SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments

These alignments are sequences aligned to the 0051290 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                   10               
                                                                                    |               
d1yela1      ...........................................................mad---TGEVQFMKPFISEKSS......
Ov1_EMT32630 .....................................................lpaelgnas--KQPTNYFCKTLTASDTSth....
Ov1_EMT04282 .......................................................ielgaas--KQPTNYFCKTLTASDTSth....
Ov1_EMT18418 .................................................dmedgdgerksrm-----LHMFCKTLTASDTSth....
Ov1_EMT01567 .........................................................lkqnk---QPVEFFCKTLTASDTSth....
Ov1_EMT19609 .........................................................alkqa--RPQNEFFCKTLTASDTSth....
Ov1_EMT31390 ..........................................................aksk---HPAEYFCKNLTASDTSth....
Ov1_EMT09779 ............................................................pr---PAVRSFCKTLTASDTSth....
Ov1_EMT17168 ............................................................rp----AVRSFCKTLTASDTSth....
Ov1_EMT16165 .........................................................alrqa--RPQMEFFCKTLTASDTSth....
Ov1_EMT31591 .....................................................ilpetprpv-----VHTFCKILTPSDTSth....
Ov1_EMT27817 .....................................................lpaemgims--KQPTNYFCKTLTASDTSth....
Ov1_EMT06148 .............................................................e------PLFEKVLTPSDVGkl....
Ov1_EMT06147 .............................................................l-------LFEKAVTPSDVGkl....
Ov1_EMT31332 .............................................................e------PLFEKAVTPSDVGkl....
Ov1_EMT25952 .........................................................rarmp------HMFCKTLTASDTSth....
Ov1_EMT08561 ......................................................dgekkprm-----PHMFCKTLTASDTSth....
Ov1_EMT22525 ......................................................parakras--------RAKTLTQSDANng....
Ov1_EMT09996 ............................................................eh-------LFDKTATPSDVGkl....
Ov1_EMT23005 ............................................................eh-------LFEKPLTPSDVGkl....
Ov1_EMT27061 ..................................................peandmsqnppc-------------------......
Ov1_EMT29229 ..............................................................--------FDKVVTPSDTGkl....
Ov1_EMT21501 ............................................................eh-------LFEKALTPSDVGkl....
Ov1_EMT29641 .............................................................h-------MFDKVVTASDVGkl....
Ov1_EMT32462 .........................................................alkqn--KPQTEFFCKTLTASDTSth....
Ov1_EMT19909 ...........................................................deq-----DKRFFKVMIGDFHE......
Ov1_EMT13106 .............................................................g---SGYPSFVKPMTQSHVTgg....
Ov1_EMT05021 .............................................................l--DPDNPSFVKTMVRSHVSsc....
Ov1_EMT28380 ...........................................................eqd------KHFFKVMIGDFHE......
Ov1_EMT09780 .............................................................d----EKKHFFKLMVGDFTE......
Ov1_EMT12434 .................................................sllpenedysqqr-------------------......
Ov1_EMT19908 ............................................................dk-------NFFKVMIGDFHE......
Ov1_EMT01685 .............................................................m--EDHNWSFFKVVILSNFK......
Ov1_EMT07173 ............................................................ll---------QKVLKQSDVGtl....
Ov1_EMT13220 .............................................................k------PQFLKVLFTDFME......
Ov1_EMT09213 .............................................................g----GNPSFVKPMKQSHVTgg....
Ov1_EMT12994 .............................................................l--DPEFPSFMKRMLHSHVVrg....
Ov1_EMT17387 ............................................................md-----KMRFFMVMMGVRASk.....
Ov1_EMT06248 ............................................................eg------PSFVKLMQKSHVVkg....
Ov1_EMT26018 .............................................................f--KSKNPFGLQIMKESYVYvg....
Ov1_EMT20130 .............................................................r-----RPAFVKTMTHVCASra....
Ov1_EMT05921 .............................................................l--DDRQKHFLRLMVGDFRQ......
Ov1_EMT08925 ............................................................md---VSKTKFFKLMTQDSQQ......
Ov1_EMT28380 .............................................................i--NSEIPIYGCVIRKSSIYgkt...
Ov1_EMT17385 .............................................................i--RPGNPAFVVVLLMTHLQrkn...
Ov1_EMT10769 .............................................................v------PLFEKVLSASDAGri....
Ov1_EMT30739 ............................................................hg----KVKCFVAPMDRNSRH......
Ov1_EMT06472 ............................................................hg----KVKCFFTQMDRHSRH......
Ov1_EMT12716 .............................................................t---SKYPSTLQVIKAASAYns....
Ov1_EMT20366 .............................................................m--DDRQKHFLRFMVGDFLH......
Ov1_EMT28479 .............................................................g-----RPRFFKVLVGDFAR......
Ov1_EMT25279 ..............................................................--DPRHPSFVKPMTQSHVTgg....
Ov1_EMT09781 ............................................................fr-------------------......
Ov1_EMT23621 ..............................................................--QSEVPIYVSIMTKSNLGsr....
Ov1_EMT12198 .............................................................d---DEKKYFLVLMLVDFQH......
Ov1_EMT25326 .............................................................r-----RPHFFKVLIGDFKK......
Ov1_EMT28355 ...........................................................ski-------RFFKLMTGDFQQ......
Ov1_EMT20365 .............................................................m--DDRQKHFLRLMFGDFRQ......
Ov1_EMT19909 .............................................................m--NSEIPIYGCAIRKSSIYgkt...
Ov1_EMT09782 .............................................................e-----IPVFVAVMKPSNVKsqt...
Ov1_EMT26093 .............................................................f--KSERPFTVKTMKHNDVYas....
Ov1_EMT08925 ............................................................md---NRKKRFFKLMLGNFRN......
Ov1_EMT12830 .............................................................v-------------------......
Ov1_EMT09782 .............................................................l--DEKMKCFRRHMGADFRH......
Ov1_EMT23621 ............................................................ka----KVTVFVAIMLRSYSS......
Ov1_EMT06404 .............................................................l--DDEKKYFLVHMMGVFQH......
Ov1_EMT19908 .............................................................m--NSEVPIYGCVIRKSSIYgat...
Ov1_EMT02831 ...........................................................iyw-------------------......
Ov1_EMT06404 .............................................................l--DDEKKHFLVLMLGDFED......
Ov1_EMT09781 .............................................................i--HSKIPIYGTVMTKCNIFgsp...
Ov1_EMT01685 .............................................................m-------RFFMVMMGIGASn.....
Ov1_EMT25326 ..............................................................-------------------......
Ov1_EMT08965 .............................................................e----DNPIFVAVMRRFNVTgt....
Ov1_EMT26018 .............................................................f---------ARVFLPQLYG......
Ov1_EMT08925 .............................................................i--KPEIPVFVSIMMKTNVSsrt...
Ov1_EMT33420 ..............................................................--QPDIPFLVVQMTKSNVNgsr...
Ov1_EMT01422 ............................................................kn-----CPHFFRALISYSFK......
Ov1_EMT07265 ..............................................................---SEIPIFVAVMGKMNLDsr....
Ov1_EMT26150 ...........................................................ngk-------------------......
Ov1_EMT08925 .............................................................i--QPGNPAFMTVLLRAHLQhkn...
Ov1_EMT28357 ............................................................vs-----KISFFKLMTGDFQQ......
Ov1_EMT26093 ............................................................qn-----CPHFFRALISNSFM......
Ov1_EMT11663 ............................................................fl----------RQINGNFVH......
Ov1_EMT08965 ...........................................................ddr-----EKHFLMFIVDDCGQ......
Ov1_EMT00295 .............................................................c------PQFFRSLMTSSSM......
Ov1_EMT12198 .............................................................t----EIPIFVAAMRKYNVAid....
Ov1_EMT17386 ............................................................gi------QFYVTVMNEKSLSd.....
Ov1_EMT32040 ............................................................fl----------RKINGNFMH......
Ov1_EMT15473 ...........................................................nfd-------------------......
Ov1_EMT20366 ............................................................qv-------------------......
Ov1_EMT11662 ...........................................................flr-----------QINGNFMH......
Ov1_EMT05921 .............................................................i------PFYITAMNKTSMS......
Ov1_EMT18170 ..............................................................--QPEIPLLVVQIMKSNVSgpq...
Ov1_EMT04827 ...........................................................mdn-------------------......
Ov1_EMT13220 .............................................................i-------------------......
Ov1_EMT24022 .............................................................l--GSDYPTFVKPMPQSLTS......
Ov1_EMT20366 .............................................................i------PFYITAMNKTSLS......
Ov1_EMT20365 ............................................................pa-----IPFYITAMNKTSMS......
Ov1_EMT05921 .............................................................i--QQGNPVYVAVLQENHGRn.....
Ov1_EMT12928 .............................................................w------PAFVKPMTHNCASka....
Ov1_EMT28125 .............................................................e---DENKHFLVLMLGDFRQ......
Ov1_EMT07265 ..........................................................ddak------KHFLVLMLGDFR-......
Ov1_EMT01685 .............................................................s--QTGIEFYVTAMNEKTLSd.....
Ov1_EMT05921 .............................................................a-------------------......
Ov1_EMT17387 .............................................................k-------RFVKIVTGDFVD......
Ov1_EMT12198 ...........................................................qlq-------------------......
Ov1_EMT07265 ..............................................................-------------------......
Ov1_EMT13166 .............................................................s-----HPFFTIILSRSHVQkp....
Ov1_EMT09782 .............................................................l--QSDVPIYASVMNKSSVGdnsl..
Ov1_EMT15692 .............................................................r------PRFIKLLRPDDWE......
Ov1_EMT32039 ...........................................................flr-----------QINGNFMH......
Ov1_EMT33019 ..............................................................--QSKLPIFVRELKTYSVVgtgqgg
Ov1_EMT00181 .............................................................a-----HPSFIKPMTRSYATg.....
Ov1_EMT06474 .............................................................l--QSDVPIYASVMNKSSVGdnsl..
Ov1_EMT17386 ............................................................rp----ETRIFVSIIYSSRA-......
Ov1_EMT20365 ........................................................nvvvcl-------------------......
Ov1_EMT04827 ............................................................qa----ETPVFVAIMKMSTQN......
Ov1_EMT04828 .............................................................i--GSRVPAYVSVMNRSSVGvgnri.
Ov1_EMT27675 ...........................................................ilr----------KELTKSDVAnv....
Ov1_EMT18170 ...........................................................rra-------KFIMQMRGNFKH......
Ov1_EMT20365 .............................................................i--QQGNPVYIALLGKNHLKkrn...
Ov1_EMT30739 .............................................................a---SDLHIYVAVMNKTNVR......
Ov1_EMT02182 .............................................................t------PLFEKMLSASDAGri....
Ov1_EMT33420 ..........................................................firq-------------MRGNFK......
Ov1_EMT04828 .............................................................a-------------------......
Ov1_EMT26160 .............................................................d-----HPSFVKPICYKTATa.....
