksyrevlqiqngdlsqgidvidvedksvknfictkrhkghhk
cassava4.1_024104m|PACid:17991311  rkaaeahlpileskeg...............................................
cassava4.1_027512m|PACid:17974822  qiq............................................................
cassava4.1_024702m|PACid:17981153  i..............................................................
cassava4.1_031383m|PACid:17989199  qi.............................................................
cassava4.1_023649m|PACid:17981152  i..............................................................
cassava4.1_026734m|PACid:17971074  wkikkrltgsdlgnhcrldivekirgegaefcfwdcdtntelnlvlk................
cassava4.1_027843m|PACid:17962441  p..............................................................
cassava4.1_028150m|PACid:17981151  i..............................................................
cassava4.1_031965m|PACid:17965416  wkik...........................................................
cassava4.1_024497m|PACid:17966841  lv.............................................................
cassava4.1_022215m|PACid:17981154  i..............................................................
cassava4.1_022611m|PACid:17962458  p..............................................................
cassava4.1_027733m|PACid:17983747  yfkkelsstdinkrlavptrffqlirprfk.................................
cassava4.1_024470m|PACid:17965913  vimkqlfptdlnphhdrlsipfkqiknefltedekiklnqqeiiavklmepcgnvse......
cassava4.1_030218m|PACid:17962472  vlfskllkktdlehqlivpsevlk.......................................
cassava4.1_023093m|PACid:17985435  fivmmkpthvsrkffmsipsawmtkhiscre................................
cassava4.1_031243m|PACid:17965734  vimkqmfptdlnphhdrlsipfrqirnefltedektklieqksitvklmepcgsesel.....
cassava4.1_021320m|PACid:17962548  vklltktdlelqlivpsdvlqrypildqnghvskfi...........................
cassava4.1_028443m|PACid:17983773  tklvlfskmltrtdiesclcistsslsqlpfde..............................
cassava4.1_022475m|PACid:17983750  tklv...........................................................
cassava4.1_033045m|PACid:17976110  lfqkelknsdkaaeahlplleskegifismddldgmhvwsfkyrfnflpshl...........
cassava4.1_032970m|PACid:17984492  tkrvlfskmltrtdiesclcistsslsqlpfdeg.............................
cassava4.1_023604m|PACid:17981149  lftkkltdtdfkhrmavpmetyqlgv.....................................
cassava4.1_026980m|PACid:17986725  gteaklgrlsmpnkqvlceflnedekekle.................................
cassava4.1_032427m|PACid:17962609  ngakvfskqlgktdkshqlilptkvleqfpiqkgfyer.........................
cassava4.1_033446m|PACid:17981150  qegh...........................................................
cassava4.1_027477m|PACid:17962512  vlfsklitradlekslliptslslqpfedgvh...............................
cassava4.1_025827m|PACid:17962542  ifskkltsididkglqvpdyslaalppsgsgn...............................
cassava4.1_025422m|PACid:17963857  ...............................................................
cassava4.1_029527m|PACid:17970463  gtkvfskklgktdreaqliiptkvlkqfpiqngyyerdftacdaqdrqwefilai........
cassava4.1_029244m|PACid:17962611  vlfsklitradlekslliptslslqpledgdp...............................
cassava4.1_032678m|PACid:17970465  gtkvfskklgktdreaqliiptkvlkqfpiqngyyerdftacdaqdrqwe.............
cassava4.1_022924m|PACid:17974798  lsvptkal.......................................................
cassava4.1_026225m|PACid:17970464  ydsgnvwsfrcripaigfskpvvfgn.....................................
cassava4.1_031810m|PACid:17962527  lfsklltktdiethlcistsslgqlpfdg..................................
cassava4.1_030655m|PACid:17962547  vkvfskqlgktdknhqlivptnvleqfpiq.................................
cassava4.1_023706m|PACid:17962525  idkvlsqtdvdyrlafptaslwgiqipegqn................................
cassava4.1_026336m|PACid:17974807  i..............................................................
cassava4.1_027448m|PACid:17962554  inkvlsqtdvdyrlafptaslwgvqipedqng...............................
cassava4.1_026234m|PACid:17989442  kirgegakfcfwdcdtktqlnvalk......................................
cassava4.1_031392m|PACid:17962488  ifskkltsididkglq...............................................


                                                   10        20        30        40         50      
                                                    |         |         |         |          |      
d1na6a1                              ......-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGIVEKL.FPSINH...
cassava4.1_002377m|PACid:17972846  ......---PMELGMPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV.FPPL-D...
cassava4.1_001923m|PACid:17979526  ......---PMELGMPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV.FPPL-D...
cassava4.1_001769m|PACid:17972845  ......---PMELGMPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV.FPPL-D...
cassava4.1_001357m|PACid:17970373  ......---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV.FPPL-D...
cassava4.1_001328m|PACid:17972625  ......---PAELGAPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV.FPPL-D...
cassava4.1_001154m|PACid:17972624  ......---PAELGAPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV.FPPL-D...
cassava4.1_001355m|PACid:17990076  ......-------LKPSKHPTEFFCKTLTASDTSTHG----GFSVPRRAAEKL.FPAL-D...
cassava4.1_001105m|PACid:17990075  ......-------LKPSKHPTEFFCKTLTASDTSTHG----GFSVPRRAAEKL.FPAL-D...
cassava4.1_001995m|PACid:17968878  ......----------AKSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC.FPPL-D...
cassava4.1_001979m|PACid:17980934  ......----------AKSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC.FPPL-D...
cassava4.1_000609m|PACid:17992784  ......---------QNRQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI.FPPL-D...
cassava4.1_000604m|PACid:17965279  ......---------QSRQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI.FPPL-D...
cassava4.1_000610m|PACid:17980095  ......---------SNKPQTEFFCKTLTASDTSTHG----GFSVPRRAAEKI.FPPL-D...
cassava4.1_004521m|PACid:17974505  ......---------PERCTVHSFCKTLTASDTSTHG----GFSVLRRHADDC.LPPL-D...
cassava4.1_004533m|PACid:17974506  ......---------PERCTVHSFCKTLTASDTSTHG----GFSVLRRHADDC.LPPL-D...
cassava4.1_002969m|PACid:17974504  ......---------PERCTVHSFCKTLTASDTSTHG----GFSVLRRHADDC.LPPL-D...
cassava4.1_002399m|PACid:17970035  ......------------TTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC.FPPL-D...
cassava4.1_002408m|PACid:17978468  ......--------EPKKPTVHSFCKILTASDTSTHG----GFSVLRKHATDC.LPPL-D...
cassava4.1_001567m|PACid:17965008  ......--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC.LPPL-D...
cassava4.1_001855m|PACid:17967456  ......---------------HSFCKTLTASDTSTHG----GFSVLRRHADEC.LPPL-D...
cassava4.1_001964m|PACid:17967457  ......---------------HSFCKTLTASDTSTHG----GFSVLRRHADEC.LPPL-D...
cassava4.1_001542m|PACid:17967454  ......---------------HSFCKTLTASDTSTHG----GFSVLRRHADEC.LPPL-D...
cassava4.1_001544m|PACid:17967455  ......---------------HSFCKTLTASDTSTHG----GFSVLRRHADEC.LPPL-D...
cassava4.1_002885m|PACid:17975736  ......---------PQKPTVHSFCKILTPSDTSTHG----GFSVLRKHATEC.LPPL-D...
cassava4.1_003285m|PACid:17970763  ......------------PTVHSFCKVLTASDTSTHG----GFSVLRKHATEC.LPQL-D...
cassava4.1_002762m|PACid:17970761  ......------------PTVHSFCKVLTASDTSTHG----GFSVLRKHATEC.LPQL-D...
cassava4.1_002772m|PACid:17970762  ......------------PTVHSFCKVLTASDTSTHG----GFSVLRKHATEC.LPQL-D...
cassava4.1_002216m|PACid:17983384  ......------------PRVHSFCKTLTPSDTSTHG----GFSVLRRHADEC.LPPL-D...
cassava4.1_010157m|PACid:17968962  ......----------------LFEKAVTPSDVGKLN----RLVIPKQHAEKH.FPLQ--...
cassava4.1_010068m|PACid:17962687  ......----------------LFEKAVTPSDVGKLN----RLVIPKQHAEKY.FPLQ-N...
cassava4.1_004122m|PACid:17971854  ......--------------IVAFAKILTPSDANNGG----GFSVPRFCADSI.FPPL-N...
cassava4.1_002980m|PACid:17967195  ......-----------QEKPASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_012252m|PACid:17992340  ......----------------MFEKPLTPSDVGKLN----RLVIPKQHAEKY.FPLG--...
cassava4.1_009838m|PACid:17968724  ......---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_022877m|PACid:17973703  ......---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY.FPL--D...
cassava4.1_002960m|PACid:17968723  ......---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_008697m|PACid:17975779  ......---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY.FPL--D...
cassava4.1_002684m|PACid:17967245  ......---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_012885m|PACid:17963793  ......----------------MFDKVVTPSDVGKLN----RLVIPKQYAEKY.FPL--D...
cassava4.1_002668m|PACid:17968894  ......-------------KPASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_004707m|PACid:17980850  ......---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_004716m|PACid:17980849  ......---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI.FPRL-D...
cassava4.1_021263m|PACid:17975434  ......---------------VMFEKPLTPSDVGKLN----RLVIPKQHAEKY.FPLS--...
cassava4.1_031993m|PACid:17974501  ......----------ETYTIHSFHKTLTASDISTRG----SLFIYRKHAEDC.LPPL-D...
cassava4.1_030248m|PACid:17986136  ......-----------------FQKELTPSDVGKLN----RLVIPKKFATKF.FPSMSE...
cassava4.1_023592m|PACid:17988096  ......-----------------FQKELTPSDVGKLN----RLVIPKKFAVKY.FPYISG...
cassava4.1_021579m|PACid:17973413  ......----------------LFQKELTPSDVGTLN----RLVIPKRFAIKY.FPCITGnme
cassava4.1_012400m|PACid:17989033  ......-----------------------------------------------.------...
cassava4.1_013238m|PACid:17989499  ......-----------------------------------------------.------...
cassava4.1_030600m|PACid:17989063  ......-------------------------------------SIPRKFVRKY.------...
cassava4.1_013029m|PACid:17988785  ......-----------------------------------------------.------...
cassava4.1_026645m|PACid:17984680  ......-------------------------------------YVPSRFAKTY.LNRF--...
cassava4.1_025209m|PACid:17989519  ......-----------------------------------------------.------...
cassava4.1_030966m|PACid:17978826  ......----------------LFRKELTQTDVTHIK----GFHIPKEHAMEY.FPPLAGvns
cassava4.1_013543m|PACid:17989532  ......-----------------------------------------------.------...
cassava4.1_013045m|PACid:17989531  ......-----------------------------------------------.------...
cassava4.1_006650m|PACid:17970733  ......-----------------------------------------------.------...
cassava4.1_028222m|PACid:17988718  ......-----------------------------------------------.------...
cassava4.1_010446m|PACid:17984628  ......-------------------------------------YLPSCFAEKN.LNGV--...
cassava4.1_033218m|PACid:17977697  ......-----------------------------------------------.------...
cassava4.1_009699m|PACid:17980107  ......-----------------------------------------------.------...
cassava4.1_024894m|PACid:17976320  ......----------------LFRKELTQTDVTHIK----GFHIPKEYAMQY.FPPLAG...
cassava4.1_007952m|PACid:17977731  ......-------------------------------------YLPSCFAEKN.LNGV--...
cassava4.1_006729m|PACid:17980106  ......-----------------------------------------------.------...
cassava4.1_023688m|PACid:17988714  ......------------------------------------MSIPASFAMKY.FPLK-H...
cassava4.1_006855m|PACid:17977730  ......-------------------------------------YLPSCFAEKN.LNGV--...
cassava4.1_004019m|PACid:17964412  ......--------------------------------------IPHQFSAAH.LPNC--...
cassava4.1_004042m|PACid:17964413  ......--------------------------------------IPHQFSAAH.LPNC--...
cassava4.1_005196m|PACid:17970764  ......-----------------------------------------------.------...
cassava4.1_004019m|PACid:17964412  ......-----------------------------------------------.------...
cassava4.1_004019m|PACid:17964412  ......-----------------------------------------------.------...
cassava4.1_004042m|PACid:17964413  ......-----------------------------------------------.------...
cassava4.1_004042m|PACid:17964413  ......-----------------------------------------------.------...
cassava4.1_025302m|PACid:17971686  ......------------------QKVLKQSDVGNLG----RIVLPKKEAETH.LPEL--...
cassava4.1_021232m|PACid:17984355  ......------------------QKVLKQSDVGNLG----RIVLPKKEAEIH.LPEL--...