Ov1_EMT17385 ............................................................ld-------------------......
Ov1_EMT20366 .............................................................i--QQGNVVYVTILGKNQVRikn...
Ov1_EMT26088 .............................................................i--QSELPIYVVVMTKSRINa.....
Ov1_EMT22877 ..............................................................-------------------......
Ov1_EMT32415 .............................................................k------PYFACVVCKSHVQqp....
Ov1_EMT08965 .............................................................s----EIPICVLVMQKTNVTgr....
Ov1_EMT09249 ..........................................................riad-------------------......
Ov1_EMT02000 .............................................................r--------FIRKINGNFMH......
Ov1_EMT26998 .............................................................m--RSQVPLYVAVMNKSNVNlkd...
Ov1_EMT09780 .............................................................e---PRNPVFVNVMHVSHVRgttrt.
Ov1_EMT08925 .............................................................r---PEIPLYVKTMSSASLVdgflii
Ov1_EMT12525 ......................................................qfvvmlke---------------CHFVtkng..
Ov1_EMT23566 .............................................................q--------FYKLMAAGMSW......
Ov1_EMT23566 .............................................................r--------FTVTLGQCHLGtkkk..
Ov1_EMT04827 .............................................................i--GSQVPVYVSVMNRSSVGvdngi.
Ov1_EMT22877 .............................................................q-------------------......
Ov1_EMT26088 .............................................................r---SQVPLYVAAMNKSNVNlkg...
Ov1_EMT01811 .............................................................i--KPETIVFVATMRKSDVQlpt...
Ov1_EMT26046 ............................................................pa----EHPSFVKHMLHSHVVhg....
Ov1_EMT01685 ...........................................................efv-------------------......
Ov1_EMT01999 ..............................................................--------FFTILLSNSLK......
Ov1_EMT28635 .............................................................c-------------------......
Ov1_EMT06472 .............................................................i--GSDLHIYIAVMTRSSIL......
Ov1_EMT11663 .............................................................s----TVPVYVAVLNKCNVSrkyg..
Ov1_EMT25672 ........................................................lckssn--------------SSNSSg.....
Ov1_EMT21044 .............................................................i--DSTVPVYVAILNRSNVRydnft.
Ov1_EMT20151 ..............................................................-----------VITSSDVAta....
Ov1_EMT00295 ............................................................lq-------------------......
Ov1_EMT31520 .............................................................h-------------------......
Ov1_EMT18170 .............................................................i--QPETPVLVVMMKKTNVNhy....
Ov1_EMT20151 ......................................................hfslvagd----------------DFA......
Ov1_EMT13199 ...................................................ffkvagehfee-------------------......
Ov1_EMT14114 .............................................................a----EHPSFVKHMLHSHVVqg....
Ov1_EMT28355 ..........................................................eeif-------------------......
Ov1_EMT14307 ............................................................rk-------------------......
Ov1_EMT33385 ............................................................fv-------FYAKQIQQGDWQr.....
Ov1_EMT30659 .............................................................i--KSGFPLFVAAMDESNVRlnd...
Ov1_EMT28125 .............................................................d---DEKKYFLMRMTGDFQD......
Ov1_EMT13199 ............................................................vv--------------PSTAQ......
Ov1_EMT28635 .............................................................i--KSEFPLFVAAMDESNVSlsd...
Ov1_EMT26998 .............................................................i--QSELPIYVSLMTKSRINa.....
Ov1_EMT02000 ..............................................................---PEIPVLVVEMKKSNVKqs....
Ov1_EMT06472 ..............................................................--QPEMPLLVAMMTKPSVKpy....
Ov1_EMT01999 ............................................................fk-----PPFYVAIMSKSTVCqrgsqn
Ov1_EMT05389 ...........................................................apa------PQFVVELKKCHFVkqng..
Ov1_EMT08502 .............................................................n-------------------......
Ov1_EMT01554 ...............................................tissgsvlkkcslpr-------------------......
Ov1_EMT32039 ...............................................lnfgfryaarylgek-------------------......
Ov1_EMT30659 .............................................................i--GSKFPVFVKVMTPHDVGrpgp..
Ov1_EMT07124 ............................................................qi-------------------......
Ov1_EMT01422 ..............................................................-------------------......
Ov1_EMT11662 ..............................................................---PEIPMLVVLMKKSNVRhh....
Ov1_EMT26998 .........................................................nlidi-------------------......
Ov1_EMT32039 ..............................................................---PEIPMLVVLMKKSNVRhh....
Ov1_EMT27996 ............................................................ik-------------------......
Ov1_EMT14989 ............................................................qi-------------------......
Ov1_EMT25672 ...........................................................tpv------------------Sv.....
Ov1_EMT32373 ...........................................................pmp-------------------......
Ov1_EMT18170 ...........................................................rap-------IYVAAMDKSNLSsal...
Ov1_EMT04828 ..............................................................-------------------......
Ov1_EMT06722 .............................................................t-------------------......
Ov1_EMT15692 ..........................................................pryk-------FAAPVLSPSCLQ......
Ov1_EMT01571 ...........................................................fvc---------VKTLQKSDVDlnq...
Ov1_EMT11111 ......................................................pdftmqpp-------------------......
Ov1_EMT11662 .....................................................arylrkkft-------------------......
Ov1_EMT18852 ............................................................sp--------FVHQVTPTDVEth....
Ov1_EMT01999 .............................................................q---PKFTVLVVQMKKSNVKqh....
Ov1_EMT02000 .............................................................i--ESDVPLYVAIMSKSNVYrgsgcn
Ov1_EMT17386 ............................................................mk---DHDWCFVKVMSLSNFK......
Ov1_EMT08764 .............................................................s-------------------......
Ov1_EMT28356 ......................................................yyhgsvar-------------------......
Ov1_EMT33420 ..............................................................--QSEIPVLVVKMNKTNVSdy....
Ov1_EMT25863 ..............................................................------PPFVHRLTPTIIAg.....
Ov1_EMT02831 ......................................................lpgrkkqg-------------------......
Ov1_EMT33847 .............................................................f-------VFMKTLQKSDVErnq...
Ov1_EMT32040 .............................................................r---SEIPVLVVQMKKTSANf.....
Ov1_EMT18693 .............................................................s----KYRLYVATLNSSSLQk.....
Ov1_EMT28635 ..............................................................---SEFPVFVKVMTAYDVSkm....
Ov1_EMT11663 .............................................................r---SEIPVLVVQMKKTSANf.....
Ov1_EMT21044 .............................................................r---PEIPVLVVQMKKTSANi.....
Ov1_EMT33420 ..........................................................qsea------PIYVAIIDKSSYFal....
Ov1_EMT20151 .......................................................efrlhva-----------AVNKRNANgd....
Ov1_EMT31520 ..........................................................gqta-------------------......
Ov1_EMT15692 .............................................................h-------SFTKQITSSSLT......
Ov1_EMT25624 .................................................vriygkllwksdr------------------Llhq...
Ov1_EMT14307 ..............................................................-------------------......
Ov1_EMT25671 .............................................................e------------MKKSNVKqg....
Ov1_EMT08426 walckvlrhsdvdptqnrlllttwmgqggpilmlfpeleqvgdngmqnevveavlidaewgv-------------------......
Ov1_EMT30738 .............................................................a---SDLPIYVAVMTKTNVR......
Ov1_EMT32507 ....................................clldsfarvmedgeplglwlqadgcc-------------------......
Ov1_EMT02333 .............................................................r----ELPVFVQKMTKNDIL......
Ov1_EMT04013 ......................lsktleqsdvqsgqnrllltketvrggpipkffpeleelg-------------------......
Ov1_EMT20145 .............................................................r--------FVHRFTSTNIMk.....
Ov1_EMT15081 ...........................................................hmi--------VWKELTNSDVGni....
Ov1_EMT01422 .............................................................s----ERPFTVKAMKHNDVYas....
Ov1_EMT25849 ......................vimkslqmsdvdrnqnrllfsckrefleghpitgilaeke-------------------......
Ov1_EMT08500 .............................................................s----TRPFTVKAMKHNDVYas....
Ov1_EMT01554 .........................................lrindetarwfdtgdrgaehk-------------------......
Ov1_EMT18234 .........................................................naenr-------------------......
Ov1_EMT31520 .............................................................k------PQFIVPLQRSFME......
Ov1_EMT08528 .............................................................p-----NNYYVCHMTETFATqg....
Ov1_EMT15116 ...........................................................ilq----------KELRNSDISql....
Ov1_EMT11222 .............................................................r-------------------......
Ov1_EMT28357 .............................................................i--QLGNPVYVAVLQKTHVRrtk...
Ov1_EMT08188 ............................................................en------GCFYLTLLEGFKW......
Ov1_EMT30738 .............................................................i--QPEMPSLVAMMTKPSAKpy....
Ov1_EMT28753 ............................................................vp-------------------......


              20             30                                40                        50         
               |              |                                 |                         |         
d1yela1      ..KSLEIPL..G...FNEYFPAPF.................P.......ITVDLL.........DYS...G....RSWTVRMKKR..
Ov1_EMT32630 ..GGFSVPR..R...AAEKVFPPL.................DftqqppaQELMAK.........DLH...G....NEWKFRHIFRgq
Ov1_EMT04282 ..GGFSVPR..R...SAEKVFPPL.................DfslqppcQELIAK.........DLH...D....NEWKFRHIFRgq
Ov1_EMT18418 ..GGFSVPR..R...AAEDCFPPLdyqqirp..........S.......QELVAK.........DLH...G....AKWRFRHIYRgq
Ov1_EMT01567 ..GGFSVPR..R...AAEKIFPPL.................DftmqppaQELMAK.........DLH...D....IPWKFRHIFRgq
Ov1_EMT19609 ..GGFSVPR..R...AAEKIFPPL.................DfsmqppaQEIQAR.........DLH...D....NVWTFRHIYRgq
Ov1_EMT31390 ..GGFSVPR..R...AAEKLFPQLdysmqpp..........N.......QELIVR.........DLH...D....NMWTFRHIYRgq
Ov1_EMT09779 ..GGFSVLR..R...HADECLPPLdmtqspp..........T.......QELVAK.........DLH...G....MDWRFRHIFRgq
Ov1_EMT17168 ..GGFSVLR..R...HADECLPPLdmtqspp..........T.......QELVAK.........DLH...G....MEWRFRHIFRgq
Ov1_EMT16165 ..GGFSVPR..R...AAEKIFPSL.................DfslqppcQELQAR.........DIH...D....NVWTFRHIFRgq
Ov1_EMT31591 ..GGFSVLR..R...HANECLPPLdmamptp..........T.......QEIISK.........DLH...G....SEWRFKHIYRgq
Ov1_EMT27817 ..GGFSVPR..R...AAERVFPPL.................DftqqppaQELIAR.........DIH...D....VEWKFRHIFR..
Ov1_EMT06148 ..NRIVLPK..Q...HAEKHIPLKrapettttadk......A.......VLLNFE.........DGQ...G....KVWRFRYSYWns
Ov1_EMT06147 ..NRLVVPK..Q...HAEKHFPLKrtpetttttgk......G.......VLLNFE.........DGE...G....KVWRFRYSYWns
Ov1_EMT31332 ..NRLVVPK..Q...HAEKHFPLKrtpetttttgn......G.......VLLNFE.........DGE...G....KVWRFRYSYWns
Ov1_EMT25952 ..GGFSVPR..R...AAEDCFPPLdynlqrp..........S.......QELVAK.........DLH...G....TEWRFRHIYR..
Ov1_EMT08561 ..GGFSVPR..R...AAEDCFAPLdykqvrp..........S.......QELVAK.........DLH...G....TQWRFRHIYR..
Ov1_EMT22525 ..GGFSVPR..Y...CAETIFPKL.................DyradppvQTVLAK.........DVH...G....EVWKFRHIYRgt
Ov1_EMT09996 ..NRLVIPK..Q...HAEKHFPLQlpsssaavpgeck....G.......VLLNFD.........DAV...G....KTWRFRYSYWns
Ov1_EMT23005 ..NRLVIPK..Q...HAERYFPLNggdspgek.........D.......LLLSFE.........DEA...G....KPWRFRYSYWts
Ov1_EMT27061 ..-------..-...---------.................-.......QELVAK.........DLH...G....TDWHFRHIFRgq
Ov1_EMT29229 ..NRLVIPK..Q...HAEKYFPLDassndn...........G.......LLLDFE.........DSA...G....KPWRFRYSYWns
Ov1_EMT21501 ..NRLVIPK..Q...HAERCFPLGgds..............G.......EKGLLLsfddeagepWRA...G....KPWRFRYSYWts
Ov1_EMT29641 ..NRLVVPN..Q...FAEKYFPLDvaanek...........G.......LLLNFE.........DRG...G....KLWNFRYSYSnn
Ov1_EMT32462 ..GGFSVPR..R...AAERIFPRL.................P.......------.........---...-....----------..
Ov1_EMT19909 ..-RMIIPD..R...FVQHFRGQT.................G.......RTIKLV.........SRH...G....YTFDVQITKN..
Ov1_EMT13106 ..FWLGLPL..P...FCRKHLPKR.................D.......ERLTLK.........DEQ...G....VESETLYLAL..
Ov1_EMT05021 ..FWLGLPS..S...FCKDHLPPR.................E.......HKMVLE.........DEE...G....VEFDAVY--I..
Ov1_EMT28380 ..-RMIIPD..R...FAQHFRGQT.................G.......RTIKLA.........SRH...G....YTCDVQITKN..
Ov1_EMT09780 ..-SMSLPG..R...FAKNFNGHI.................S.......EVINLK.........PPT...G....KSWSIKVAGD..
Ov1_EMT12434 ..-------..-...--------P.................S.......QELVAK.........DLH...G....TEWKFRHIYRgq
Ov1_EMT19908 ..-RMIIPD..K...FAQHFRGQI.................G.......RTIKLA.........SRH...G....YTSDVQITKN..
Ov1_EMT01685 ..DEMTIPP..K...FATNFRGRI.................S.......DEVKLE.........VPD...G....KIYNVQVAEE..
Ov1_EMT07173 ..GRIVLPK..K...EAETHLPELktgd.............G.......ISIPIE.........DIGt..S....QVWSMRYRFWpn
Ov1_EMT13220 ..-KMPIPA..K...FMRRHLAAE.................Pgl.....RRATLM.........SPL...G....KFWHVDVVRDgh
Ov1_EMT09213 ..FWLGLPS..Q...FCGLYLPGS.................D.......DTITLE.........DEE...G....VEYKTRYLAL..
Ov1_EMT12994 ..FWLGLPS..H...FCDTYLPKN.................D.......CTITLV.........DEK...D....EEFESKYLAY..
Ov1_EMT17387 ..NELTIPK..E...FANNVRGKI.................S.......DEIKLE.........VPD...G....QTYRVQVDKE..
Ov1_EMT06248 ..FWLGVPL..N...FCGEHLPKH.................D.......VTIVLE.........DED...G....HGFDTNYLAR..
Ov1_EMT26018 ..FFLNLPC..E...FVRECLPRA.................H.......RKLKLW.........NPQ...G....KSWDVNYVYY..
Ov1_EMT20130 ..KQMMIPK..H...FIE-HLPAH.................D.......EAVVLV.........DQA...D....DEFHMMCNASke
Ov1_EMT05921 ..-EMSIPQ..K...FVNNFRGRI.................S.......EVMKLE.........APD...G....NIYNFKVTKD..
Ov1_EMT08925 ..-RFRIPD..K...FASSFIRQTqs...............S.......QGFDLE.........APS...G....ETWHVGVTKV..
Ov1_EMT28380 ..RTLEISR..K...YAEVYLPFV.................E.......QMVTLQ.........H-H...G....KKWDVRCCVKn.
Ov1_EMT17385 ..NFLTIPS..K...FAADHLQSK.................P.......REVLLL.........RLSr..E....DKWHVRCYYSs.
Ov1_EMT10769 ..GRLVLPK..A...CAEAYFPPIsqpe.............G.......RPLTIQ.........DAK...G....KEWHFQFRFWpn
Ov1_EMT30739 ..-SMIIPE..S...FVNYFGWKL.................S.......GTIELE.........APN...G....NVYDVRVTER..
Ov1_EMT06472 ..-SMVIPE..R...FVNYFGWKL.................S.......GTIELE.........APN...G....SVYDVEIAER..
Ov1_EMT12716 ..FFMVIPS..E...FVREHLPHT.................S.......KKLTLW.........DPQ...A....TPWQVDYVYC..
Ov1_EMT20366 ..-EMNIPE..K...FVNNFRGRI.................S.......KVMKLE.........APD...G....NVYNIQVTND..
Ov1_EMT28479 ..-RLEIPR..D...FLSYIPEVGlrgsnis..........P.......VQAMLK.........RSE...G....KTWVVELEKV..
Ov1_EMT25279 ..FWLGLPK..Q...FCTKYLPKR.................D.......EWITLV.........DEK...G....TESDSYYLAR..
Ov1_EMT09781 ..DRMTIPD..K...FVQKFRGQI.................T.......RTVKLE.........SRN...G....NTFDVHVTED..
Ov1_EMT23621 ..HMVELSK..R...YAAEHLPHR.................N.......VTLMFQ.........Y-M...G....KIWNINMLFH..
Ov1_EMT12198 ..-EMIVPK..E...FVQRFKGEF.................P.......REMILE.........TQN...R....RSCKIGVAKN..
Ov1_EMT25326 ..-RLKIPP..K...FCKHIPWEAsrkakglkea.......S.......MAATLE.........GPS...G....RTWQVVIRRT..
Ov1_EMT28355 ..-RISIPE..K...IANNFIGKIa................N.......GGFTLK.........APS...G....EEWRVGVEKI..
Ov1_EMT20365 ..-EISIPE..K...FVNNFRGRI.................S.......KVMKLE.........APD...G....NVYNIQVIND..
Ov1_EMT19909 ..RTLEISR..K...YAEVYLPFE.................E.......QMLTLQ.........H-H...G....KKWEVRCSVKk.
Ov1_EMT09782 ..SALVIPK..G...YAVEHFPPK.................S.......QTVTLQ.........RPGk..S....KKWHPRFHIRkd
Ov1_EMT26093 ..YFMIIPD..K...FVKTFLPEE.................S.......RKMTFW.........DPQ...G....KPWKVWYEYT..
Ov1_EMT08925 ..-GVTIPE..K...FVRSVGGMI.................S.......ELVKLE.........TPD...G....NTYNVHIAKE..
Ov1_EMT12830 ..----LPS..A...SAAVPGECK.................G.......VLLNFD.........DAV...G....KMWRFRYSYWns
Ov1_EMT09782 ..-GMIIPK..K...FIDNFGGMI.................S.......RTIELE.........SSN...G....NMYVFEVSKR..
Ov1_EMT23621 ..-YVTIPK..E...YAAVHFPPE.................S.......ATITLR.........SPGk..N....KKWHPRFYKK..
Ov1_EMT06404 ..-EMIIPE..E...FLQRFKGEF.................P.......REMILE.........TQN...C....RSYVIGVAKN..
Ov1_EMT19908 ..RSLDISR..K...YAEVYLPFK.................E.......QMLTLQ.........L-H...G....KKWEVRCRVKn.
Ov1_EMT02831 ..CMQDVPP..R...FAKNIPELA.................D.......TNVYLE.........DAF...G....LRWRVYLCAR..
Ov1_EMT06404 ..-SMIIPE..E...VVRRLKGEI.................P.......GEIKLE.........TRN...G....YSHTIVVAKN..
Ov1_EMT09781 ..CILDLSS..K...YADEYLPRE.................D.......QTLMLQ.........R-R...D....KSWKVQFHINk.
Ov1_EMT01685 ..NGLTIPE..K...FANYVRGHI.................S.......EEIKLE.........VPD...G....QTYSVQVDNE..
Ov1_EMT25326 ..---RFPT..G...FSRQHLPRE.................K.......TEMVLR.........DPD...G....KAWAALYIPSt.
Ov1_EMT08965 ..CTLTFSK..K...YVQTHVGDK.................E.......RRVCLQ.........R-F...G....KRWDVQFSSS..
Ov1_EMT26018 ..ERLKIPP..S...FNQYLQDQP.................T.......GVVSLK.........GQS...G....NTWLAELASD..
Ov1_EMT08925 ..PSLAFSL..D...YAKYFLPGE.................N.......QIFRLH.........RPGe..S....APWKAEFRSF..
Ov1_EMT33420 ..PSLVICR..G...YGRAHFPKG.................R.......QTITLR.........LPV...Gk...KKWHAIFHIRrd
Ov1_EMT01422 ..EHVTIPV..G...FHK-YLEDC.................T.......RMVSLR.........GPS...G....NKWPVELAKI..
Ov1_EMT07265 ..FVLTLPS..Q...YAKKYLGEE.................P.......RLY--L.........QLL...G....DKWEVGFPDN..
Ov1_EMT26150 ..-------..-...---------.................G.......VLLNFE.........DGE...G....KVWRFRYSYWns
Ov1_EMT08925 ..NFLVIPS..E...FVDEHLHMR.................S.......HEVVLL.........RPNr..E....ERWHVRYYQGs.
Ov1_EMT28357 ..-RISTPE..K...IANNFIWKIa................N.......GGFTLK.........APS...G....EEWRVGVEKI..
Ov1_EMT26093 ..EHVTIPA..G...FHK-YLEDC.................T.......GMVSLR.........GPS...G....NKWPVELAKI..
Ov1_EMT11663 ..-SLVIPE..W...FVSQFGGKV.................W.......RTVKLE.........SPD...G....NVYDVGVTEN..