cassava4.1_010400m|PACid:17985434  ......-----------------------------------------------.------...
cassava4.1_031416m|PACid:17959850  ......-----------------------------------------------.------...
cassava4.1_025209m|PACid:17989519  ......--------------------------------------IQARFAVKY.FPKK--...
cassava4.1_023034m|PACid:17973665  ......-----------------------------------------------.------...
cassava4.1_026568m|PACid:17977720  ......--------------------------------------IPRKFVRKF.GDELSG...
cassava4.1_024159m|PACid:17977134  ......-----------------------------------------------.------...
cassava4.1_011420m|PACid:17984629  ......-----------------------------------------------.------...
cassava4.1_029589m|PACid:17989515  ......-----------------------------------------------.------...
cassava4.1_010446m|PACid:17984628  ......-----------------------------------------------.------...
cassava4.1_026835m|PACid:17970017  ......-------------------KELKNSDVGSLG----RIVLPKRGAEEN.LPILSD...
cassava4.1_010015m|PACid:17977732  ......---------------------------------------P-------.------...
cassava4.1_007952m|PACid:17977731  ......---------------------------------------P-------.------...
cassava4.1_006855m|PACid:17977730  ......---------------------------------------P-------.------...
cassava4.1_021264m|PACid:17985936  ......-----------------------------------------------.------...
cassava4.1_032875m|PACid:17989505  ......-----------------------------------------------.------...
cassava4.1_027517m|PACid:17989062  ......-----------------------------------------------.------...
cassava4.1_023093m|PACid:17985435  ......---------------------------S-------------------.------...
cassava4.1_026568m|PACid:17977720  ......--------------------------------------LPSCFARKH.LNGV--...
cassava4.1_028222m|PACid:17988718  ......-----------------------------------------------.------...
cassava4.1_012186m|PACid:17992633  ......-----------------------------------------------.------...
cassava4.1_001569m|PACid:17970131  ......----------------LFEKMLSASDAGRIG----RLVLPKKCAEAY.FPPISH...
cassava4.1_001573m|PACid:17990861  ......----------------LFEKMLSASDAGRIG----RLVLPKKCAEAY.FPPISH...
cassava4.1_026585m|PACid:17992650  ......-----------------------------------------------.------...
cassava4.1_001576m|PACid:17984754  ......----------------LFEKVLSASDAGRIG----RLVLPKACAEAF.FPPISQ...
cassava4.1_022865m|PACid:17992636  ......-----------------------------------------------.------...
cassava4.1_033218m|PACid:17977697  ......-----------------------------------------------.------...
cassava4.1_023688m|PACid:17988714  ......-----------------------------------------------.------...
cassava4.1_026585m|PACid:17992650  ......-----------------------------------------------.------...
cassava4.1_001408m|PACid:17965912  ......----------------LFEKVLSASDAGRIG----RLVLPKACAEAY.FPPISQ...
cassava4.1_013029m|PACid:17988785  ......---------------------------T-------------------.------...
cassava4.1_028119m|PACid:17992629  ......-------------------------------------VIPRRFVDKTgLDSKRN...
cassava4.1_013968m|PACid:17985433  ......-----------------------------------------------.------...
cassava4.1_027517m|PACid:17989062  ......-----------------------------------------------.------...
cassava4.1_026645m|PACid:17984680  ......-----------------------------------------------.------...
cassava4.1_028119m|PACid:17992629  ......-----------------------------------------------.------...
cassava4.1_031416m|PACid:17959850  ......-----------------------------------------------.------...
cassava4.1_013968m|PACid:17985433  ......-----------------------------------------------.------...
cassava4.1_031982m|PACid:17968160  ......----------------SFSKKLTASDTSTYG----GLSVLKRHAEEC.LPPL-D...
cassava4.1_013045m|PACid:17989531  ......-----------------------------------------------.------...
cassava4.1_012186m|PACid:17992633  ......-----------------------------------------------.------...
cassava4.1_021264m|PACid:17985936  ......-----------------------------------------------.------...
cassava4.1_031416m|PACid:17959850  ......-----------------------------------------------.------...
cassava4.1_023815m|PACid:17977737  ......-----------------------------------------------.------...
cassava4.1_028222m|PACid:17988718  ......-----------------------------------------------.------...
cassava4.1_029589m|PACid:17989515  ......--------------------------------------------Q--.------...
cassava4.1_012400m|PACid:17989033  ......-----------------------------------------------.------...
cassava4.1_013238m|PACid:17989499  ......-----------------------------------------------.------...
cassava4.1_030600m|PACid:17989063  ......-----------------------------------------------.------...
cassava4.1_022637m|PACid:17989488  ......-----------------------------------------------.------...
cassava4.1_010400m|PACid:17985434  ......-------------------------------------SIPSAWTTKH.LRSL--...
cassava4.1_032875m|PACid:17989505  ......-----------------------------------------------.------...
cassava4.1_022637m|PACid:17989488  ......-----------------------------------------------.------...
cassava4.1_026340m|PACid:17986296  ......-----------KASALSFSKKLTSSDTSTHG----GFSVLKRHAEEC.LPPM-D...
cassava4.1_031416m|PACid:17959850  ......-----------------------------------------------.------...
cassava4.1_027543m|PACid:17993392  ......------------------------------------------VVRCL.LPLL-N...
cassava4.1_032104m|PACid:17993510  ......------------------------------------------VVRCL.LPLL-N...
cassava4.1_021168m|PACid:17971073  .kywht-----------------------------------------------.------...
cassava4.1_022865m|PACid:17992636  ......-----------------------------------------------.------...
cassava4.1_021291m|PACid:17971078  .....k-----------------------------------------------.------...
cassava4.1_026028m|PACid:17971072  kywhts-----------------------------------------------.------...
cassava4.1_013543m|PACid:17989532  ......-----------------------------------------------.------...
cassava4.1_025743m|PACid:17965438  .kywht-----------------------------------------------.------...
cassava4.1_032495m|PACid:17977842  lkywht-----------------------------------------------.------...
cassava4.1_023815m|PACid:17977737  ......-----------------------------------------------.------...
cassava4.1_026201m|PACid:17962468  ......-----------------------------------------------.------...
cassava4.1_030107m|PACid:17962538  ..vfsk-----------------------------------------------.------...
cassava4.1_031569m|PACid:17992125  .kywht-----------------------------------------------.------...
cassava4.1_033082m|PACid:17962430  pvfskg-----------------------------------------------.------...
cassava4.1_024104m|PACid:17991311  ......-----------------------------------------------.------...
cassava4.1_027512m|PACid:17974822  ......----------------LFTKQLSRTDVLY------ALSVPSNALQYFiIPEG--...
cassava4.1_024702m|PACid:17981153  ......-----------------FSKILTSSDILRR------LSMPEN-TIKA.FPPA--...
cassava4.1_031383m|PACid:17989199  ......---------------QLFTKQLSRNDVLS------ALSVPSNALQYFvIPEG--...
cassava4.1_023649m|PACid:17981152  ......-----------------FSKVLTSSDILRR------LSMPEN-TLKA.FPPA--...
cassava4.1_026734m|PACid:17971074  ......-----------------------------------------------.------...
cassava4.1_027843m|PACid:17962441  ......--------------THLFTKTLSSTDVKS------ALSVPCYA-LEF.FPIP--...
cassava4.1_028150m|PACid:17981151  ......-----------------FSKILTSVDIHR------GLEIPHDRCDDV.LVELL-...
cassava4.1_031965m|PACid:17965416  ......-------------------KRLTSSDLGSH-----------------.------...
cassava4.1_024497m|PACid:17966841  ......-----------------IQKAITNTDTQDNQ---GRLSMPKKQVLCE.FLNEDE...
cassava4.1_022215m|PACid:17981154  ......-----------------FSKILTSVDINK------GLEIPHDRCDDV.LAEL-Q...
cassava4.1_022611m|PACid:17962458  ......--------------THLFTKTLSSTDVKS------ALSVPCYA-LEF.FPIP--...
cassava4.1_027733m|PACid:17983747  ......-----------------------------------------------.------...
cassava4.1_024470m|PACid:17965913  ......-----------------------------------------------.------...
cassava4.1_030218m|PACid:17962472  ......----------------------------------------------K.YPIL-D...
cassava4.1_023093m|PACid:17985435  ......-----------------------------------------------.------...
cassava4.1_031243m|PACid:17965734  ......-----------------------------------------------.------...
cassava4.1_021320m|PACid:17962548  ......-----------------------------------------------.------...
cassava4.1_028443m|PACid:17983773  ......-----------------------------------------------.------...
cassava4.1_022475m|PACid:17983750  ......----------------LFSKMLTRTDIES------GLCISTSSLSQLpFD----...
cassava4.1_033045m|PACid:17976110  ......-----------------------------------------------.------...
cassava4.1_032970m|PACid:17984492  ......-----------------------------------------------.------...
cassava4.1_023604m|PACid:17981149  ......------------------------------------FSIPEGEFSKE.FDFI-D...
cassava4.1_026980m|PACid:17986725  ......-----------------------------------------------.------...
cassava4.1_032427m|PACid:17962609  ......----------------------------------------------D.FTAF--...
cassava4.1_033446m|PACid:17981150  ......-----------------------------------------------.------...
cassava4.1_027477m|PACid:17962512  ......-----------------------------------------------.------...
cassava4.1_025827m|PACid:17962542  ......-----------------------------------------------.------...
cassava4.1_025422m|PACid:17963857  ......-----------------------------------------------.------...
cassava4.1_029527m|PACid:17970463  ......-----------------------------------------------.------...
cassava4.1_029244m|PACid:17962611  ......-----------------------------------------------.------...
cassava4.1_032678m|PACid:17970465  ......-----------------------------------------------.------...
cassava4.1_022924m|PACid:17974798  ......---------------------------------------------KH.LPSF--...
cassava4.1_026225m|PACid:17970464  ......-----------------------------------------------.------...
cassava4.1_031810m|PACid:17962527  ......-----------------------------------------------.------...
cassava4.1_030655m|PACid:17962547  ......----------------------------------------KGYYERN.FTA---...
cassava4.1_023706m|PACid:17962525  ......-----------------------------------------------.------...
cassava4.1_026336m|PACid:17974807  ......-----------------FSKILTSVDINK------GLEIPHDRCDDV.LAGL-Q...
cassava4.1_027448m|PACid:17962554  ......-----------------------------------------------.------...
cassava4.1_026234m|PACid:17989442  ......-----------------------------------------------.------...
cassava4.1_031392m|PACid:17962488  ......-----------------------------------------------.------...