Ov1_EMT08965 ..-EMIVPD..E...FLRRFRGEI.................P.......TEIKLE.........TRN...G....HSYTIGVAKY..
Ov1_EMT00295 ..EQETIPE..D...CH-KYLEEC.................T.......GTVSLR.........GPS...G....NLWPVELAKI..
Ov1_EMT12198 ..FLLTFPR..Y...YAKKYLGEE.................P.......HMY--L.........QRM...G....RKWDVWFSEK..
Ov1_EMT17386 ..GCLVICK..D...FAAKHLPHK.................D.......QTIKLC.........YPQn..S....KTWDANLAVIt.
Ov1_EMT32040 ..-SLVIPE..W...FVNQFGGKI.................W.......RTVKLE.........SPN...G....NVYDVGVTEN..
Ov1_EMT15473 ..-------..-...---------.................-.......------.........DAA...G....KVWRFRYSYWns
Ov1_EMT20366 ..--LAIPQ..K...FVQNFKGQI.................S.......EVIKLE.........APD...G....NIYNVQAIKD..
Ov1_EMT11662 ..-SLVIPE..W...FVNQFGGKI.................C.......GTVRLE.........TSD...G....NMYDVGVTES..
Ov1_EMT05921 ..GSLVICK..D...YAAKYLPHE.................E.......QFITLC.........HPHk..S....NIWVDNLKVIt.
Ov1_EMT18170 ..PALVIPK..R...YAAAHFPTE.................S.......QNIVLT.........LPGv..K....KKWHPLFHVRr.
Ov1_EMT04827 ..CLQVIPN..K...FIDHFGGNI.................S.......RTIELE.........SRN...G....SMYTVEVSKLm.
Ov1_EMT13220 ..-------..K...FCVMNGIAT.................N.......RLMILK.........DSG...G....RSWPVKLTLT..
Ov1_EMT24022 ..--LHIPA..Q...FSMEHLPDH.................G.......MRMVLV.........DEE...E....EEFKVCYRPH..
Ov1_EMT20366 ..GSLVICK..D...YAAKYLPHE.................D.......QFITLC.........HPRk..S....NIWLDNLKVTt.
Ov1_EMT20365 ..GSLVICK..D...YAAKYLPDE.................D.......QFITLC.........HPHk..S....NIWIDNLKVIt.
Ov1_EMT05921 ..NLLTFPR..E...FAAKHLAER.................S.......HDILLL.........RPNr..R....EKWCVRYYYH..
Ov1_EMT12928 ..AEMKIPK..H...FSE-YLPAH.................D.......EGVVLV.........DEA...D....DEFHMMYNAHrq
Ov1_EMT28125 ..-QMIISK..E...WVRCLKGEI.................P.......DEIKLE.........TRN...R....ASYTIKVAKY..
Ov1_EMT07265 ..-DEMIPE..E...LVRRFKCEI.................P.......GEIKLV.........TRK...G....YSHTIVVSKN..
Ov1_EMT01685 ..GYLVICK..D...YAVKHLPHQ.................D.......QMIKLC.........HPQn..S....KTWDANLAVI..
Ov1_EMT05921 ..----IPQ..K...FVDNFNGHI.................S.......EVIKLE.........APD...G....NIYNIQAIRD..
Ov1_EMT17387 ..----VPR..K...FLVNNMRGQi................P.......DEVNLD.........LPN...G....KAYTVQVSKQ..
Ov1_EMT12198 ..---IIPE..E...VVRRFKSEI.................P.......GEIKLE.........TRN...G....YSHTIVVAKN..
Ov1_EMT07265 ..---IIPE..E...FVRRFKGEF.................P.......REMILE.........TKN...R....CSYIIGVAKN..
Ov1_EMT13166 ..FQLYIPG..R...FHK-HLPEE.................R.......TSATLI.........C-R...G....RSWAMRYCGD..
Ov1_EMT09782 ..YAVTICR..K...YAAEYLPAG.................A.......QTVTLL.........RAEk..S....KTWEVKVNPRi.
Ov1_EMT15692 ..-KMTIPD..E...FVQQHLIGLescps............S.......QKALII.........GPT...G....KLWPVELDQR..
Ov1_EMT32039 ..-SLVIPE..W...FVNQFGGKI.................W.......GTVRLE.........TSD...G....NMYDVGVTES..
Ov1_EMT33019 ..CALVFCK..E...FASACGLPHtkkt.............T.......IHLQLE.........DKT...K....GPWPVTLIRSeh
Ov1_EMT00181 ..HLLTIPQ..Q...FKKSYLPWF.................D.......EMIFLV.........DEE...D....GEFPMPYMAQ..
Ov1_EMT06474 ..YAVTICR..K...YAAEYLPAG.................Aq......TVTRLR.........AEK...S....KTWEVKVNPRi.
Ov1_EMT17386 ..-KLSIEV..R...YATAHLPRE.................E.......QWVRLQ.........LPGk..N....HTWKAKLYIGdk
Ov1_EMT20365 ..FMQTIPQ..K...FVENFKGQI.................S.......EVIKIE.........APD...G....NIFNVQATKN..
Ov1_EMT04827 ..RTIVIPK..L...FAEEHFPRE.................S.......QNLTLQ.........RPGk..S....KKWHPWFSIR..
Ov1_EMT04828 ..YNVTISC..A...YAAEYLPPG.................E.......RVAVTL.........VRR...K....KAWEVEMRAR..
Ov1_EMT27675 ..GRIVLPK..K...DAEASLPPLcerd.............P.......VILQMD.........DMVl..P....ITWKFKYRFWpn
Ov1_EMT18170 ..-SMVIPE..R...LVDHFGGKI.................S.......GTIQLE.........APN...G....QMYVVGVAKK..
Ov1_EMT20365 ..NLLTISR..K...FAAKHLAAR.................S.......HDILLL.........RHNr..G....KKWCVRYYYH..
Ov1_EMT30739 ..RSLTFAT..K...YCDTYLRKG.................S.......RSLVFQ.........AEG...Ki...QQWHGGLHVT..
Ov1_EMT02182 ..GRLVLPK..K...CAEAYFPPIsqpe.............G.......LPLKVQ.........DAS...G....KEWVFQFRFWpn
Ov1_EMT33420 ..DSVVIPQ..R...LMNHFGGDT.................S.......GTIKLE.........SPN...A....QVYDVGVAKK..
Ov1_EMT04828 ..----IPN..K...FIDHFGGKI.................S.......RTIELE.........SHN...G....GMYTVEVFELm.
Ov1_EMT26160 ..SCLRIPQ..L...FKEWYLPWC.................N.......EMIYLV.........DEQ...D....VEFHLPYYAL..
Ov1_EMT17385 ..-------..-...---------.................-.......--LKLK.........APS...G....ETWHVGVSKV..
Ov1_EMT20366 ..NLLTFPE..K...FAAKHLVER.................S.......HDILLL.........RPNr..S....ETWCARYYYHp.
Ov1_EMT26088 ..DQLGIRM..E...YGARHIPHI.................N.......RKTDLM.........LQAegsT....EQHTCRLVIDq.
Ov1_EMT22877 ..-----PD..K...FAKVLAGRE.................P.......REVKLR.........EAGsgrH....SLWDVKVVLDa.
Ov1_EMT32415 ..FQVVVPR..S...LAP-FLPSK.................P.......TSATLT.........W-Q...G....RSWEMRFTGG..
Ov1_EMT08965 ..FSLSISK..R...YVRRYLGDE.................V.......RSIWLE.........R-D...G....ERCQVTLGRG..
Ov1_EMT09249 ..-------..-...---------.................-.......-EVKLE.........VPD...S....KTSNIRVSKE..
Ov1_EMT02000 ..-SMVIPE..W...FVSQLGGKI.................W.......RTIRLQ.........APD...G....IIYDVGVSEN..
Ov1_EMT26998 ..CSVNLPL..K...LVEHFKEDTs................K.......ATIQLE.........APN...D....NIYGVEACKHg.
Ov1_EMT09780 ..SIVGVSS..E...FAGKYLGAI.................G.......REIVLR.........RAGr..K....GGWHVRYISG..
Ov1_EMT08925 cnRSYLICK..D...DAIKHLPRK.................D.......EFITLC.........HASh..S....KTWGAHYNINa.
Ov1_EMT12525 ..QYLNVPR..E...FSVAHGYAE.................R.......KKVLLR.........M-G...G....ESWTVNLKHAhn
Ov1_EMT23566 ..EKLVLPD..K...FVRGLNGRElr...............G.......VKLRVE.........GGG...A....RAWDVEVVVN..
Ov1_EMT23566 ..QYLNVPV..E...FSQSHGFTE.................K.......GRVVLR.........M-R...G....QQWTVCLKHSnr
Ov1_EMT04827 ..YNVTISG..A...YAADYLPAG.................E.......RVAVTL.........VRR...K....KVWEVEMRAR..
Ov1_EMT22877 ..-YLNVPL..E...FHEAHGYAE.................R.......SKVVLR.........M-S...G....KSWPVTLKHTnr
Ov1_EMT26088 ..CSVNLPL..K...LVEHFKEDTs................K.......ATIQLE.........APN...D....NIYGVEACKHg.
Ov1_EMT01811 ..PLLIISK..ErslAAAARFPHE.................N.......GAVTLQ.........MPGk..S....EKWRPRFFIE..
Ov1_EMT26046 ..FWLGLPS..D...FCNKHLPKK.................D.......TAVVLE.........DED...G....HNYDAKYLGA..
Ov1_EMT01685 ..---DVPI..N...LANYIRGQI.................P.......DKVKLE.........VPD...G....KTYNVQVSKE..
Ov1_EMT01999 ..-KLRLPG..K...FARVFDGHE.................P.......FEVKLR.........EAGrr.H....HLWDVEVVFDa.
Ov1_EMT28635 ..----IPW..E...VSSQLRDMIpd...............S.......EPIKLE.........TPD...G....RTYSVKFFKF..
Ov1_EMT06472 ..VSLSFAI..K...YSATYLQKG.................S.......GSLVLQ.........VEGk..S....QIWHDEMREK..
Ov1_EMT11663 ..ITITMGK..Q...YASRYLEKQyftghrgk.........Knv.....ISLVLQ.........REGk..S....RTWDTELRRG..
Ov1_EMT25672 ..PYLTFSK..Q...YVSRYLEKQyftrhhak.........Knv.....ISLVLE.........REGg..S....RRWHTELRLG..
Ov1_EMT21044 ..TFLTFGA..K...YASRYLNKNygaghhgk.........Knm.....ISLVLQ.........REGk..S....RTWNTELQRR..
Ov1_EMT20151 ..PSLYLGK..D...YASACLLTQ.................P.......GRLRLL.........LEGd..E....RDWDCRLGLRks
Ov1_EMT00295 ..---IIPD..M...FVENFLLKE.................S.......RKMTLW.........DPQ...A....KPWKVWYEYT..