                                                             60        70          80               
                                                              |         |           |               
d1na6a1                              .....TR.....ELNP.........SVFLTAHVSSHD.C.PDSEARAIYYNSAHF.......G
cassava4.1_002377m|PACid:17972846  .....FS.....QQPP.........AQELIAR--DLH.D.VEWKFRHIFRGQ---.......-
cassava4.1_001923m|PACid:17979526  .....FS.....QQPP.........AQELIAR--DLH.D.VEWKFRHIFRGQ---.......-
cassava4.1_001769m|PACid:17972845  .....FS.....QQPP.........AQELIAR--DLH.D.VEWKFRHIFRGQ---.......-
cassava4.1_001357m|PACid:17970373  .....FS.....QQPP.........AQELIAR--DLH.D.NEWKFRHIFRGQ---.......-
cassava4.1_001328m|PACid:17972625  .....FS.....QQPP.........AQELIAR--DLH.D.NEWKFRHIFRGQ---.......-
cassava4.1_001154m|PACid:17972624  .....FS.....QQPP.........AQELIAR--DLH.D.NEWKFRHIFRGQ---.......-
cassava4.1_001355m|PACid:17990076  .....YT.....MQPP.........TQELVVR--DLH.D.NTWTFRHIYRGQ---.......-
cassava4.1_001105m|PACid:17990075  .....YT.....MQPP.........TQELVVR--DLH.D.NTWTFRHIYRGQ---.......-
cassava4.1_001995m|PACid:17968878  .....YK.....QQRP.........SQELVAK--DLH.G.VEWRFRHIYRGQ---.......-
cassava4.1_001979m|PACid:17980934  .....YK.....QQRP.........SQELVAK--DLH.G.VEWRFRHIYRGQ---.......-
cassava4.1_000609m|PACid:17992784  .....YS.....MQPP.........AQELVAR--DLH.E.NAWTFRHIYRGQ---.......-
cassava4.1_000604m|PACid:17965279  .....FS.....MQPP.........AQELGAK--DLH.D.NAWTFRHIYRGQ---.......-
cassava4.1_000610m|PACid:17980095  .....FS.....MQPP.........AQELVAR--DLH.D.NVWTFRHIYRGQ---.......-
cassava4.1_004521m|PACid:17974505  .....MS.....QQPP.........WQELVAS--DLH.G.NSWHFRHIFRGQ---.......-
cassava4.1_004533m|PACid:17974506  .....MS.....QQPP.........WQELVAS--DLH.G.NSWHFRHIFRGQ---.......-
cassava4.1_002969m|PACid:17974504  .....MS.....QQPP.........WQELVAS--DLH.G.NSWHFRHIFRGQ---.......-
cassava4.1_002399m|PACid:17970035  .....YA.....QQRP.........SQELVAK--DLH.G.FQWRFRHIYRGQ---.......-
cassava4.1_002408m|PACid:17978468  .....MN.....QATP.........TQELAAK--DLH.G.YEWRFKHIFRGQ---.......-
cassava4.1_001567m|PACid:17965008  .....MS.....KQPP.........TQELIAK--DLH.G.NEWRFRHIFRGQ---.......-
cassava4.1_001855m|PACid:17967456  .....MS.....RQPP.........TQELMAK--DLH.G.NEWRFRHIFRGQ---.......-
cassava4.1_001964m|PACid:17967457  .....MS.....RQPP.........TQELMAK--DLH.G.NEWRFRHIFRGQ---.......-
cassava4.1_001542m|PACid:17967454  .....MS.....RQPP.........TQELMAK--DLH.G.NEWRFRHIFRGQ---.......-
cassava4.1_001544m|PACid:17967455  .....MS.....RQPP.........TQELMAK--DLH.G.NEWRFRHIFRGQ---.......-
cassava4.1_002885m|PACid:17975736  .....MN.....QATP.........TQELAAK--DLH.G.YNWRFKHIFRGQ---.......-
cassava4.1_003285m|PACid:17970763  .....MA.....QPTP.........TQELVAK--DLH.G.YEWRFKHIFRGQ---.......-
cassava4.1_002762m|PACid:17970761  .....MA.....QPTP.........TQELVAK--DLH.G.YEWRFKHIFRGQ---.......-
cassava4.1_002772m|PACid:17970762  .....MA.....QPTP.........TQELVAK--DLH.G.YEWRFKHIFRGQ---.......-
cassava4.1_002216m|PACid:17983384  .....MS.....LQPP.........AQELVAK--DLL.G.NKWHFRHIFRGQ---.......-
cassava4.1_010157m|PACid:17968962  .....-S.....GNNS.........TKGVLLNFEDIS.G.KVWRFRYSYWNS---.......-
cassava4.1_010068m|PACid:17962687  .....VS.....NSTK.........GVLLNFE--DIT.G.KVWRFRYSYWNS---.......-
cassava4.1_004122m|PACid:17971854  .....YQ.....AEPP.........VQTLTVT--DIH.G.VTWDFRHIYRGT---.......-
cassava4.1_002980m|PACid:17967195  .....YS.....AEPP.........VQTIIAK--DVH.G.ETWKFRHIYRGT---.......-
cassava4.1_012252m|PACid:17992340  .....GD.....SADK.........GLFLSFE--DES.G.KLWRFRYSYWNS---.......-
cassava4.1_009838m|PACid:17968724  .....YS.....AEPP.........VQTILVK--DVH.G.ETWKFRHIYRGT---.......-
cassava4.1_022877m|PACid:17973703  .....SS.....TNDK.........GLLLNFE--DRT.G.KAWRFRYSYWNS---.......-
cassava4.1_002960m|PACid:17968723  .....YS.....AEPP.........VQTILVK--DVH.G.ETWKFRHIYRGT---.......-
cassava4.1_008697m|PACid:17975779  .....ST.....SNEK.........GLLLNFE--DRN.G.KPWRFRYSYWNS---.......-
cassava4.1_002684m|PACid:17967245  .....YS.....ADPP.........VQTILAK--DVH.G.ETWKFRHIYRGT---.......-
cassava4.1_012885m|PACid:17963793  .....ST.....SSEK.........GLLLNFE--DRN.G.KPWRFRYSYWNS---.......-
cassava4.1_002668m|PACid:17968894  .....YS.....ADPP.........VQTVIAK--DVH.G.QIWKFRHIYRGT---.......-
cassava4.1_004707m|PACid:17980850  .....YS.....ADPP.........VQTVVAK--DVH.G.EMWKFRHIYRGT---.......-
cassava4.1_004716m|PACid:17980849  .....YS.....ADPP.........VQTVVAK--DVH.G.EMWKFRHIYRGT---.......-
cassava4.1_021263m|PACid:17975434  .....--.....GNTV.........DKVLLLSFEDEL.G.KWWRFRYSYWSS---.......-
cassava4.1_031993m|PACid:17974501  .....MS.....QQPP.........RQDLIAA--DLH.R.NKWHFQHIFRGK---.......-
cassava4.1_030248m|PACid:17986136  .....VD.....QENGvd.......DRQLAFY--DKA.M.KLWKFRYCYWRS---.......-
cassava4.1_023592m|PACid:17988096  .....NM.....ENDKehglghgleDVELVFY--DRL.M.KSWKFRYCYWRS---.......-
cassava4.1_021579m|PACid:17973413  eddngEG.....GERE.........DTELVFY--DRL.M.KCWKFRYCYWRS---.......-
cassava4.1_012400m|PACid:17989033  .....--.....----.........------------.-.---------------.......-
cassava4.1_013238m|PACid:17989499  .....--.....----.........-------LTDPT.G.NSWKVDLLKNGNDVW.......-
cassava4.1_030600m|PACid:17989063  .....--.....----.........------------.-.---------------.......-
cassava4.1_013029m|PACid:17988785  .....--.....----.........-V----------.-.---------------.......-
cassava4.1_026645m|PACid:17984680  .....--.....----.........HKHIKLQ--GSD.G.KEWIVLLLWKSWGRV.......D
cassava4.1_025209m|PACid:17989519  .....--.....----.........----E-------.-.---------------.......-
cassava4.1_030966m|PACid:17978826  ....sGG.....DENG.........NKSMELTFFDRH.R.RPWTFRYSYWKS---.......-
cassava4.1_013543m|PACid:17989532  .....--.....----.........------------.-.----V----------.......-
cassava4.1_013045m|PACid:17989531  .....--.....----.........------------.-.----V----------.......-
cassava4.1_006650m|PACid:17970733  .....--.....----.........--IITLE--DEC.G.KGFRMKYIAYKTGLS.......A
cassava4.1_028222m|PACid:17988718  .....--.....----.........-----ATLITKD.G.KTWSVEFCYTVS---.......N
cassava4.1_010446m|PACid:17984628  .....--.....----.........SGFIKLQL--CD.G.KQWPVRCLYRGG---.......-
cassava4.1_033218m|PACid:17977697  .....--.....----.........-----------D.G.KQWPVRCVS------.......-
cassava4.1_009699m|PACid:17980107  .....--.....----.........------------.-.---------------.......-
cassava4.1_024894m|PACid:17976320  .....VSsagggDENG.........SKSIELTFFDRH.C.RPWTFRYSYWKS---.......-
cassava4.1_007952m|PACid:17977731  .....--.....----.........SGFIKLQ--FCD.G.KQWSVRCLYRGG---.......-
cassava4.1_006729m|PACid:17980106  .....--.....----.........------------.-.---------------.......-
cassava4.1_023688m|PACid:17988714  .....TS.....DVN-.........-------LNGLD.G.RTWSVKFYFNKA---.......S
cassava4.1_006855m|PACid:17977730  .....--.....----.........SGFIKLQ--FCD.G.KQWSVRCLYRGG---.......-
cassava4.1_004019m|PACid:17964412  .....--.....----.........KTEIVLR--NSQ.G.ICWTVNAVPDSK---.......-
cassava4.1_004042m|PACid:17964413  .....--.....----.........KTEIVLR--NSQ.G.ICWTVNAVPDSK---.......-
cassava4.1_005196m|PACid:17970764  .....--.....--TP.........TQELVAK--DLH.G.YEWRFKHIFRGQ---.......-
cassava4.1_004019m|PACid:17964412  .....--.....----.........------------.-.---------------.......-
cassava4.1_004019m|PACid:17964412  .....--.....----.........------------.-.-------------SV.......P
cassava4.1_004042m|PACid:17964413  .....--.....----.........------------.-.---------------.......-
cassava4.1_004042m|PACid:17964413  .....--.....----.........------------.-.-------------SV.......P
cassava4.1_025302m|PACid:17971686  .....--.....EARD.........GISIAME--DIGtS.RIWNMRYRFWPN---.......-
cassava4.1_021232m|PACid:17984355  .....--.....EARD.........GISIAME--DIGtS.RIWNMRYRFWPN---.......-
cassava4.1_010400m|PACid:17985434  .....--.....----.........---------D--.-.---------------.......-
cassava4.1_031416m|PACid:17959850  .....--.....----.........------------.-.---------------.......-
cassava4.1_025209m|PACid:17989519  .....--.....----.........RQSGDATLHGLD.G.RSWPVKFYLYNRACN.......E
cassava4.1_023034m|PACid:17973665  .....--.....----.........------------.-.---------------.......G
cassava4.1_026568m|PACid:17977720  .....VA.....----.........--TLTVP--DDR.I.WLVTIRQI-------.......-
cassava4.1_024159m|PACid:17977134  .....--.....----.........------------.-.---------------.......-
cassava4.1_011420m|PACid:17984629  .....--.....----.........------------.-.---------------.......-
cassava4.1_029589m|PACid:17989515  .....--.....----.........------------.-.---------------.......-
cassava4.1_010446m|PACid:17984628  .....--.....----.........------------.-.---------------.......-
cassava4.1_026835m|PACid:17970017  .....KE.....GM--.........--QVVIR--DLN.SpKEWSLKFKFWSN---.......-
cassava4.1_010015m|PACid:17977732  .....--.....----.........------------.-.---------------.......-
cassava4.1_007952m|PACid:17977731  .....--.....----.........------------.-.---------------.......-
cassava4.1_006855m|PACid:17977730  .....--.....----.........------------.-.---------------.......-
cassava4.1_021264m|PACid:17985936  .....--.....----.........------------.-.-------VYIGQ---.......-
cassava4.1_032875m|PACid:17989505  .....--.....----.........------------.-.---------------.......-
cassava4.1_027517m|PACid:17989062  .....--.....----.........------------.-.---------------.......-
cassava4.1_023093m|PACid:17985435  .....--.....----.........------------.-.---------------.......-
cassava4.1_026568m|PACid:17977720  .....--.....----.........SDWIKLQ--FSD.G.KLWSVRCSYKAG---.......-
cassava4.1_028222m|PACid:17988718  .....--.....----.........------------.-.---------------.......-
cassava4.1_012186m|PACid:17992633  .....--.....----.........------------.-.---------------.......-
cassava4.1_001569m|PACid:17970131  .....PE.....GL--.........----PLKVQDSK.G.KEWVFQFRFWPN---.......-
cassava4.1_001573m|PACid:17990861  .....PE.....GL--.........----PLKVQDSK.G.KEWVFQFRFWPN---.......-
cassava4.1_026585m|PACid:17992650  .....--.....----.........------------.-.-S-------------.......-
cassava4.1_001576m|PACid:17984754  .....SE.....----.........--GLPLSIKDVK.G.GEWTFQFRFWPN---.......-
cassava4.1_022865m|PACid:17992636  .....--.....----.........-----VTLRDEN.G.QLWPVKIIFRDD---.......-
cassava4.1_033218m|PACid:17977697  .....--.....----.........------------.-.---------------.......-
cassava4.1_023688m|PACid:17988714  .....--.....----.........------------.-.---------------.......-
cassava4.1_026585m|PACid:17992650  .....--.....----.........------------.-.---------------.......-
cassava4.1_001408m|PACid:17965912  .....PE.....G---.........---LPLRIQDVK.G.KDWVFQFRFWPN---.......-
cassava4.1_013029m|PACid:17988785  .....--.....----.........------------.-.---------------.......-
cassava4.1_028119m|PACid:17992629  .....TL.....MKDP.........QGRV-------H.T.VDVKVR---------.......-
cassava4.1_013968m|PACid:17985433  .....--.....--NP.........SSKLWAV--KLC.S.IDSKC----------.......-
cassava4.1_027517m|PACid:17989062  .....--.....----.........------------.-.---------------.......-
cassava4.1_026645m|PACid:17984680  .....--.....----.........------------.-.-----R---------.......-
cassava4.1_028119m|PACid:17992629  .....--.....----.........------------.-.---------------.......-
cassava4.1_031416m|PACid:17959850  .....--.....----.........------------.-.---------------.......-
cassava4.1_013968m|PACid:17985433  .....--.....----.........------------.-.---------------.......-
cassava4.1_031982m|PACid:17968160  .....MS.....SEPV.........MRELIAK--DLH.G.NDWRFQHIFRGN---.......-
cassava4.1_013045m|PACid:17989531  .....--.....----.........------------.-.---------------.......-
cassava4.1_012186m|PACid:17992633  .....--.....----.........------------.-.---------------.......-
cassava4.1_021264m|PACid:17985936  .....--.....----.........------------.-.-------------HL.......K
cassava4.1_031416m|PACid:17959850  .....--.....----.........------------.-.---------------.......-
cassava4.1_023815m|PACid:17977737  .....--.....----.........------------.-.---------------.......-
cassava4.1_028222m|PACid:17988718  .....--.....----.........------------.-.---------------.......K
cassava4.1_029589m|PACid:17989515  .....--.....----.........------------.-.---------------.......-
cassava4.1_012400m|PACid:17989033  .....--.....----.........------------.-.---------------.......-
cassava4.1_013238m|PACid:17989499  .....--.....----.........------------.-.--------VYSN---.......-
cassava4.1_030600m|PACid:17989063  .....--.....----.........------------.-.--WIVKLTIYPH---.......-
cassava4.1_022637m|PACid:17989488  .....--.....----.........------------.-.---------------.......-
cassava4.1_010400m|PACid:17985434  .....--.....-EKQ.........DVILRTK-----.E.NTWHTKFYYQKSKNS.......G
cassava4.1_032875m|PACid:17989505  .....--.....--S-.........------------.-.---------------.......-
cassava4.1_022637m|PACid:17989488  .....--.....----.........------------.-.---------------.......-
cassava4.1_026340m|PACid:17986296  .....MS.....QDPP.........EQKLFAK--DLH.G.ENGELR---------.......-
cassava4.1_031416m|PACid:17959850  .....--.....----.........---------DAK.G.RSWPAKLWHKTS---.......-
cassava4.1_027543m|PACid:17993392  .....RE.....EENP.........CQGIKVKTYDMQ.G.NEYDMAFKLWAS---.......-
cassava4.1_032104m|PACid:17993510  .....RE.....EENP.........CQGIKVKTYDMQ.G.NEYDMAFKLWAS---.......-
cassava4.1_021168m|PACid:17971073  .....--.....----.........------------.-.---------------.......-
cassava4.1_022865m|PACid:17992636  .....--.....----.........------TLKDHT.G.MMWNVQ--------L.......E
cassava4.1_021291m|PACid:17971078  .....--.....----.........------------.-.--------YWHT---.......-
cassava4.1_026028m|PACid:17971072  .....--.....----.........------------.-.---------------.......-
cassava4.1_013543m|PACid:17989532  .....--.....----.........------------.-.---------------.......-
cassava4.1_025743m|PACid:17965438  .....--.....----.........------------.-.---------------.......-
cassava4.1_032495m|PACid:17977842  .....--.....----.........------------.-.---------------.......-
cassava4.1_023815m|PACid:17977737  .....--.....----.........------------.-.---------------.......-
cassava4.1_026201m|PACid:17962468  .....--.....----.........------------.-.---------------.......-
cassava4.1_030107m|PACid:17962538  .....--.....----.........------------.-.---------------.......-
cassava4.1_031569m|PACid:17992125  .....--.....----.........------------.-.---------------.......-
cassava4.1_033082m|PACid:17962430  .....--.....----.........------------.-.---------------.......-
cassava4.1_024104m|PACid:17991311  .....--.....----.........-IFISMD--DLD.GlHVWSFKYRYWPN---.......-
cassava4.1_027512m|PACid:17974822  .....--.....--AH.........SVEFEAV--DLT.G.FTWRFRLSTRSTGR-.......-
cassava4.1_024702m|PACid:17981153  .....--.....--QK.........GHEIILHVKDDS.G.NVWSFRC--------.......-
cassava4.1_031383m|PACid:17989199  .....--.....--AH.........SVEFEAV--DLT.G.FTWRFRLSTRST--G.......P
cassava4.1_023649m|PACid:17981152  .....--.....QKGH.........EIILPVK--DDA.G.ILWSFRCRIPAI---.......-
cassava4.1_026734m|PACid:17971074  .....--.....----.........------------.-.--------YWHT---.......-
cassava4.1_027843m|PACid:17962441  .....--.....--QG.........DHVMQFEAVDIT.G.FIWRFRLSTRCTG--.......R
cassava4.1_028150m|PACid:17981151  .....--.....--IT.........GQRMKILVADVE.G.NTWNFV---------.......-
cassava4.1_031965m|PACid:17965416  .....--.....----.........------------.-.---------------.......-
cassava4.1_024497m|PACid:17966841  .....KE.....KLEK.........DKHLQVKIIDPN.L.EVSDMN---------.......-
cassava4.1_022215m|PACid:17981154  .....IT.....G---.........-QRMEILVVDMQ.G.NPWNF----------.......-
cassava4.1_022611m|PACid:17962458  .....--.....--QG.........DHVMQFEAVDIT.G.FIWRFRLSTRCTG--.......R
cassava4.1_027733m|PACid:17983747  .....--.....----.........---------GNH.F.LDLKVK--YKNQKMGlrccrrkE
cassava4.1_024470m|PACid:17965913  .....--.....----.........------------.-.-------MYLRQWNL.......R
cassava4.1_030218m|PACid:17962472  .....QN.....G---.........HVSKFIISFDKN.G.KRWEFPLATRNTGIY.......-
cassava4.1_023093m|PACid:17985435  .....--.....--NQ.........DVILRMK-----.E.NTWRTRLYYRRK---.......-
cassava4.1_031243m|PACid:17965734  .....--.....----.........------------.-.--------YLRQWNL.......K
cassava4.1_021320m|PACid:17962548  .....--.....----.........------ISFDKN.G.KRWEFPLATRNTGP-.......-
cassava4.1_028443m|PACid:17983773  .....--.....----.........GQQVNMHVHDEG.G.REWIFPCTIKEDE--.......-
cassava4.1_022475m|PACid:17983750  .....--.....---E.........GQQVNMHVHDEG.G.REWIFPCTIKEDE--.......-
cassava4.1_033045m|PACid:17976110  .....--.....----.........------------.-.---------FNQRYWp......N
cassava4.1_032970m|PACid:17984492  .....--.....----.........-QQVNMHVHDEG.G.REWIFP---------.......-
cassava4.1_023604m|PACid:17981149  .....VD.....DNSV.........KKFTCCK-----.-.------------RIK.......G
cassava4.1_026980m|PACid:17986725  .....--.....---K.........DEHLQVKIIDPN.L.EVSDMN---------.......-
cassava4.1_032427m|PACid:17962609  .....--.....----.........---------DGK.G.VKWDFVLAIRHTGEY.......-
cassava4.1_033446m|PACid:17981150  .....--.....----.........--SLDMNVHDQS.G.QEWIFSCTIQRNDSV.......G
cassava4.1_027477m|PACid:17962512  .....--.....----.........-WEMDMNVHDDC.G.QEWIFPCSIQRN---.......-
cassava4.1_025827m|PACid:17962542  .....--.....----.........KVEFLVA--DIE.G.NAWNFA-------CT.......T
cassava4.1_025422m|PACid:17963857  .....--.....----.........---------DLT.G.FTWRFRLSTRSTGR-.......-
cassava4.1_029527m|PACid:17970463  .....--.....----.........------------.-.---------R-----.......-
cassava4.1_029244m|PACid:17962611  .....--.....----.........-WEMNMNVHDDC.G.QEWIFPCSIQ-----.......-
cassava4.1_032678m|PACid:17970465  .....--.....----.........------------.-.----F----------.......-
cassava4.1_022924m|PACid:17974798  .....--.....--GD.........NHHLYIEAMDDR.G.YFWSFQCSIRRN---.......G
cassava4.1_026225m|PACid:17970464  .....--.....----.........------------.-.---------------.......-
cassava4.1_031810m|PACid:17962527  .....--.....----.........RQTVNMHVHDEG.G.RKWMFPCCIKED---.......-
cassava4.1_030655m|PACid:17962547  .....--.....----.........--------FDEK.G.VKWNFMLAVR-----.......-
cassava4.1_023706m|PACid:17962525  .....--.....----.........AMEFEATSADNI.H.EHWNFRLCLRNSNNG.......E
cassava4.1_026336m|PACid:17974807  .....IT.....GQRK.........DILLPK------.-.---------------.......-
cassava4.1_027448m|PACid:17962554  .....--.....----.........-MEFEATSAGNI.H.EHWNFRLCLRNSNNG.......E
cassava4.1_026234m|PACid:17989442  .....--.....----.........---------DWH.T.SKS---YIFKKG---.......-
cassava4.1_031392m|PACid:17962488  .....--.....--VP.........DYSLAALPPSGS.G.NKVEFLV----ADIE.......G


                                     90          100         110       120       130       140      
                                      |            |           |         |         |         |      
d1na6a1                              KTR...NEKRITRWGRG..SPLQDPENTGALTLLAFKLDEQGGDCKEVNIWVCASTDEEDVIE
cassava4.1_002377m|PACid:17972846  -PK...RHLLTTGW-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRATRPQT--------
cassava4.1_001923m|PACid:17979526  -PK...RHLLTTGW-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRATRPQT--------
cassava4.1_001769m|PACid:17972845  -PK...RHLLTTGW-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRATRPQT--------
cassava4.1_001357m|PACid:17970373  -PK...RHLLTTGW-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT--------
cassava4.1_001328m|PACid:17972625  -PK...RHLLTTGW-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRTNRPQT--------
cassava4.1_001154m|PACid:17972624  -PK...RHLLTTGW-SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRTNRPQT--------
cassava4.1_001355m|PACid:17990076  -PK...RHLLTTGW-SI..FVGTKRLKAGDSVLFIRDEKSQL-LVGVRRANRQQT--------
cassava4.1_001105m|PACid:17990075  -PK...RHLLTTGW-SI..FVGTKRLKAGDSVLFIRDEKSQL-LVGVRRANRQQT--------
cassava4.1_001995m|PACid:17968878  -PR...RHLLTTGW-SI..FVSQKNLVSGDAVLFLRGENGEL-RLGIRRAARPRN--------
cassava4.1_001979m|PACid:17980934  -PR...RHLLTTGW-SI..FVSQKNLVSGDAVLFLRGEDGEL-RLGIRRAVRPRN--------
cassava4.1_000609m|PACid:17992784  -PK...RHLLTTGW-SV..FVSTKRLFAGDSVLFIRDEKSQL-LLGIRRANRQQP--------
cassava4.1_000604m|PACid:17965279  -PK...RHLLTTGW-SV..FVSTKRLFAGDSVLFIRDEKSQL-LLGVRHANKQQS--------
cassava4.1_000610m|PACid:17980095  -PK...RHLLTTGW-SL..FVSGKRLFAGDSVLFIRDEKQQL-LLGIRRANRQPA--------
cassava4.1_004521m|PACid:17974505  -PR...RHLLTTGW-SV..FVSSKKLVAGDAFIFLRGENGEL-RVGVRRLMRQQI--------
cassava4.1_004533m|PACid:17974506  -PR...RHLLTTGW-SV..FVSSKKLVAGDAFIFLRGENGEL-RVGVRRLMRQQI--------
cassava4.1_002969m|PACid:17974504  -PR...RHLLTTGW-SV..FVSSKKLVAGDAFIFLRGENGEL-RVGVRRLMRQQI--------
cassava4.1_002399m|PACid:17970035  -PR...RHLLTTGW-SA..FVNKKKLLSGDAVLFLRGDDGEL-RLGIRR--------------
cassava4.1_002408m|PACid:17978468  -PR...RHLLTTGW-ST..FVTSKRLVAGDAFVFLRGDNGEL-RVGVRRLARQQS--------
cassava4.1_001567m|PACid:17965008  -PR...RHLLQSGW-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG--------
cassava4.1_001855m|PACid:17967456  -PR...RHLLQSGW-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG--------
cassava4.1_001964m|PACid:17967457  -PR...RHLLQSGW-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG--------
cassava4.1_001542m|PACid:17967454  -PR...RHLLQSGW-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG--------
cassava4.1_001544m|PACid:17967455  -PR...RHLLQSGW-SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG--------
cassava4.1_002885m|PACid:17975736  -PR...RHLLTTGW-ST..FVTSKRLVAGDAFVFLRGDNGEL-RVGVRRLARQQS--------