Ov1_EMT31520 ..-------..-...FPARFGFLE.................R.......CKITLK.........SVEr..N....KSWEVEGVNYhp
Ov1_EMT18170 ..PNLVISK..D...YAHAYFPHK.................T.......QFVTLK.........LPGk..S....KAWPCKFRIR..
Ov1_EMT20151 ..DHMRIRP..P...VASHLRNLI.................Tef.....DKIQLE.........APN...G....RSYPVKIGWE..
Ov1_EMT13199 ..-FLLIPP..K...PAGAPKMVGlt...............N.......QLVCLE.........DSE...G....KSSMVRLSVV..
Ov1_EMT14114 ..FWLGLLS..G...FCNKHLPKQ.................D.......ATIVLE.........DED...G....HNYDAKYLGA..
Ov1_EMT28355 ..-RQIISS..K...FAADHLEGR.................S.......YEMLLL.........RPNr..K....EKWCLKYYHS..
Ov1_EMT14307 ..CNLNVSV..D...FQLAHGYAE.................R.......SKVELR.........M-R...G....KSWPVHLKHNpn
Ov1_EMT33385 ..SYFQVPK..E...CERLVPPHQaagd.............K.......QDLLLH.........DIS...G....NSWNMEHTHR..
Ov1_EMT30659 ..CHVYIPL..S...LVRQF---K.................E.......EVVKIV.........ALD...K....SIYVVGAKKHn.
Ov1_EMT28125 ..-KMIIQK..E...FVQRFKGEI.................P.......GEIELE.........TKN...K....CRYIIQVIKNq.
Ov1_EMT13199 ..TRLELPD..P...LSNAVGRKGrld..............Q.......NIVMLK.........DPM...K....RLWPVFYHET..
Ov1_EMT28635 ..CHVYIPL..S...LVGQ---FK.................E.......EVVKIV.........ALD...K....SIYVVGAKKHn.
Ov1_EMT26998 ..SHLGFRR..E...YGSRYIPHI.................N.......RRMRLV.........LQS...E....GSTTGQPATVvi
Ov1_EMT02000 ..GTLVICK..D...YGRKHLPCE.................E.......TNIILQ.........LPRk..N....KGWKCRFHIRps
Ov1_EMT06472 ..PDLVIPK..D...YTLAHFPHR.................N.......QTIKLQ.........LPEq..S....KKWYCEFRVKsd
Ov1_EMT01999 .nPMLRFGS..Q...YATRYLVEKfagghpcgkhr......G.......VELVLL.........REGk..S....RSWPTKLRHS..
Ov1_EMT05389 ..QYLNVPM..E...FGVVHRYTE.................K.......KKVLLR.........M-G...G....ESWAVNLKHGlt
Ov1_EMT08502 ..-------..R...FMKTFLPKE.................S.......RTMTLW.........DPQ...A....KPWKAWYKYTc.
Ov1_EMT01554 ..-----PF..-...-----GFVE.................S.......CKIALKp........MES...D....NSWEVEGVALsp
Ov1_EMT32039 ..-------..-...FAAGHHGGKcn...............A.......INLVLQ.........REGk..S....RPWPTKLRYThv
Ov1_EMT30659 ..TKLCFCV..E...YASACHLPL.................K.......ETPLLL.........RLE...GsdiqFPATLSVLRY..
Ov1_EMT07124 ..----IPT..H...FQRRL-PA-.................R.......RAAVVL.........RCR...G....SSWIMSYCGD..
Ov1_EMT01422 ..-----PK..K...LLRTFHPRE.................S.......TKMTLW.........DPQ...A....KPWKVWYEYT..
Ov1_EMT11662 ..GDLVIRK..D...YAHKYLPCK.................D.......TNIILQ.........LPRk..N....KIWECKFQIRps
Ov1_EMT26998 ..-NLCIPW..E...VGDHLGSMI.................S.......ETITLE.........APN...G....IFCIGVCR-K..
Ov1_EMT32039 ..GDLVIRK..D...YAHKYLPCK.................D.......TNIILQ.........LPRk..N....KIWECKFQIRps
Ov1_EMT27996 ..---RLPD..T...FTEMLDDHQ.................P.......KNVKLR.........QPDsglR....RLWDVEVVIR..
Ov1_EMT14989 ..----IPT..H...FQRRL-PA-.................R.......RAAVVL.........RCR...G....SSWILSYCGD..
Ov1_EMT25672 ..FRQAIPK..D...YALKYFPCE.................S.......TSIKLQ.........LPNk..N....KAWKCRLHIRps
Ov1_EMT32373 ..---TIPQ..Q...FKKSYLPWF.................D.......EMIFLV.........DEE...D....GEFPMPYMAQ..
Ov1_EMT18170 ..DLRTTGH..A...AADGHLLPDg................K.......QTLTLR.........EAGw..S....KAWRVEM--R..
Ov1_EMT04828 ..-----PQ..A...FCRGALPRE.................S.......QNLTLQ.........RPGk..S....KKWHPWLYIR..
Ov1_EMT06722 ..-------..-...---KHFVAV.................P.......TEFKLR.........NNI...G....CSWKVTVKLM..
Ov1_EMT15692 ..-KLCVPW..E...FAARLAA-G.................A.......GDVHVV.........DLL...G....KPRRVELCVRpr
Ov1_EMT01571 ..NRLLFSC..K...RASIQRHPItgllshketylvhewkdG.......RRVTAF.........DDH...G....NEFGFKLRYLrs
Ov1_EMT11111 ..-------..-...---------.................A.......QELFAK.........DLH...G....NEWKFRHIFR..
Ov1_EMT11662 ..-------..-...--AGHHGGKcn...............A.......INLVLQ.........REGk..S....RPWPTKLRYThi
Ov1_EMT18852 ..YKMKIPQ..R...AVWYLQLKK.................K.......GILQVV.........LGN...G....HLKPAKYRVGv.
Ov1_EMT01999 ..ATLIIHK..D...YALKHFPCE.................D.......TTVILQ.........LPGk..N....KDWKCTFRIRps
Ov1_EMT02000 .tPTLHFGY..Q...YTGRYLVQKsaagyh...........Rgkssl..VGLVLH.........REGr..S....GSWHTKMQHSmq
Ov1_EMT17386 ..DEMAIPD..E...FTTNFRGHI.................S.......DKVKLE.........VAD...G....NIYNVQVAKE..
Ov1_EMT08764 ..-------..-...---------.................-.......------.........---...-....RTWDTELQRK..
Ov1_EMT28356 ..-------..-...---------.................-.......------.........---...-....----------..
Ov1_EMT33420 ..PDLVIHK..E...YAGAYFPPR.................T.......RFVTLK.........VPEn..S....KGWQCKFCIRpv
Ov1_EMT25863 ..KLMKIPK..K...VAQPLNLDT.................E.......GVLGLC.........MGV...G....DVMQVAYHTDr.
Ov1_EMT02831 ..-------..-...---------.................R.......KVVVLE.........DPG...G....RRWPVLYLCT..
Ov1_EMT33847 ..NRLLFSCkrE...FIQAHPITWllaeeetyfvhewgd..G.......LSVSVM.........DDH...D....NQFNFKLKYLds
Ov1_EMT32040 ..GNLIIRK..D...YALKYFPCE.................A.......TNIILQ.........LPRk..N....KEWKCRFNPD..
Ov1_EMT18693 ..KQFEFGQ..D...YAHAVHLPA.................K.......TTDVIL.........KSN...G....KDWETKMSCRkg
Ov1_EMT28635 ..AHLAFCM..E...YASACRLPL.................E.......QTPLLL.........RLEgs.N....MRWSSALMIQqn
Ov1_EMT11663 ..GNLIIRK..D...YALKYFPCE.................A.......TNIILQ.........LPRk..N....KEWKCRFNPG..
Ov1_EMT21044 ..GNLVIRK..D...YALKYFPCE.................A.......TDIILQ.........LPGk..N....KEWRCKLQIRp.
Ov1_EMT33420 ..DLGAMGG..A...PADGHLPDG.................A.......QTLVLR.........QAGw..S....KAWHAEM--L..
Ov1_EMT20151 ..CHVYIPL..T...LLDSFKEGIt................E.......APIQLK.........AHSn..D....MIYVVGASKHg.
Ov1_EMT31520 ..-------..-...---------.................-.......---LVL.........SPFg..K....NAWPVKVDRD..
Ov1_EMT15692 ..KLFAVKR..T...FCSSIGLVG.................A.......CTIELK.........TSMes.T....RSWPVAFNIA..
Ov1_EMT25624 ..SRLLMSC..K...KWKQHGLDDvltveekqllqkqi...K.......VDMKAY.........DRN...G....NSYDLAFKKLdc
Ov1_EMT14307 ..-------..-...---------.................-.......------.........---...-....----------..
Ov1_EMT25671 ..PTLVIRK..D...YALEHLPCK.................D.......TNIILQ.........LPRk..N....KDWHCRFTIRps
Ov1_EMT08426 ..-------..-...---------.................-.......------.........---...E....KLATVRYMNA..
Ov1_EMT30738 ..VSLTFGT..E...YAAKYLRKG.................D.......RNLVLQ.........QWH...G....-----VMRDH..
Ov1_EMT32507 ..-------..-...---------.................-.......------.........--N...G....PFWVAAEFSP..
Ov1_EMT02333 ..-------..-...----SPNLM.................D.......AKLVFT.........KYS...H....GTWPTIY---..
Ov1_EMT04013 ..-------..-...--------Ddglnaqn..........K.......VSVKVL.........DAE...G....HEKDVHLRYLn.
Ov1_EMT20145 ..KSMKIPN..Q...VCVLLNIGA.................E.......GFIGVR.........LGE...G....PLSRVAFKTAk.
Ov1_EMT15081 ..GRIVVPK..R...DAEANLPALlerd.............G.......LILKME.........DMRl..P....VTWNFKFSHT..
Ov1_EMT01422 ..YFMIIPD..K...FVKTFLPKE.................S.......RKMTLW.........DPQ...A....KPWKI-----..
Ov1_EMT25849 ..-------..-...-TRHVHHHR.................G.......LSVVVQ.........DDH...S....NQFNFTLKYLds
Ov1_EMT08500 ..YFMIIPD..K...FMKTFLPKE.................S.......RKMTPW.........DTQ...A....KPWKWSL---..
Ov1_EMT01554 ..-------..-...---------.................-.......--AHIM.........SPFg..K....KPWGITVGAR..
Ov1_EMT18234 ..-------..-...---------.................-.......VLVKVL.........DAE...G....REKEVSLPYLns
Ov1_EMT31520 ..-KMPIPP..E...FLQRGYISEedlnrp...........R.......PIATFL.........T--...-....-SWHIELKKDg.
Ov1_EMT08528 ..KRMYFNV..H...FSMGSLFPHmdag.............H.......GELPIT.........TGD...Gt...TTVTARFIKGv.