cassava4.1_003285m|PACid:17970763  -PR...RHLLTTGW-ST..FVTSKRLVAGDSFVFLRGKNGEL-RVGVRRLARQQS--------
cassava4.1_002762m|PACid:17970761  -PR...RHLLTTGW-ST..FVTSKRLVAGDSFVFLRGKNGEL-RVGVRRLARQQS--------
cassava4.1_002772m|PACid:17970762  -PR...RHLLTTGW-ST..FVTSKRLVAGDSFVFLRGKNGEL-RVGVRRLARQQS--------
cassava4.1_002216m|PACid:17983384  -PR...RHLLQSGW-SL..FVSAKKLVAGDAFIFLRGENGEI-RVGVRRAMRQPS--------
cassava4.1_010157m|PACid:17968962  -SQ...SYVLTKGW-SR..FVKEKNLKAGDIVSFQRSTGPDK---------------------
cassava4.1_010068m|PACid:17962687  -SQ...SYVLTKGW-SR..FVKEKNLKAGDIVSFQRSTG------------------------
cassava4.1_004122m|PACid:17971854  -PR...RHLLTTGW-SK..FVNHKKLIAGDSVVFMRNLAGEM-FIGVRRAVRSNNGSDCARWR
cassava4.1_002980m|PACid:17967195  -PR...RHLLTTGW-SN..FVNQKKLVAGDSIVFLRAENGDL-CVGIRRA-------------
cassava4.1_012252m|PACid:17992340  -SQ...SYVLTKGW-SR..YVKEKQLDAGDVVSFERHRT------------------------
cassava4.1_009838m|PACid:17968724  -PR...RHLLTTGW-SN..FVNQKKLVAGDSIVFLRAENGDL-CVGIRRA-------------
cassava4.1_022877m|PACid:17973703  -SQ...SYVMTKGW-SR..FVKDKKLDAGDIVSFHRGVGETGKD-------------------
cassava4.1_002960m|PACid:17968723  -PR...RHLLTTGW-SN..FVNQKKLVAGDSIVFLRAENGDL-CVGIRRA-------------
cassava4.1_008697m|PACid:17975779  -SQ...SYVMTKGW-SR..FVKEKKLDPGDIVSFQRGVGESGK--------------------
cassava4.1_002684m|PACid:17967245  -PR...RHLLTTGW-ST..FVNHKKLVAGDSIVFLRAENGDL-CVGIRRAK------------
cassava4.1_012885m|PACid:17963793  -SQ...SYVMTKGW-SR..FVKEKQLDAGDIVSFQRGVGESGK--------------------
cassava4.1_002668m|PACid:17968894  -PR...RHLLTTGW-ST..FVNQKKLVAGDSIVFLKAENGDL-FVGIRRAKR-----------
cassava4.1_004707m|PACid:17980850  -PR...RHLLTTGW-ST..FVNHKKLVAGDSIVFLRAENGDL-CVGIRRA-------------
cassava4.1_004716m|PACid:17980849  -PR...RHLLTTGW-ST..FVNHKKLVAGDSIVFLRAENGDL-CVGIRRA-------------
cassava4.1_021263m|PACid:17975434  -SQ...SYVLTKGW-SR..YVKEKRLDAGDIVLFERHRLDS----------------------
cassava4.1_031993m|PACid:17974501  -PK...RHVLTTGW-NA..YVNSKKLAAGDVFIFLRGENGRI-HIGVRRLVRQ----------
cassava4.1_030248m|PACid:17986136  -SQ...SYVFTRGW-NG..FVKEKKLKANDTICFSL---------------------------
cassava4.1_023592m|PACid:17988096  -SQ...SFVFTRGW-NR..FVKEKNLKEKDIVTF-----------------------------
cassava4.1_021579m|PACid:17973413  -SQ...SFVFTRGW-IR..FVKEKNLKEKDV--------------------------------
cassava4.1_012400m|PACid:17989033  ---...------GW-QE..FTEYHSLKHGNMLV------------------------------
cassava4.1_013238m|PACid:17989499  ---...-----------..--------------------------------------------
cassava4.1_030600m|PACid:17989063  ---...-----------..--------------------------------------------
cassava4.1_013029m|PACid:17988785  ---...-----------..--------------------------------------------
cassava4.1_026645m|PACid:17984680  FGK...------GW-NA..FCRENNLQGGEVCVFELI--------------------------
cassava4.1_025209m|PACid:17989519  ---...-----------..--------------------------------------------
cassava4.1_030966m|PACid:17978826  -TQ...TFVFTKGW-RH..FLKMNNLKPKDCVFFYR---------------------------
cassava4.1_013543m|PACid:17989532  ---...-----------..--------------------------------------------
cassava4.1_013045m|PACid:17989531  ---...-----------..--------------------------------------------
cassava4.1_006650m|PACid:17970733  ---...------GW-RQ..FCVAHQLLEGDVLVFQLIE-------------------------
cassava4.1_028222m|PACid:17988718  RKQ...SASLGLGW-NK..FSQENYLEVGDVCVFELI--------------------------
cassava4.1_010446m|PACid:17984628  ---...RAKLSQGW-YE..FTLENNLGEGDVCIFELMRSRDI---------------------
cassava4.1_033218m|PACid:17977697  GKG...GAKLSKGW-TE..FVWENNLEEGDVCIFE----------------------------
cassava4.1_009699m|PACid:17980107  ---...------GW-KA..FCAAHELHEGDVLVFHL---------------------------
cassava4.1_024894m|PACid:17976320  -TQ...TFVFTKGW-KH..FLRMNNLKPKDCVFFYRC--------------------------
cassava4.1_007952m|PACid:17977731  ---...RAKLSQGW-YE..FTLENNLGEGDVCIFELMRSRDI---------------------
cassava4.1_006729m|PACid:17980106  ---...------GW-KA..FCAAHELHEGDVLVFHL---------------------------
cassava4.1_023688m|PACid:17988714  NGQ...PMAKITRGWRV..FAEDNCLEVGDVCAFEL---------------------------
cassava4.1_006855m|PACid:17977730  ---...RAKLSQGW-YE..FTLENNLGEGDVCIFELMRSRDI---------------------
cassava4.1_004019m|PACid:17964412  GRR...IHTFCGGW-MA..FVRDNYINMGDVCIFELVSKC-----------------------
cassava4.1_004042m|PACid:17964413  GRR...IHTFCGGW-MA..FVRDNYINMGDVCIFELVSKC-----------------------
cassava4.1_005196m|PACid:17970764  -PR...RHLLTTGW-ST..FVTSKRLVAGDSFVFLRGKNGEL-RVGVRRLARQQS--------
cassava4.1_004019m|PACid:17964412  ---...------G----..--------------------------------------------
cassava4.1_004019m|PACid:17964412  TTR...VHTSHTFCGGWmaFVRSNDIKIGDVCIFELVRKCEL---------------------
cassava4.1_004042m|PACid:17964413  ---...------G----..--------------------------------------------
cassava4.1_004042m|PACid:17964413  TTR...VHTSHTFCGGWmaFVRSNDIKIGDVCIFELVRKCEL---------------------
cassava4.1_025302m|PACid:17971686  NKS...RMYLLENT-GD..FVRANELQEGDFIVIYSD--------------------------
cassava4.1_021232m|PACid:17984355  NKS...RMYLLENT-GD..FVRTNGLQEGDFIVIYSD--------------------------
cassava4.1_010400m|PACid:17985434  ---...-----------..--------------------------------------------
cassava4.1_031416m|PACid:17959850  ---...------GW-KD..FVEDHDLHVGDFLVFRH---------------------------
cassava4.1_025209m|PACid:17989519  -KRmakIRKFTDGW-SA..FVRGNSLKVGDVCIFELNNSENLQ--------------------
cassava4.1_023034m|PACid:17973665  ---...------GW-RG..FSIAHELLEGDVLVFQLVRPTKF---------------------
cassava4.1_026568m|PACid:17977720  -DQ...KLWFCNGW-HE..FVVHYSICTGHFLVFRYEGN------------------------
cassava4.1_024159m|PACid:17977134  ---...-----AGW-RG..FAIDHKLVDGDAVVFQLVSP------------------------
cassava4.1_011420m|PACid:17984629  ---...-----------..--------------------------------------------
cassava4.1_029589m|PACid:17989515  -EK...DVWLYKGW-RE..FAQHYSLDIGDTVVFKYEKNSHF------HVFICD---------
cassava4.1_010446m|PACid:17984628  ---...-----------..--------------------------------------------
cassava4.1_026835m|PACid:17970017  NKS...RMYVLENT-GD..FVKQNGLEIGDSLTLYEDECKNLYF-------------------
cassava4.1_010015m|PACid:17977732  ---...-----------..--------------------------------------------
cassava4.1_007952m|PACid:17977731  ---...-----------..--------------------------------------------
cassava4.1_006855m|PACid:17977730  ---...-----------..--------------------------------------------
cassava4.1_021264m|PACid:17985936  ---...------GW-SA..FCVANHLKAGDSFLFELIKKG-----------------------
cassava4.1_032875m|PACid:17989505  ---...-----------..----------------------W---------------------
cassava4.1_027517m|PACid:17989062  ---...----LTNGWQE..FVGYYSLACGYFLVF-----------------------------
cassava4.1_023093m|PACid:17985435  ---...-----------..--------------------------------------------
cassava4.1_026568m|PACid:17977720  GA-...--KLSQGW-YE..FSMNNGFAEGDVCVFELLNL------------------------
cassava4.1_028222m|PACid:17988718  ---...-E---------..--------------------------------------------
cassava4.1_012186m|PACid:17992633  ---...-----------..-----S--------------------------------------
cassava4.1_001569m|PACid:17970131  NNS...RMYVLEGV-TP..CIQNMRLQAGDIVTFSRLEPEGKLVMGFR---------------
cassava4.1_001573m|PACid:17990861  NNS...RMYVLEGV-TP..CIQNMRLQAGDIVTFSRLEPEGKLVMGFR---------------
cassava4.1_026585m|PACid:17992650  ---...-----------..--------------------------------------------
cassava4.1_001576m|PACid:17984754  NNS...RMYVLEGV-TP..CIQSMQLQAGDTITFSRIDPGGKLIMGFRK--------------
cassava4.1_022865m|PACid:17992636  ---...-----------..--------------------------------------------
cassava4.1_033218m|PACid:17977697  ---...-----------..-V------------------------------------------
cassava4.1_023688m|PACid:17988714  ---...------GW-QG..FLEYYSLVHGSFLVFEYDKS------------------------
cassava4.1_026585m|PACid:17992650  ---...--SRITGGWAH..FARENFLKVGDVC-------------------------------
cassava4.1_001408m|PACid:17965912  NNS...RMYVLEGV-TP..CIQSMQLQAGDTVTFSRMDPEGKLVMGFRK--------------
cassava4.1_013029m|PACid:17988785  ---...-----------..--------------------------------------------
cassava4.1_028119m|PACid:17992629  -NR...QVRLSSGW-SA..FYKANGLATGDTCVFESLPEKG----------------------
cassava4.1_013968m|PACid:17985433  GKR...SALRGKGW-HE..FYVDNKLKEGDVCLFELDLTRK----------------------
cassava4.1_027517m|PACid:17989062  ---...------GW-KK..FVQENHLEVGDVCVF-----------------------------
cassava4.1_026645m|PACid:17984680  ---...-----------..--------------------------------------------
cassava4.1_028119m|PACid:17992629  ---...-----SGW-NK..FVKDHELETGDFLVFNLVDDKTF---------------------
cassava4.1_031416m|PACid:17959850  ---...-----------..------------W-------------------------------
cassava4.1_013968m|PACid:17985433  ---...------GW-ED..FVTHHDLDLGDFVVFE----------------------------
cassava4.1_031982m|PACid:17968160  ---...-----------..--------------------------------------------
cassava4.1_013045m|PACid:17989531  ---...------GW-HA..FSRENALGVGDVCVFE----------------------------
cassava4.1_012186m|PACid:17992633  ---...---FCSGW-SV..FARENSLEMGDVCIFEL---------------------------
cassava4.1_021264m|PACid:17985936  IPR...NFARMNRLSR-..--------------------------------------------
cassava4.1_031416m|PACid:17959850  ---...------GW-TS..FRDANNLKAGDSFIFKHIEKQKIP--------------------
cassava4.1_023815m|PACid:17977737  -CR...GWSLVLRGGGEe.FFSDNDMQNGDVCLFELIQERD----------------------
cassava4.1_028222m|PACid:17988718  YPP...NSMIAEGW-RS..FATENFLKVGDVCIFELIAN------------------------
cassava4.1_029589m|PACid:17989515  ---...-----------..--------------------------------------------
cassava4.1_012400m|PACid:17989033  ---...----CGGF-TL..FLRENGLKKGDVCIFE----------------------------
cassava4.1_013238m|PACid:17989499  -RR...IASLARGW-TA..FARENCLEAGDICIFEMIER------------------------
cassava4.1_030600m|PACid:17989063  -HN...KGQFLSGW-SV..FVRENSLRKGDVCIFELIDR------------------------
cassava4.1_022637m|PACid:17989488  ---...-------W---..--------------------------------------------
cassava4.1_010400m|PACid:17985434  G--...---LSSGW-KS..FALSNDLQEFDVCV------------------------------
cassava4.1_032875m|PACid:17989505  ---...-----------..--------------------------------------------
cassava4.1_022637m|PACid:17989488  ---...----I------..--------------------------------------------
cassava4.1_026340m|PACid:17986296  ---...-----------..--------------------------------------------
cassava4.1_031416m|PACid:17959850  --D...GRAYIHDW-NA..FRVANDLHPGDSFILELVDKGEM---------------------
cassava4.1_027543m|PACid:17993392  --K...VYVLTTGW-KN..FFMKHGLIENED--------------------------------
cassava4.1_032104m|PACid:17993510  --K...VYVLTTGW-KN..FFIKHGLIENED--------------------------------
cassava4.1_021168m|PACid:17971073  -SK...SYIFNKGWLNN..FVKRRNLVEGDLIGIYWDSREKI---------------------
cassava4.1_022865m|PACid:17992636  KTE...NDLIIKKGWQE..FASHHSLVDADFLVFKYDGNSQF---------------------
cassava4.1_021291m|PACid:17971078  -SK...SYIFNKGWPNN..FVKRRNLVGGDLIGIYWDSTKKI---------------------
cassava4.1_026028m|PACid:17971072  --K...SYIFKKGWLNN..FVKRRNLVEGDLIGIFWDSTG-----------------------
cassava4.1_013543m|PACid:17989532  ---...------GW-HA..FSRENALGVGDVCVFEL---------------------------
cassava4.1_025743m|PACid:17965438  -SK...SYIFNKGWLNN..FVKRRNLVEGDLIGIYWDSTK-----------------------
cassava4.1_032495m|PACid:17977842  -SK...SYIFNKGWQNN..FVKRRHLVEGDLIGIYWDFT------------------------
cassava4.1_023815m|PACid:17977737  ---...-----------..-----------T--------------------------------
cassava4.1_026201m|PACid:17962468  ---...KPVFCKGW-IS..FVKEKHLVAGDEVTFYKEED------------------------
cassava4.1_030107m|PACid:17962538  ---...------GW-IS..FVKEKHLVAGDKVIFYKEED------------------------
cassava4.1_031569m|PACid:17992125  -SK...SYIFNKGWQNN..FVKRRHLVEGDLIGIYWDFT------------------------
cassava4.1_033082m|PACid:17962430  ---...-------W-IS..FVKEKHLVAGDKVIFCKEED------------------------
cassava4.1_024104m|PACid:17991311  NNS...RMYVLENT-GD..FVNTHGLQLGDFI-------------------------------
cassava4.1_027512m|PACid:17974822  YPK...PVILQSSW-HR..FVEQKGLIPNDRVMFFLDHDEE----------------------
cassava4.1_024702m|PACid:17981153  ---...-----------..--------------------------------------------
cassava4.1_031383m|PACid:17989199  YPK...PVILQSSW-HH..FVEQKGLIPNDRVMFFLDHDE-----------------------
cassava4.1_023649m|PACid:17981152  GFS...KPVVFGNW-FK..FVRSKDLKPGDTIV------------------------------
cassava4.1_026734m|PACid:17971074  -SK...SYVFNKGWPNN..FVKRRNLVEGDLIGIYWDSTK-----------------------
cassava4.1_027843m|PACid:17962441  YPK...PVLLRSLW-HF..FVEKKGLVAGDRVMFFREHD------------------------
cassava4.1_028150m|PACid:17981151  ---...-----------..--------------------------------------------
cassava4.1_031965m|PACid:17965416  ---...-----------..--------------------------------------------
cassava4.1_024497m|PACid:17966841  ---...-----------..--------------------------------------------
cassava4.1_022215m|PACid:17981154  ---...-----------..--------------------------------------------
cassava4.1_022611m|PACid:17962458  YPK...PVLLRSLW-HF..FVEKKGLVAGDRVMFF----------------------------
cassava4.1_027733m|PACid:17983747  GTH...PKPVLTKGWVE..FVRREKLKAGDRIVL-----------------------------
cassava4.1_024470m|PACid:17965913  STS...FYALTTRWKK-..--------------------------------------------
cassava4.1_030218m|PACid:17962472  -PK...PSVPPASW-HP..FVAEYGLRAGDSVLFYT---------------------------
cassava4.1_023093m|PACid:17985435  PNR...GGLACGGW-RS..FVLDNKL-------------------------------------
cassava4.1_031243m|PACid:17965734  NTS...CYALTTRW---..--------------------------------------------
cassava4.1_021320m|PACid:17962548  HPK...PTVPPASW-HP..FVAEYGLRAGDSVLFY----------------------------
cassava4.1_028443m|PACid:17983773  -NV...GRFLSVGW-LD..FVRFKDLRAGDQVII-----------------------------
cassava4.1_022475m|PACid:17983750  -NV...GRFLSVGW-LD..FVRFKDLRAGD---------------------------------
cassava4.1_033045m|PACid:17976110  NNS...RMYVLENT-GD..FANTHGLQPGD---------------------------------
cassava4.1_032970m|PACid:17984492  ---...-----------..--------------------------------------------
cassava4.1_023604m|PACid:17981149  HPK...PEFRK-GW-TC..YVKEKHLVEGDEVIFYKEE-------------------------
cassava4.1_026980m|PACid:17986725  ---...-----------..--------------------------------------------
cassava4.1_032427m|PACid:17962609  -DK...PFLRQSKW-HE..FVVAH---------------------------------------
cassava4.1_033446m|PACid:17981150  ---...-QFLSVGW-LE..FVRHKNLAVNDEVIF-----------------------------
cassava4.1_027477m|PACid:17962512  EEL...GHVLSIGW-LE..FAKYGDIRVGDKVIF-----------------------------
cassava4.1_025827m|PACid:17962542  KTR...NTL--------..--------------------------------------------
cassava4.1_025422m|PACid:17963857  YPK...PVILQSSW-HR..FVEQKGLIPNDRVMFFLDHDEE----------------------
cassava4.1_029527m|PACid:17970463  ---...-----------..--------------------------------------------
cassava4.1_029244m|PACid:17962611  ---...-----------..--------------------------------------------
cassava4.1_032678m|PACid:17970465  ---...-----------..--------------------------------------------
cassava4.1_022924m|PACid:17974798  HPK...PTLSSRTW-LP..FVRYRNLTVGDTIK------------------------------
cassava4.1_026225m|PACid:17970464  ---...-----------..-----------WF-------------------------------
cassava4.1_031810m|PACid:17962527  ---...-----------..--------------------------------------------
cassava4.1_030655m|PACid:17962547  ---...-----------..--------------------------------------------
cassava4.1_023706m|PACid:17962525  RYR...KPELTGDW-LQ..FVRSKNLRKGNKIILT----------------------------
cassava4.1_026336m|PACid:17974807  ---...-----------..--------------------------------------------
cassava4.1_027448m|PACid:17962554  RYR...KPELTGDW-LQ..FVRSKSLCKGNKIIL-----------------------------
cassava4.1_026234m|PACid:17989442  ---...-------WLNT..FVKR----------------------------------------
cassava4.1_031392m|PACid:17962488  KAW...NFACTTKT-GR..NTLMKPVFSKDWFAFARQ--------------------------


                                      150       160       170                                       
                                        |         |         |                                       
d1na6a1                              TAIGEVIPGALISGPAGQILGGLSLQQ--ap................................
cassava4.1_002377m|PACid:17972846  -----VMPSSVLSSDSMHIGLLAAAAH--a.................................
cassava4.1_001923m|PACid:17979526  -----VMPSSVLSSDSMHIGLLAAAAH--a.................................
cassava4.1_001769m|PACid:17972845  -----VMPSSVLSSDSMHIGLLAAAAH--a.................................
cassava4.1_001357m|PACid:17970373  -----VMPSSVLSSDSMHLGLLAAAAH--a.................................
cassava4.1_001328m|PACid:17972625  -----VMPSSVLSSDSMHLGLLAAAAH--a.................................
cassava4.1_001154m|PACid:17972624  -----VMPSSVLSSDSMHLGLLAAAAH--a.................................
cassava4.1_001355m|PACid:17990076  -----TLPSSVLSADSMHIGVLAAAAH--a.................................
cassava4.1_001105m|PACid:17990075  -----TLPSSVLSADSMHIGVLAAAAH--a.................................
cassava4.1_001995m|PACid:17968878  -----VLPDSV------------------i.................................
cassava4.1_001979m|PACid:17980934  -----------------------------glpdsv............................
cassava4.1_000609m|PACid:17992784  -----ALSSSVISSDSMHIGILAAAAH--a.................................
cassava4.1_000604m|PACid:17965279  -----ALSSSVISSDSMHIGILAAAAH--a.................................
cassava4.1_000610m|PACid:17980095  -----NLSSSVLSSDSMHIGILAAAAH--a.................................
cassava4.1_004521m|PACid:17974505  -----SMPSSVISCQSMHLGVLATASH--a.................................
cassava4.1_004533m|PACid:17974506  -----SMPSSVISCQSMHLGVLATASH--a.................................
cassava4.1_002969m|PACid:17974504  -----SMPSSVISCQSMHLGVLATASH--a.................................
cassava4.1_002399m|PACid:17970035  -----------------------------aa................................
cassava4.1_002408m|PACid:17978468  -----LMPSSVISRQSMHLGVLATASH--a.................................
cassava4.1_001567m|PACid:17965008  -----NVPSSVISSHSMHLGVLATAWH--a.................................
cassava4.1_001855m|PACid:17967456  -----NVPSSVISSHSMHLGVLATAWH--a.................................
cassava4.1_001964m|PACid:17967457  -----NVPSSVISSHSMHLGVLATAWH--a.................................
cassava4.1_001542m|PACid:17967454  -----NVPSSVISSHSMHLGVLATAWH--a.................................
cassava4.1_001544m|PACid:17967455  -----NVPSSVISSHSMHLGVLATAWH--a.................................
cassava4.1_002885m|PACid:17975736  -----SMPSSVISSQSMHLGVLATASH--a.................................
cassava4.1_003285m|PACid:17970763  -----NMPSSVISSQSMHLGVLATASH--a.................................
cassava4.1_002762m|PACid:17970761  -----NMPSSVISSQSMHLGVLATASH--a.................................
cassava4.1_002772m|PACid:17970762  -----NMPSSVISSQSMHLGVLATASH--a.................................
cassava4.1_002216m|PACid:17983384  -----NIPPSVISSHSMHIGILATAWH--a.................................
cassava4.1_010157m|PACid:17968962  -----------------------------qlyidwk...........................
cassava4.1_010068m|PACid:17962687  -----------------------------pdk...............................
cassava4.1_004122m|PACid:17971854  EQIG-------------------------c.................................
cassava4.1_002980m|PACid:17967195  -----------------------------krgv..............................
cassava4.1_012252m|PACid:17992340  -----------------------------dd................................
cassava4.1_009838m|PACid:17968724  -----------------------------krgi..............................
cassava4.1_022877m|PACid:17973703  -----------------------------hlyidwrrrp........................
cassava4.1_002960m|PACid:17968723  -----------------------------krgi..............................
cassava4.1_008697m|PACid:17975779  -----------------------------hrlyidwrrr........................
cassava4.1_002684m|PACid:17967245  -----------------------------rgig..............................
cassava4.1_012885m|PACid:17963793  -----------------------------hrlyidwrrr........................
cassava4.1_002668m|PACid:17968894  -----------------------------gng...............................
cassava4.1_004707m|PACid:17980850  -----------------------------kr................................
cassava4.1_004716m|PACid:17980849  -----------------------------kr................................
cassava4.1_021263m|PACid:17975434  -----------------------------erlfigwrr.........................
cassava4.1_031993m|PACid:17974501  -----------------------------erd...............................
cassava4.1_030248m|PACid:17986136  -----------------------------cecre.............................
cassava4.1_023592m|PACid:17988096  -----------------------------ya................................
cassava4.1_021579m|PACid:17973413  -----------------------------vtfya.............................
cassava4.1_012400m|PACid:17989033  -----------------------------fkyegdcqfsvlifdms.................
cassava4.1_013238m|PACid:17989499  -----------------------------lekgwpefsenhslkyghflvfeykgdshlhvfi
cassava4.1_030600m|PACid:17989063  -----------------------------gkdlsnpvllkvpdgrtwqmeliksdgevwlqng
cassava4.1_013029m|PACid:17988785  -----------------------------wlgqgwqdfsnyyslergsflvfkyegecrfhvv
cassava4.1_026645m|PACid:17984680  -----------------------------ksdvlkvslfg.......................