Ov1_EMT15116 ..GRIVLPK..K...ESEAYLPILtskd.............G.......RSLRMH.........DLLn..A....QLWTFKYSI-..
Ov1_EMT11222 ..-------..D...FLEKFKVPV.................D.......ATITFQ.........CTL...M....KMLTVQKFNClv
Ov1_EMT28357 ..NFLIVPS..K...FAADHLEGR.................S.......HEMLLL.........RPNr..K....EKWYLKL---..
Ov1_EMT08188 ..-MACIPC..F...ARPNLLRKLkvamdkgt.........G.......TTAYLC.........TKE...G....FSFKTTILNEk.
Ov1_EMT30738 ..PDVVIPK..D...YALAHFPRK.................N.......QTIKLQ.........LPEq..S....KKWYCE----..
Ov1_EMT28753 ..---FIPC..H...SMVEFNCAT.................G.......DRMLFE.........ECE...G....CKFITEIRKE..


                        60              70             80            90            100              
                         |               |              |             |              |              
d1yela1      ....G.....E.K.....VFLTV.GWENFVKDNNLEDG.....K.YLQFIYD...RDR.....TFYVIIYGHNMC............
Ov1_EMT32630 ....P.....K.R.....HLLTT.GWSVFISAKRLVAG.....D.SVLFIWN...DNN.....QLLLGIRRAN--rsqtvmpssvls
Ov1_EMT04282 ....P.....K.R.....HLLTT.GWSVFVSAKRLVAG.....D.SVIFIWN...DNN.....QLLLGIRHA---nrpqtimpssvl
Ov1_EMT18418 ....P.....R.R.....HLLTT.GWSSFVNKKKLVSG.....D.AVLFLRG...DDG.....ELRLGVRR----aiqlkneallka
Ov1_EMT01567 ....P.....K.R.....HLLTT.GWSVFVSTKRLLAG.....D.SVLFIRD...EKS.....QLLLGIRRA---trpqpalsssvl
Ov1_EMT19609 ....P.....K.R.....HLLTT.GWSLFVSGKRLFAG.....D.SVIFVRD...ERQ.....QLLLGIRRAN--rqptnisssvls
Ov1_EMT31390 ....P.....K.R.....HLLTT.GWSLFVGAKRLKAG.....D.SVLFIRF...---.....------------plgefvrverpf
Ov1_EMT09779 ....P.....R.R.....HLLQS.GWSVFVSSKRLVAG.....D.AFIFLRG...ESG.....ELRVGVRR----amrqlsnvpssv
Ov1_EMT17168 ....P.....R.R.....HLLQS.GWSVFVSSKRLVAG.....D.AFIFLRG...ESG.....ELRVGVRR----amrqlsniassv
Ov1_EMT16165 ....P.....K.R.....HLLTT.GWSLFVSGKKLFAG.....D.SVIFVRA...SPT.....EF----------............
Ov1_EMT31591 ....P.....R.R.....HLLTT.GWSTFVTSKKLMAG.....D.AFVYLRS...ETG.....EQRVGVRR----lvqkqstmpasv
Ov1_EMT27817 ....G.....K.-.....-----.--------------.....-.-------...---.....------------neknqlwlgirr
Ov1_EMT06148 ....S.....Q.S.....YVLTK.GWSRFVREKGLVAG.....D.VVVFSCS...E--.....------------ygh.........
Ov1_EMT06147 ....S.....Q.S.....YVLTK.GWSRFVREKGLGAG.....D.SIVFS--...---.....------------cs..........
Ov1_EMT31332 ....S.....Q.S.....YVLTK.GWSRFVREKGLAAG.....D.SIVFSCS...---.....------------aygqekqffi..
Ov1_EMT25952 ....G.....-.-.....-----.--------------.....-.-------...---.....------------t...........
Ov1_EMT08561 ....G.....E.R.....-----.--------------.....-.-------...---.....------------gddg........
Ov1_EMT22525 ....P.....R.R.....HLLTT.GWSTFVNQKKLVAG.....D.SIVFLRT...EHG.....ELCVGIRRAK--rv..........
Ov1_EMT09996 ....S.....Q.S.....YVLTM.GWSRFVKEKGLHAG.....D.AVGFYRS...ASG.....NNQLFIDC----kl..........
Ov1_EMT23005 ....S.....Q.S.....YVLTK.GWSRYVKEKQLDAG.....H.IVHFERV...R--.....------------g...........
Ov1_EMT27061 ....P.....R.R.....HLLTT.GWSVFVSSKRLVAG.....D.AFIFLRG...ENG.....ELRVGVRR----hmrqvnnmpssv
Ov1_EMT29229 ....S.....Q.S.....YVMTK.GWSRFVKETRLEAG.....D.IVSFK--...---.....------------r...........
Ov1_EMT21501 ....S.....Q.S.....YVLTK.GWSRYVKEKHLEAG.....D.VVHFERV...R--.....------------g...........
Ov1_EMT29641 ....S.....Q.S.....YIMTM.GWSAFVRDHHLATG.....D.TVSFYRA...GTR.....------------lf..........
Ov1_EMT32462 ....-.....K.R.....HLLTT.GWSLFISGKRLLAG.....D.SVLFIRD...AKQ.....QLLLGIRRAN--rqptnlsssvls
Ov1_EMT19909 ....L.....E.K.....LVLDS.GWKAFARAHNLRTG.....D.FLVFKYD...GNS.....ELKVLIFGPSGC............
Ov1_EMT13106 ....K.....N.G.....--LSA.GWRGFAIQHNLVDG.....D.CLVFELI...NRT.....TFKVYIIRQ---s...........
Ov1_EMT05021 ....G.....N.R.....TGLSG.GWRGFSMHHDLEDG.....D.SLVFELA...EPD.....RFKIYIFK----............
Ov1_EMT28380 ....L.....E.K.....LVLDS.GWKAFVRAHNLRTG.....D.FLLFKYD...GHS.....QLKVLIFGPSGC............
Ov1_EMT09780 ....T.....D.E.....VVLRS.GWKEFVDGHGIGEG.....D.RLLFKYS...GAS.....SFDVLMFDSTGCqkppp.......
Ov1_EMT12434 ....P.....R.R.....HLLTT.GWSAFVNKKKLVSG.....D.AVLFLRG...DDG.....ELRLGVRR----svqlkngsafpa
Ov1_EMT19908 ....L.....A.K.....LVLDS.GWKAFARAHNLRTG.....D.FLVFKYD...GNS.....ELKVLIFGPSGC............
Ov1_EMT01685 ....Q.....H.K.....LVLRS.GWANFAGAYELKEG.....D.LLVFTYS...GDS.....HFKVKIFKPSGC............
Ov1_EMT07173 ...nK.....S.R.....MYLLE.NTGDFVRSNELQEG.....D.FIVLYS-...---.....------------dvksgkyl....
Ov1_EMT13220 ..ggD.....S.D.....VYFAG.GWAEFVRANRLEEE.....N.FLVFKYE...GNM.....VFTVKVFETSGC............
Ov1_EMT09213 ....K.....T.G.....--LSA.GWRRFALDHNLVDG.....D.CLVFEWV...VWN.....TFYVYIIRQ---s...........
Ov1_EMT12994 ....K.....K.G.....--LSG.GWAGFALDHVIRDG.....D.STVFQLI...KPT.....TFKVHIIR----............
Ov1_EMT17387 ....P.....N.E.....VVLRS.GWDAFVSAYELKEG.....D.TLLFAYT...GNS.....HLKVQIFN----............
Ov1_EMT06248 ....K.....Q.G.....--LSG.GWHGFVVRHGLMVG.....D.AVIFQLV...GPK.....RFKVYILR----e...........
Ov1_EMT26018 ....S.....E.Rcv...GGLSG.GWGKFSLDNNLEKF.....D.VCVFELF...SKD.....NIKVHIYR----............
Ov1_EMT20130 ....G.....R.H.....CYLSK.GWREFAVHHDLENG.....D.CLVFQLI...DSA.....KFKVYIFRAN--............
Ov1_EMT05921 ....L.....N.K.....IVLRY.GWAAFASDYQLKEH.....D.LLVFRYI...GDS.....HFKVLIFDPSGC............
Ov1_EMT08925 ....A.....N.D.....LFFSS.GWGDFVKAHELQEN.....D.LLVFTFS...GNS.....SFEVLIFDATGC............
Ov1_EMT28380 ....K.....K.S.....KRLMR.GWMHFVRGNNLQLG.....D.VCLFELL...RNKkky..VMNVHIIRK---s...........
Ov1_EMT17385 ....R.....T.R.....CFNCQ.RWVKFVRDNGLREG.....D.VCVFELI...KGArkmt.TMTVHVAR----r...........
Ov1_EMT10769 ...nN.....S.R.....MYVLE.GVTPCIQSLQLQAG.....D.TVTFSRI...EPG.....GKLVMGFR----ka..........
Ov1_EMT30739 ....R.....N.K.....TFLRS.GWEAFVDANYIVET.....D.SLMFRYR...GNC.....RFNVLVFHSSGC............
Ov1_EMT06472 ....R.....N.K.....TLLRS.GWEAFVDANHIVEN.....D.SLMFRYR...GSC.....RFKVVVFDSSGC............
Ov1_EMT12716 ....Shr...S.A.....GAFSR.GWSQFSIGNNLEKF.....D.VCVFELI...AED.....TIKVHIYR----a...........
Ov1_EMT20366 ....L.....N.K.....ITLRS.GWAAFASAYELKEH.....D.LLVFSYT...GNS.....HFRVLIFDPSGC............
Ov1_EMT28479 ....D.....R.C.....VFLTT.GWPKFVVDNSLREY.....E.FLLFRHD...KKM.....DFMVSVFGRNACekav........
Ov1_EMT25279 ....K.....W.G.....--LSA.QWKAFAINHKLVDG.....D.CLVFERI...HQT.....RFKLV-------v...........
Ov1_EMT09781 ....L.....H.K.....VVLQS.GWEVFVSAHGISMG.....D.FLVFNYD...GNS.....WFKVLIFDPSGC............
Ov1_EMT23621 ....Drkyp.K.R.....WYLIG.GWSKFISDNSLRLG.....D.ICLFELK...KDEkel..TVIVHLLR----kesidh......
Ov1_EMT12198 ....N.....G.K.....LVFTV.GWGKFVETFGLEMD.....D.TILFRYN...GNS.....QFNVIIFDEDGC............
Ov1_EMT25326 ....A.....E.G.....TFFTA.GWAKFVQDQALREL.....E.FLVFRHD...GGT.....SFAAMVFDKSACer..........
Ov1_EMT28355 ....A.....D.E.....LFFMP.GWEEFAKAHELQEN.....D.LLFFKCS...GNG.....SFDVLIFDPSGC............
Ov1_EMT20365 ....L.....N.K.....IVLRS.GWAAFASAYELKEH.....D.LLVFRYI...GDS.....HFKVLIFNPSGC............