cassava4.1_025209m|PACid:17989519  -----------------------------vpsgrtwqvelkkwddeiwlqngwqefleyyslt
cassava4.1_030966m|PACid:17978826  -----------------------------ce................................
cassava4.1_013543m|PACid:17989532  -----------------------------ellncngdvllgkgwqdfsnyysldignfllfky
cassava4.1_013045m|PACid:17989531  -----------------------------ellncngdvllgkgwqdfsnyysldignfllfky
cassava4.1_006650m|PACid:17970733  -----------------------------pckfkvyiiran......................
cassava4.1_028222m|PACid:17988718  -----------------------------nrsairfnvvifr.....................
cassava4.1_010446m|PACid:17984628  -----------------------------vlkvtvfr..........................
cassava4.1_033218m|PACid:17977697  -----------------------------linmidivlkvtvfrvlq................
cassava4.1_009699m|PACid:17980107  -----------------------------vkplkfkvyivra.....................
cassava4.1_024894m|PACid:17976320  -----------------------------ey................................
cassava4.1_007952m|PACid:17977731  -----------------------------vlkvtvfr..........................
cassava4.1_006729m|PACid:17980106  -----------------------------vkplkfkvyivra.....................
cassava4.1_023688m|PACid:17988714  -----------------------------imiqgakatfkvtifrn.................
cassava4.1_006855m|PACid:17977730  -----------------------------vlkvtvfr..........................
cassava4.1_004019m|PACid:17964412  -----------------------------emlvhisg..........................
cassava4.1_004042m|PACid:17964413  -----------------------------emlvhisg..........................
cassava4.1_005196m|PACid:17970764  -----NMPSSVISSQSMHLGVLATASH--a.................................
cassava4.1_004019m|PACid:17964412  -----------------------------wptfvkdhliecgdvlifrydgelcfsvqvfdis
cassava4.1_004019m|PACid:17964412  -----------------------------rvfilrv...........................
cassava4.1_004042m|PACid:17964413  -----------------------------wptfvkdhliecgdvlifrydgelcfsvqvfdis
cassava4.1_004042m|PACid:17964413  -----------------------------rvfilrv...........................
cassava4.1_025302m|PACid:17971686  -----------------------------vkcgk.............................
cassava4.1_021232m|PACid:17984355  -----------------------------vkcgk.............................
cassava4.1_010400m|PACid:17985434  -----------------------------dtvffnhgweefvndhvlqekdllifkyngdscf
cassava4.1_031416m|PACid:17959850  -----------------------------egemvfdvmvfessac..................
cassava4.1_025209m|PACid:17989519  -----------------------------lkvtifr...........................
cassava4.1_023034m|PACid:17973665  -----------------------------kvyivrvngle.......................
cassava4.1_026568m|PACid:17977720  -----------------------------snfsvhmy..........................
cassava4.1_024159m|PACid:17977134  -----------------------------ref...............................
cassava4.1_011420m|PACid:17984629  ------W----------------------pvglikaddkfwfhegwqefmerysirvgyflvf
cassava4.1_029589m|PACid:17989515  -----------------------------qn................................
cassava4.1_010446m|PACid:17984628  ------W----------------------pvglikaddkfwfhegwqefmerysirvgyflvf
cassava4.1_026835m|PACid:17970017  -----------------------------sikkvktpqie.......................
cassava4.1_010015m|PACid:17977732  -----------------------------ggpvwpvglikaddkfwfhegwqefmesysirvg
cassava4.1_007952m|PACid:17977731  -----------------------------ggpvwpvglikaddkfwfhegwqefmesysirvg
cassava4.1_006855m|PACid:17977730  -----------------------------ggpvwpvglikaddkfwfhegwqefmesysirvg
cassava4.1_021264m|PACid:17985936  -----------------------------rwpil.............................
cassava4.1_032875m|PACid:17989505  -----------------------------evellnndgeiwlgegwkefsqhyslehgymiff
cassava4.1_027517m|PACid:17989062  -----------------------------efeqnchfnviimdks..................
cassava4.1_023093m|PACid:17985435  -----------------------------lffehgwkefvkyhsleendilvfkyngeshfdv
cassava4.1_026568m|PACid:17977720  -----------------------------rdtvlkvtvfr.......................
cassava4.1_028222m|PACid:17988718  -----------------------------iwltngwqefveyyslafgyflifefeqnchfnv
cassava4.1_012186m|PACid:17992633  -----------------------------ldhgyflvfkyeghghfcvfildksaseiqyp..
cassava4.1_001569m|PACid:17970131  -----------------------------k.................................
cassava4.1_001573m|PACid:17990861  -----------------------------k.................................
cassava4.1_026585m|PACid:17992650  -----------------------------wkmelfkgsdvwlsegwqefadyyyvklahlllf
cassava4.1_001576m|PACid:17984754  -----------------------------at................................
cassava4.1_022865m|PACid:17992636  -----------------------------grigisegwfnfrvkhklaikdmcvfefmpr...
cassava4.1_033218m|PACid:17977697  -----------------------------ehysirvgyflvfryggesnfnvyifd.......
cassava4.1_023688m|PACid:17988714  -----------------------------schfnvtifdks......................
cassava4.1_026585m|PACid:17992650  -----------------------------klelidrkkmvlkvsisr................
cassava4.1_001408m|PACid:17965912  -----------------------------asn...............................
cassava4.1_013029m|PACid:17988785  -----------------------------rasfsagwrvfsrenaievgdacvfelikrnvln
cassava4.1_028119m|PACid:17992629  -----------------------------nlievqi...........................
cassava4.1_013968m|PACid:17985433  -----------------------------rsdvvvitvhif......................
cassava4.1_027517m|PACid:17989062  -----------------------------elinriackfnvvifrh.................
cassava4.1_026645m|PACid:17984680  -----------------------------ltkdqkgiwfddgwqnfvdhysinsgyflvfgyr
cassava4.1_028119m|PACid:17992629  -----------------------------evdmyaptcc........................
cassava4.1_031416m|PACid:17959850  -----------------------------vvsletgkdgkvyigcgwsefakanglrernifm
cassava4.1_013968m|PACid:17985433  -----------------------------hkgdmvfdaivfdsssc.................
cassava4.1_031982m|PACid:17968160  -----------------------------..................................
cassava4.1_013045m|PACid:17989531  -----------------------------likrnllnvsifr.....................
cassava4.1_012186m|PACid:17992633  -----------------------------ikidvlnvyifk......................
cassava4.1_021264m|PACid:17985936  -----------------------------kcfkmiltnekgssrvvlvgksksgdvaigrgwn
cassava4.1_031416m|PACid:17959850  -----------------------------tfkfh.............................
cassava4.1_023815m|PACid:17977737  -----------------------------vvlkvlvfh.........................
cassava4.1_028222m|PACid:17988718  -----------------------------eavllkvtifr.......................
cassava4.1_029589m|PACid:17989515  -----------------------------elkditetenmllqvadkvkiwpvnvrfyplkkm
cassava4.1_012400m|PACid:17989033  -----------------------------ligrrmmnvhiik.....................
cassava4.1_013238m|PACid:17989499  -----------------------------nvlnvfmfr.........................
cassava4.1_030600m|PACid:17989063  -----------------------------etalvkvtifr.......................
cassava4.1_022637m|PACid:17989488  -----------------------------refaghysldfghlilfkhlrdsifnvvifgrs.
cassava4.1_010400m|PACid:17985434  -----------------------------fe................................
cassava4.1_032875m|PACid:17989505  -----------------------------ktqtvklqiadrawpvklmfhpssnmsclcegfc
cassava4.1_022637m|PACid:17989488  -----------------------------tlsigwrafaagnfleggdvcifeliknnilkvt
cassava4.1_026340m|PACid:17986296  -----------------------------i.................................
cassava4.1_031416m|PACid:17959850  -----------------------------pvfk..............................
cassava4.1_027543m|PACid:17993392  -----------------------------fvtiwmfrnfrtdklcfvis..............
cassava4.1_032104m|PACid:17993510  -----------------------------fvtiwmfrnlqtnklcfvis..............
cassava4.1_021168m|PACid:17971073  -----------------------------fnfsvl............................
cassava4.1_022865m|PACid:17992636  -----------------------------svklygkng.........................
cassava4.1_021291m|PACid:17971078  -----------------------------fnfavlerace.......................
cassava4.1_026028m|PACid:17971072  -----------------------------kifnf.............................
cassava4.1_013543m|PACid:17989532  -----------------------------ikrnllnvsifr......................
cassava4.1_025743m|PACid:17965438  -----------------------------kifnfavie.........................
cassava4.1_032495m|PACid:17977842  -----------------------------kkifnfavlerac.....................
cassava4.1_023815m|PACid:17977737  -----------------------------iwldngwqelveyysvcngwflqfnylgmsnfni
cassava4.1_026201m|PACid:17962468  -----------------------------etg...............................
cassava4.1_030107m|PACid:17962538  -----------------------------kvgrirfki.........................
cassava4.1_031569m|PACid:17992125  -----------------------------kkifnfavlerac.....................
cassava4.1_033082m|PACid:17962430  -----------------------------kvgrirfk..........................
cassava4.1_024104m|PACid:17991311  -----------------------------mvykdd............................
cassava4.1_027512m|PACid:17974822  -----------------------------n.................................
cassava4.1_024702m|PACid:17981153  -----------------------------ripaigfskpvvfgnwfkfvrskdlkpsdtivly
cassava4.1_031383m|PACid:17989199  -----------------------------e.................................
cassava4.1_023649m|PACid:17981152  -----------------------------lyk...............................
cassava4.1_026734m|PACid:17971074  -----------------------------kifnfa............................
cassava4.1_027843m|PACid:17962441  -----------------------------h.................................
cassava4.1_028150m|PACid:17981151  -----------------------------cftksgnkqpvfkngwlefaghrnlaagttitfy
cassava4.1_031965m|PACid:17965416  -----------------------------crllvasalvkdhilpfmsseivekirgegaefc
cassava4.1_024497m|PACid:17966841  -----------------------------frqwklskpngspsltyvfrthwnefkkknglke
cassava4.1_022215m|PACid:17981154  -----------------------------vcftksgnkqlpkpvfkkgwlefachwnlaagtt
cassava4.1_022611m|PACid:17962458  -----------------------------geh...............................
cassava4.1_027733m|PACid:17983747  -----------------------------eeedeat...........................
cassava4.1_024470m|PACid:17965913  -----------------------------vlernlefkqndiiqlwsfrvrgelqfaf.....
cassava4.1_030218m|PACid:17962472  -----------------------------rrd...............................
cassava4.1_023093m|PACid:17985435  -----------------------------re................................
cassava4.1_031243m|PACid:17965734  -----------------------------kqvikefkqndiiqlwsfrvq.............
cassava4.1_021320m|PACid:17962548  -----------------------------trr...............................
cassava4.1_028443m|PACid:17983773  -----------------------------h.................................
cassava4.1_022475m|PACid:17983750  -----------------------------qvn...............................
cassava4.1_033045m|PACid:17976110  -----------------------------fimvykdnlnqnyv....................
cassava4.1_032970m|PACid:17984492  -----------------------------ctikedenvgrflsvgwldfvrfkdlragd....
cassava4.1_023604m|PACid:17981149  -----------------------------det...............................
cassava4.1_026980m|PACid:17986725  -----------------------------frqwklnkpngshsltyvfrthwnefkknnglke
cassava4.1_032427m|PACid:17962609  -----------------------------dlyeedidygivfyinnegkmqvtglrrs.....
cassava4.1_033446m|PACid:17981150  -----------------------------ve................................
cassava4.1_027477m|PACid:17962512  -----------------------------l.................................
cassava4.1_025827m|PACid:17962542  -----------------------------lkpvfskgwyafarhwglrsgatiafym......
cassava4.1_025422m|PACid:17963857  -----------------------------n.................................
cassava4.1_029527m|PACid:17970463  -----------------------------qtgehekpflrppkwhefvmahrlskddadygvv
cassava4.1_029244m|PACid:17962611  -----------------------------rneelghiisigwlefakygdirvgdkvifl...
cassava4.1_032678m|PACid:17970465  -----------------------------ilairqtgehekpflrppkwhefvmahglsrdda
cassava4.1_022924m|PACid:17974798  -----------------------------lyke..............................
cassava4.1_026225m|PACid:17970464  -----------------------------kfvrskdlkprdtivfyke...............
cassava4.1_031810m|PACid:17962527  -----------------------------enmgrflsvdwlefarlkdvrvgdqfii......
cassava4.1_030655m|PACid:17962547  -----------------------------qtgeydkpflrpskwhefvrvhglceed......
cassava4.1_023706m|PACid:17962525  -----------------------------m.................................
cassava4.1_026336m|PACid:17974807  -----------------------------pvfkkgwlefardsnlaagttitfy.........
cassava4.1_027448m|PACid:17962554  -----------------------------tm................................
cassava4.1_026234m|PACid:17989442  -----------------------------rnlvkgdlig........................
cassava4.1_031392m|PACid:17962488  -----------------------------wglrsgatsaf.......................