Ov1_EMT19909 ....S.....K.G.....KRLLT.GWKHFACGNNLQLG.....D.VCLFELL...RNKkky..AMNVYIIRK---s...........
Ov1_EMT09782 ....Kh....G.S.....ILCGP.GWFDFVRDTRVQVG.....D.ICIFER-...---.....------------mmk.........
Ov1_EMT26093 ....Ggec..P.R.....AAFSA.GWGALAMENNLEKW.....D.VCIFELL...DQE.....------------yniklhvy....
Ov1_EMT08925 ....L.....N.N.....LVLRS.GWSKFASVYELQEG.....D.LLRFKYN...GDS.....HFKVEIYDPSAC............
Ov1_EMT12830 ....S.....Q.T.....YVLTK.GWSRFVKEKGLHAG.....D.VVGFYRS...ASG.....NNQLFIDC----kl..........
Ov1_EMT09782 ....M.....G.N.....TVLHR.GWQAFIDEHHIEEN.....D.SLLFRHI...EKS.....RFEILVLDSDDC............
Ov1_EMT23621 ....G.....T.M.....IKLTG.SWLHFVRDNDVHEG.....D.ICIFVPA...KGGkpf..MFTVHLLR----k...........
Ov1_EMT06404 ....N.....G.N.....LVLTV.GWGKFVGTFGLEMG.....D.TIVFRYI...GNS.....RFNVIIFD----e...........
Ov1_EMT19908 ....N.....K.T.....KRLMR.GWKHFARGNSLWLG.....D.VCLFELL...RNK.....KKYVMN------lhiir.......
Ov1_EMT02831 ....D.....G.R.....LSFGH.GWRNFVLDHTVAVG.....E.FLVFRHI...SRS.....VFAVQIFAKSAC............
Ov1_EMT06404 ....Q.....E.K.....LVLTV.GWRQFIENYDLQIG.....D.SLMFRYK...GTS.....QFNVMIFD----k...........
Ov1_EMT09781 ....N.....N.T.....KRLFQ.GWGEFADDNNLKVG.....D.LCLFEPLqk.KNR.....VMNVHIIR----k...........
Ov1_EMT01685 ....Q.....N.E.....LVLLS.GWDTFVSAYELKEG.....D.TLLFGYN...GNS.....QFKVRIFNVN--g...........
Ov1_EMT25326 ....R.....D.R.....--LSR.GWCAFARGNCLEEG.....D.CCVFELA...GAA.....EFRVHIFR----............
Ov1_EMT08965 ....R.....E.V.....KRIVS.GWRKFVKDNDVETG.....D.ICIFELL...K--.....------------idem........
Ov1_EMT26018 ....N.....E.G.....LFFVK.GWKEFVRDHSIEMG.....H.FLTFRYD...GRS.....KFSVVIFD----............
Ov1_EMT08925 ....G.....S.R.....RWLVK.GWEQFVIDNELELD.....D.VCLFERI...ENKkkl..RMMVHIIR----k...........
Ov1_EMT33420 ....S.....G.G.....YVLYG.GWVDFVRGNNLREQ.....D.VCLLQPM...DKGegr..RFTVIV------hl..........
Ov1_EMT01422 ....S.....G.E.....LRFAR.GWKEFLSDNRIGYG.....Y.LLVFRYD...GQS.....QFSVTVFLPSSC............
Ov1_EMT07265 ....T.....G.D.....RRIVS.GWKQFAQDNNLKMG.....D.ICLFELL...SNQkr...TMEVYIIP----atdyny......
Ov1_EMT26150 ....S.....Q.S.....YVLTK.GWSRFVKETGLRAG.....D.TVAFYRS...---.....------------ayg.........
Ov1_EMT08925 ....S.....S.R.....GFRGQ.PWAKFVRENELREG.....D.VCVFELI...K--.....------------g...........
Ov1_EMT28357 ....A.....D.E.....LFFMP.GWVEFAKAHELQEN.....D.LLLFTCS...GNG.....SFDVLIFDASGC............
Ov1_EMT26093 ....S.....G.E.....LCFAR.GWKEFLSDHRVGYG.....Y.LLVFRYD...GQS.....QFSVTVFLPSSC............
Ov1_EMT11663 ....M.....N.R.....TILKS.GWASFVDANKIEEN.....Y.SLMFHYL...GNA.....RFKVTIFDSSG-kqk.........
Ov1_EMT08965 ....P.....D.K.....LVLQA.GWGTFVKTYDLHMD.....D.CVVFRYK...GNS.....QFDVIVFD----r...........
Ov1_EMT00295 ....S.....G.E.....LCFAR.GWKEFLCDHCIVYG.....Y.LLVFRYD...GNS.....QFSVTVFSPSSC............
Ov1_EMT12198 ....N.....D.C.....KNLRR.GWRQFVEDHKLKIG.....D.ICLFKLLsi.QSR.....TMEVYIIRA---n...........
Ov1_EMT17386 ....Dgact.R.S.....CILAA.GWLDFVRDNNLREG.....D.ICAFEVS...KDH.....------------drviitvh....
Ov1_EMT32040 ....M.....N.R.....TILKS.GWASFVDANKIEEN.....Y.SLMFRYL...ENA.....RFKVTIFDSSG-kqk.........
Ov1_EMT15473 ....S.....Q.S.....YVLTK.GWSRFVKEKGLHAG.....D.AVGFYRS...SSG.....NNQLFIEC----k...........
Ov1_EMT20366 ....L.....N.K.....IVLGS.GWGVFVRFYELKAG.....Y.FLVFRYI...GDS.....HFKVLIFDFASC............
Ov1_EMT11662 ....M.....N.R.....TILKS.GWSSFVDANQIEEN.....Y.SLMFRYL...GNA.....RFEVTIFDSNG-ke..........
Ov1_EMT05921 ....D.....G.S.....CMLSV.GWSCFVLHNELRES.....D.ICLFEVS...KNDgev..TMVV--------hs..........
Ov1_EMT18170 ....G.....NiG.....YVLYG.RWLEFVRDNRLREG.....D.ICLLQPI...NRG.....------------egrrfml.....
Ov1_EMT04827 ....N.....E.T.....VLRRR.GWQAFVDAHGVEEN.....D.SLLFRHI...EKS.....CFEVLVLDSDDC............
Ov1_EMT13220 ....S.....D.Q.....ARMKA.GWGHFSGHHGIKVG.....D.LCVFHLV...DEH.....TFNVSIRR----a...........
Ov1_EMT24022 ....S.....S.S.....--LVA.GWSEFAVDNELVEG.....D.CLVFQLI...KRA.....LFK---------ytsrc.......
Ov1_EMT20366 ....D.....G.S.....GMLSA.GWSCFVLHNELRES.....D.VCVFEVSksaGEM.....TMVVH-------sl..........
Ov1_EMT20365 ....D.....G.S.....RMLSV.GWSCFVLHNELRES.....D.ICLFEVS...KNDgev..T-----------mvvh........
Ov1_EMT05921 ....Smmr..I.Q.....GFSYR.SWTKFVSDNGLQEG.....H.VCVFELM...KGVcea..TMMVHVFR----............
Ov1_EMT12928 ....G.....R.H.....YYFHK.GWRGFAAHHDLAVG.....D.CLVFHMT...ERA.....KF----------k...........
Ov1_EMT28125 ....Q.....E.K.....HVLKV.GWPQFVENFHLQLG.....D.SLLFRYN...GDS.....LFSIVIFD----k...........
Ov1_EMT07265 ....Q.....E.K.....LVFTV.GWRQFVGNYDLQMG.....D.SLIFKYN...RNS.....QFEVIIFD----............
Ov1_EMT01685 ....S.....D.GtctlsCILTA.GWLGFVRDNNLREG.....D.ICAFEVS...KND.....------------srvmit......
Ov1_EMT05921 ....L.....N.K.....IVLGS.GWGVFVSFYKLKAG.....Y.FLVFRYI...RDS.....HFKVLIFDFGTC............
Ov1_EMT17387 ....E.....N.G.....LIFQS.GWAEFARTYELVQG.....D.ILLFESS...GSS.....CFEVRIFNQTGC............
Ov1_EMT12198 ....Q.....E.N.....LVLTV.GWRQFVENYDLQMD.....D.SLIFRYK...GNS.....QFSVMIFD----k...........
Ov1_EMT07265 ....K.....E.K.....LVLTV.GWGKFVETFGLEMG.....D.TIVFRYN...GNS.....QFSVIIFDKLGCekal........
Ov1_EMT13166 ....L.....K.T.....KRLDA.DWMDFAVDNRLQVN.....D.ACVFELV...TGTreev.VFQV--------qi..........
Ov1_EMT09782 ....G.....N.A.....KMLKG.GWREFAHDNHLKLK.....D.ICLFQLMtdqRKL.....TMMVDIIRH---n...........
Ov1_EMT15692 ....Q.....S.D.....VLYGE.VWAEFLTAHDLSQG.....N.ILLFRYE...VNM.....SFSVQVFLPNGCmkeyp.......
Ov1_EMT32039 ....M.....N.R.....TILKS.GWATFVDANQIEEN.....Y.SLMFRYL...GNA.....RFEVTIFDSNG-ke..........
Ov1_EMT33019 ...nS.....N.Q.....RWLTT.GWNKFVTDNGLKKG.....D.ACLFQPD...KS-.....------------nnt.........
Ov1_EMT00181 ....H.....G.A.....--IGS.GWNLFAIGHKLADG.....D.CLVFQQV...QRT.....KFKV--------r...........
Ov1_EMT06474 ....G.....D.A.....KMLRG.GWREFAHDNHLKLK.....D.ICLFQLMtdqRKL.....TMMVDIIRH---n...........
Ov1_EMT17386 ..dkG.....K.C.....YALQT.GWKKFVDDNKLQDD.....D.MCLFELL...KNEel...TMNVHIIR----............
Ov1_EMT20365 ....L.....D.K.....IVLGS.GWGVFISFYEVKEG.....N.FLVFRYM...GDS.....HFKVLIFDFGSC............
Ov1_EMT04827 ....Kdrc..G.H.....VLTGS.RWVGFLRDNGVQEG.....D.LCVFQPV...QGTgtrs.KFTVH-------ll..........
Ov1_EMT04828 ....G.....G.G.....RALAH.GWRGFARDNRLRVQ.....D.VCLFQPM...EKNrqsl.TMTVHIIRH---s...........
Ov1_EMT27675 ...nK.....S.R.....MYILD.STSEFVKTHGLQAG.....D.ALII---...---.....------------yk..........
Ov1_EMT18170 ....M.....N.R.....SVLQS.GWEAFVHANQIQDN.....S.YLMFRNL...GIS.....CFKVTIFDSN--............
Ov1_EMT20365 ....Si....F.R.....GFCNS.PWTKFVHDNKLREG.....H.ICVFELI...KGVpka..MMIVHVFR----............