                                                                                             
                                                                                             
d1na6a1                              ........................................................
cassava4.1_002377m|PACid:17972846  ........................................................
cassava4.1_001923m|PACid:17979526  ........................................................
cassava4.1_001769m|PACid:17972845  ........................................................
cassava4.1_001357m|PACid:17970373  ........................................................
cassava4.1_001328m|PACid:17972625  ........................................................
cassava4.1_001154m|PACid:17972624  ........................................................
cassava4.1_001355m|PACid:17990076  ........................................................
cassava4.1_001105m|PACid:17990075  ........................................................
cassava4.1_001995m|PACid:17968878  ........................................................
cassava4.1_001979m|PACid:17980934  ........................................................
cassava4.1_000609m|PACid:17992784  ........................................................
cassava4.1_000604m|PACid:17965279  ........................................................
cassava4.1_000610m|PACid:17980095  ........................................................
cassava4.1_004521m|PACid:17974505  ........................................................
cassava4.1_004533m|PACid:17974506  ........................................................
cassava4.1_002969m|PACid:17974504  ........................................................
cassava4.1_002399m|PACid:17970035  ........................................................
cassava4.1_002408m|PACid:17978468  ........................................................
cassava4.1_001567m|PACid:17965008  ........................................................
cassava4.1_001855m|PACid:17967456  ........................................................
cassava4.1_001964m|PACid:17967457  ........................................................
cassava4.1_001542m|PACid:17967454  ........................................................
cassava4.1_001544m|PACid:17967455  ........................................................
cassava4.1_002885m|PACid:17975736  ........................................................
cassava4.1_003285m|PACid:17970763  ........................................................
cassava4.1_002762m|PACid:17970761  ........................................................
cassava4.1_002772m|PACid:17970762  ........................................................
cassava4.1_002216m|PACid:17983384  ........................................................
cassava4.1_010157m|PACid:17968962  ........................................................
cassava4.1_010068m|PACid:17962687  ........................................................
cassava4.1_004122m|PACid:17971854  ........................................................
cassava4.1_002980m|PACid:17967195  ........................................................
cassava4.1_012252m|PACid:17992340  ........................................................
cassava4.1_009838m|PACid:17968724  ........................................................
cassava4.1_022877m|PACid:17973703  ........................................................
cassava4.1_002960m|PACid:17968723  ........................................................
cassava4.1_008697m|PACid:17975779  ........................................................
cassava4.1_002684m|PACid:17967245  ........................................................
cassava4.1_012885m|PACid:17963793  ........................................................
cassava4.1_002668m|PACid:17968894  ........................................................
cassava4.1_004707m|PACid:17980850  ........................................................
cassava4.1_004716m|PACid:17980849  ........................................................
cassava4.1_021263m|PACid:17975434  ........................................................
cassava4.1_031993m|PACid:17974501  ........................................................
cassava4.1_030248m|PACid:17986136  ........................................................
cassava4.1_023592m|PACid:17988096  ........................................................
cassava4.1_021579m|PACid:17973413  ........................................................
cassava4.1_012400m|PACid:17989033  ........................................................
cassava4.1_013238m|PACid:17989499  fde.....................................................
cassava4.1_030600m|PACid:17989063  wqefleyyslahgsflvfeynkrdchfnviifdkt.....................
cassava4.1_013029m|PACid:17988785  ifdks...................................................
cassava4.1_026645m|PACid:17984680  ........................................................
cassava4.1_025209m|PACid:17989519  hgfflvfeytkrnchfnviifdks................................
cassava4.1_030966m|PACid:17978826  ........................................................
cassava4.1_013543m|PACid:17989532  egncqfcvlifdks..........................................
cassava4.1_013045m|PACid:17989531  egncqfcvlifdks..........................................
cassava4.1_006650m|PACid:17970733  ........................................................
cassava4.1_028222m|PACid:17988718  ........................................................
cassava4.1_010446m|PACid:17984628  ........................................................
cassava4.1_033218m|PACid:17977697  ........................................................
cassava4.1_009699m|PACid:17980107  ........................................................
cassava4.1_024894m|PACid:17976320  ........................................................
cassava4.1_007952m|PACid:17977731  ........................................................
cassava4.1_006729m|PACid:17980106  ........................................................
cassava4.1_023688m|PACid:17988714  ........................................................
cassava4.1_006855m|PACid:17977730  ........................................................
cassava4.1_004019m|PACid:17964412  ........................................................
cassava4.1_004042m|PACid:17964413  ........................................................
cassava4.1_005196m|PACid:17970764  ........................................................
cassava4.1_004019m|PACid:17964412  ac......................................................
cassava4.1_004019m|PACid:17964412  ........................................................
cassava4.1_004042m|PACid:17964413  ac......................................................
cassava4.1_004042m|PACid:17964413  ........................................................
cassava4.1_025302m|PACid:17971686  ........................................................
cassava4.1_021232m|PACid:17984355  ........................................................
cassava4.1_010400m|PACid:17985434  dvlmfd..................................................
cassava4.1_031416m|PACid:17959850  ........................................................
cassava4.1_025209m|PACid:17989519  ........................................................
cassava4.1_023034m|PACid:17973665  ........................................................
cassava4.1_026568m|PACid:17977720  ........................................................
cassava4.1_024159m|PACid:17977134  ........................................................
cassava4.1_011420m|PACid:17984629  ryeghavftvhifnl.........................................
cassava4.1_029589m|PACid:17989515  ........................................................
cassava4.1_010446m|PACid:17984628  ryeghavftvhifnl.........................................
cassava4.1_026835m|PACid:17970017  ........................................................
cassava4.1_010015m|PACid:17977732  yflvfryeghavftvhifnl....................................
cassava4.1_007952m|PACid:17977731  yflvfryeghavftvhifnl....................................
cassava4.1_006855m|PACid:17977730  yflvfryeghavftvhifnl....................................
cassava4.1_021264m|PACid:17985936  ........................................................
cassava4.1_032875m|PACid:17989505  kyvefcrfhviicdgsgleieyp.................................
cassava4.1_027517m|PACid:17989062  ........................................................
cassava4.1_023093m|PACid:17985435  lmfn....................................................
cassava4.1_026568m|PACid:17977720  ........................................................
cassava4.1_028222m|PACid:17988718  iimdks..................................................
cassava4.1_012186m|PACid:17992633  ........................................................
cassava4.1_001569m|PACid:17970131  ........................................................
cassava4.1_001573m|PACid:17990861  ........................................................
cassava4.1_026585m|PACid:17992650  kyegdsqfsvvifsk.........................................
cassava4.1_001576m|PACid:17984754  ........................................................
cassava4.1_022865m|PACid:17992636  ........................................................
cassava4.1_033218m|PACid:17977697  ........................................................
cassava4.1_023688m|PACid:17988714  ........................................................
cassava4.1_026585m|PACid:17992650  ........................................................
cassava4.1_001408m|PACid:17965912  ........................................................
cassava4.1_013029m|PACid:17988785  vtifr...................................................
cassava4.1_028119m|PACid:17992629  ........................................................
cassava4.1_013968m|PACid:17985433  ........................................................
cassava4.1_027517m|PACid:17989062  ........................................................
cassava4.1_026645m|PACid:17984680  gfsnfsivildv............................................
cassava4.1_028119m|PACid:17992629  ........................................................
cassava4.1_031416m|PACid:17959850  lelveggnkpamkf..........................................
cassava4.1_013968m|PACid:17985433  ........................................................
cassava4.1_031982m|PACid:17968160  ........................................................
cassava4.1_013045m|PACid:17989531  ........................................................
cassava4.1_012186m|PACid:17992633  ........................................................
cassava4.1_021264m|PACid:17985936  afakenglregyvimlelvkggvkpvmk............................
cassava4.1_031416m|PACid:17959850  ........................................................
cassava4.1_023815m|PACid:17977737  ........................................................
cassava4.1_028222m|PACid:17988718  ........................................................
cassava4.1_029589m|PACid:17989515  gcitsgfrtfarenslqprdvcvfqlisshvlkvsifrn.................
cassava4.1_012400m|PACid:17989033  ........................................................
cassava4.1_013238m|PACid:17989499  ........................................................
cassava4.1_030600m|PACid:17989063  ........................................................
cassava4.1_022637m|PACid:17989488  ........................................................
cassava4.1_010400m|PACid:17985434  ........................................................
cassava4.1_032875m|PACid:17989505  efarenslavgdv...........................................
cassava4.1_022637m|PACid:17989488  ifr.....................................................
cassava4.1_026340m|PACid:17986296  ........................................................
cassava4.1_031416m|PACid:17959850  ........................................................
cassava4.1_027543m|PACid:17993392  ........................................................
cassava4.1_032104m|PACid:17993510  ........................................................
cassava4.1_021168m|PACid:17971073  ........................................................
cassava4.1_022865m|PACid:17992636  ........................................................
cassava4.1_021291m|PACid:17971078  ........................................................
cassava4.1_026028m|PACid:17971072  ........................................................
cassava4.1_013543m|PACid:17989532  ........................................................
cassava4.1_025743m|PACid:17965438  ........................................................
cassava4.1_032495m|PACid:17977842  ........................................................
cassava4.1_023815m|PACid:17977737  fifdetvfeigyp...........................................
cassava4.1_026201m|PACid:17962468  ........................................................
cassava4.1_030107m|PACid:17962538  ........................................................
cassava4.1_031569m|PACid:17992125  ........................................................
cassava4.1_033082m|PACid:17962430  ........................................................
cassava4.1_024104m|PACid:17991311  ........................................................
cassava4.1_027512m|PACid:17974822  ........................................................
cassava4.1_024702m|PACid:17981153  k.......................................................
cassava4.1_031383m|PACid:17989199  ........................................................
cassava4.1_023649m|PACid:17981152  ........................................................
cassava4.1_026734m|PACid:17971074  ........................................................
cassava4.1_027843m|PACid:17962441  ........................................................
cassava4.1_028150m|PACid:17981151  k.......................................................
cassava4.1_031965m|PACid:17965416  fwdcntnnelnlvlkywhtsksyifnkgllnnfvkrrklvggdligiywdstkkif
cassava4.1_024497m|PACid:17966841  ddiiqvwcfrvvgkilf.......................................
cassava4.1_022215m|PACid:17981154  itfyk...................................................
cassava4.1_022611m|PACid:17962458  ........................................................
cassava4.1_027733m|PACid:17983747  ........................................................
cassava4.1_024470m|PACid:17965913  ........................................................
cassava4.1_030218m|PACid:17962472  ........................................................
cassava4.1_023093m|PACid:17985435  ........................................................
cassava4.1_031243m|PACid:17965734  ........................................................
cassava4.1_021320m|PACid:17962548  ........................................................
cassava4.1_028443m|PACid:17983773  ........................................................
cassava4.1_022475m|PACid:17983750  ........................................................
cassava4.1_033045m|PACid:17976110  ........................................................
cassava4.1_032970m|PACid:17984492  ........................................................
cassava4.1_023604m|PACid:17981149  ........................................................
cassava4.1_026980m|PACid:17986725  ddiiqvwgfrvegkilfalv....................................
cassava4.1_032427m|PACid:17962609  ........................................................
cassava4.1_033446m|PACid:17981150  ........................................................
cassava4.1_027477m|PACid:17962512  ........................................................
cassava4.1_025827m|PACid:17962542  ........................................................
cassava4.1_025422m|PACid:17963857  ........................................................
cassava4.1_029527m|PACid:17970463  fysdnngrlqvrglrkn.......................................
cassava4.1_029244m|PACid:17962611  ........................................................
cassava4.1_032678m|PACid:17970465  dygvvfysdnngplqvrglrkn..................................
cassava4.1_022924m|PACid:17974798  ........................................................
cassava4.1_026225m|PACid:17970464  ........................................................
cassava4.1_031810m|PACid:17962527  ........................................................
cassava4.1_030655m|PACid:17962547  ........................................................
cassava4.1_023706m|PACid:17962525  ........................................................
cassava4.1_026336m|PACid:17974807  ........................................................
cassava4.1_027448m|PACid:17962554  ........................................................
cassava4.1_026234m|PACid:17989442  ........................................................
cassava4.1_031392m|PACid:17962488  ........................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]