Ov1_EMT30739 ....D.....R.A.....LRIRG.GWTSFARDNNLREG.....D.ICLFELM...KNKvglk.KMMVYIIRRERC............
Ov1_EMT02182 ...nN.....S.R.....MYVLE.GVTPCIQSMHLQAG.....D.T------...---.....------------............
Ov1_EMT33420 ....V.....N.R.....TVLLS.GWEAFVDANQIQEN.....N.SLMFRYI...GFS.....CFKVAVFDSNG-eer.........
Ov1_EMT04828 ....N.....E.T.....VLRRR.GWEAFVDAHSIEEN.....D.SLLFRHI...EKS.....RFEVLVLDSDDC............
Ov1_EMT26160 ....S.....G.S.....--IGT.GWKMFAISHNLADG.....D.CLVFQQV...QKT.....KFKVYIIRA---s...........
Ov1_EMT17385 ....A.....N.E.....LFLRS.GWGGFAKAHELQEN.....D.LLLFTCT...GNA.....SFEVLIFDPSGC............
Ov1_EMT20366 ....E.....K.Q.....GFSYS.SWTKFVRDNKLREG.....H.VCVFELI...KGVska..MMIVHV------f...........
Ov1_EMT26088 ....S.....G.K.....RWIRR.GWKDFVTENKVREG.....D.ICLFERG...ESTkkl..RMMVYFIR----r...........
Ov1_EMT22877 ....D.....G.H.....MYLGR.GWEQFARAHDLRLG.....Y.ILLFSFD...GDA.....VLTVKVFDVSMC............
Ov1_EMT32415 ....R.....H.I.....QRLEA.GWRSFALDNALRLG.....D.GCVFELV...GCDgegi.VFRVQVLR----............
Ov1_EMT08965 ....P.....Q.N.....NRVVG.GWVKFAKENGLRPG.....D.VCLLERLrhcKEC.....TMKVHIVR----rv..........
Ov1_EMT09249 ....G.....N.D.....LVFQS.GWETFASAYELEQG.....D.ILLFEYS...GSS.....RFDVRIFDQSCC............
Ov1_EMT02000 ....M.....N.R.....IILKF.GWAAFLDANEIEEN.....Y.SLMFRYL...GNS.....LFEVTIFDSN--............
Ov1_EMT26998 ....D.....D.Q.....IVLQY.GWKNLVDANRIQEN.....D.LLIFITK...GKK.....RLEVRILG----t...........
Ov1_EMT09780 ....D.....NcR.....GFCGR.GWRDFARHNGLLAH.....D.ICIFEFM...EDA.....R-----------rpaanvhvl...
Ov1_EMT08925 ....D.....D.T.....YHLSA.GWLRFVDDNQLQKG.....D.TCVFEVLkrqRSF.....TMAVHLL-----ka..........
Ov1_EMT12525 .vrgK.....A.R.....TSFRY.GWHQFCVDNHLRVG.....E.TCFFRAL...GQG.....------------ggdrhvlkvevr
Ov1_EMT23566 ....Ec....G.D.....MHLGR.GWKEFVRANGVELG.....Q.LLVFCYD...GAGaa...LLTVKVFDDSEC............
Ov1_EMT23566 ...rKgnar.T.R.....TALRY.GWNRFRVDNGLRVG.....D.ICFFQLV...Q--.....------------d...........
Ov1_EMT04827 ....N.....G.G.....RTLAQ.GWCGFARDNRLRVQ.....D.VCLFQPM...EKNhesl.TMTVHIIRH---s...........
Ov1_EMT22877 .aggK.....T.R.....SSFRY.GWHQFLVDNRLTVG.....D.TCFFRAL...RGGedh..ELKVQV------rk..........
Ov1_EMT26088 ....D.....D.Q.....TVLQY.GWNNLVDANRIQEN.....D.LLVFIIK...GKK.....RLEVRILG----t...........
Ov1_EMT01811 ....K.....D.N.....CMLAG.NWLDFVCDNQVQAG.....D.ICIFVPAmggERS.....TFTVHIIR----a...........
Ov1_EMT26046 ....K.....Q.G.....--LSA.GWRGFAINHDIKV-.....-.-------...---.....------------............
Ov1_EMT01685 ....E.....N.G.....LVFQS.GWAEFARTYELVQG.....T.ILLFESS...GSS.....CFEVRMFNQTGC............
Ov1_EMT01999 ....E.....G.H.....IYLGR.GWEQFAGAHDLRLG.....H.FLVLSYG...GCHaha..MLTVKVFDGSMC............
Ov1_EMT28635 ....-.....G.R.....ITLTT.GWRGFVDANHIEEN.....N.PMLFVYR...GNS.....TFKVQIFNS---s...........
Ov1_EMT06472 ....A.....G.A.....MRIRA.GWTSFASDNNLREG.....D.ICLFELM...KNE.....------------gglkkmvvy...
Ov1_EMT11663 ....T.....D.R.....MRICK.GWVAFVRGNRLRVG.....D.LCLFKLM...ESEepl..KMMVYIIR----............
Ov1_EMT25672 ....N.....N.R.....PMIVK.GWTSFARDNRLQVD.....D.LCLFKLM...RNEetl..KMMVYIIRRKKC............
Ov1_EMT21044 ....V.....D.R.....TSILK.GWASFARGNRLREG.....D.LCLFKLM...ESVepl..KMMVYIIRREKC............
Ov1_EMT20151 ....N.....K.T.....WWIDR.SWPKFISDVGLEED.....D.ICLFELT...DRSsl...TMKVHVIRKS--dip.........
Ov1_EMT00295 ....Ggec..P.R.....AAFSA.GWGALAMENYLENR.....D.LCVFELL...DDDy....NIKLHVYR----............
Ov1_EMT31520 .gtrR.....S.Y.....NCLTR.GWKAFCKENELKAG.....D.ICTFKVV...NST.....LWHVVID-----r...........
Ov1_EMT18170 ....P.....D.G.....RGRNL.SLREFVHDNRVKKG.....D.LCLFQPM...TEVqstrfTFMVHLL-----r...........
Ov1_EMT20151 ....F.....G.D.....IVLRS.GWHDFVEAHHIEQN.....Y.SIRFVYR...GNS.....SFEVHISGS---s...........
Ov1_EMT13199 ....D.....G.S.....LAFYQ.GWSNFVSDHSIKWA.....E.IILFEYT...GCS.....KFSVRVFGA---d...........
Ov1_EMT14114 ....K.....Q.G.....--LSG.GWRGFAINHDIKV-.....-.-------...---.....------------............
Ov1_EMT28355 ....Rv....T.R.....GFNSR.RWNKFVRDNMLREG.....Y.VCIFELM...KGArka..TMTVHVLR----............
Ov1_EMT14307 ...tGgr...P.R.....AWFRY.GWHQFCVDNSLGEG.....D.TCFFRA-...---.....------------i...........
Ov1_EMT33385 ....G.....A.T.....RSLSR.DWQDLVHEKGVKVR.....D.IIVFVRC...PDG.....RILVDLRR----a...........
Ov1_EMT30659 ....E.....D.Q.....IVLQS.GWDRFVTSQRIQQN.....D.LLIFIIE...GGT.....RLKVLVLDPS--g...........
Ov1_EMT28125 ....E.....E.Q.....LVLAA.GWGSFVQKFRLEMG.....DrIILFGYN...GNS.....WFSVIILD----............
Ov1_EMT13199 ....S.....L.F.....VGFTG.GWKSFVAANKLEAG.....D.LCVLLMD...---.....------------ldedelvydv..
Ov1_EMT28635 ....E.....D.Q.....IVLQS.GWHRFVASQCIQQN.....D.FLIFIIE...GEA.....RLKVLVLDPS--g...........
Ov1_EMT26998 ..dkN.....G.M.....RWIRG.GWKRFVAENDVQEG.....D.IALFERA...KSTkel..RMTVYF------vrk.........
Ov1_EMT02000 ..gtSda...G.R.....RNLSL.G--NFVRDNHVREG.....D.ICLFEPM...TNAkekrfTMTV--------hlv.........
Ov1_EMT06472 ....G.....G.R.....CNLKE.--CGFARDNHLLEG.....D.LCVFQPMmnrKGR.....TFKVMV------hllrkasi....
Ov1_EMT01999 ....L.....R.G.....SRVLK.GWPSFARDNQLREG.....D.LCLFKLL...KSEell..TMMVYI------vr..........
Ov1_EMT05389 .ptgR.....P.R.....TSLRY.GWQQFRVDNRLRVG.....E.TCFFRAL...---.....------------pgdddgdhhvlk
Ov1_EMT08502 ....Gec...P.H.....AVLSA.GWGTLAMENNLEKW.....D.MCVFELL...DQ-.....------------eyniklhi....
Ov1_EMT01554 .gtrK.....A.T.....NRLVT.GWPKFCKENGLKAG.....D.TCTFKVV...DST.....LWHVVID-----r...........
Ov1_EMT32039 mrasS.....Q.Q.....MRVIK.GWPSFARDNRLREG.....D.LCLFKLM...ENEeql..TMMVYIIRREKC............
Ov1_EMT30659 ....N.....G.G.....RRIYG.GWRGLVSQAGMEAG.....D.ICLVELV...DRSserl.TMTVYLICK---s...........
Ov1_EMT07124 ....T.....K.L.....KRLDQ.GWADFAVQNRLQVG.....D.ACVFELV...---.....------------s...........
Ov1_EMT01422 ....Ggec..P.R.....AAFSA.GWGALAMENNLEKW.....D.VCVFELL...D--.....------------qe..........
Ov1_EMT11662 ....Gstda.G.R.....RNLSL.G--DFVGDNLVREG.....D.ICLFEPM...TNTkqkrfTMTVHILG----kls.........
Ov1_EMT26998 ....A.....G.E.....LVLQS.AWDKFVAMHHIEEN.....Y.SFWFVCP...GNS.....TFKVHIFNPNG-............
Ov1_EMT32039 ....Gstda.G.R.....RNLSL.G--DFVGDNLVREG.....D.ICLFEPM...TNTkqkrfTMTVHILD----klsi........
Ov1_EMT27996 ....N.....D.H.....MYLCR.GWEQFIRAYDPRHR.....Y.FLVFRYD...GDA.....MLTMKA------ir..........
Ov1_EMT14989 ....T.....K.L.....KRLDQ.GWEDFAVHNRLQVG.....D.ACVFELV...---.....------------s...........
Ov1_EMT25672 ..gvH.....N.P.....GRRSL.YWRLFAVDNHVREG.....D.ICLFQPM...TND.....K-----------hrtfivi.....
Ov1_EMT32373 ....H.....G.A.....--IGS.GWNLFAIGHKLADG.....D.CLVFQQV...QRT.....K-----------f...........
Ov1_EMT18170 ....H.....R.R.....MVPAG.GWREFAADNRLQAG.....D.LCLLEPV...ADKrl...AMAVHIIRREQC............
Ov1_EMT04828 ....Ksqc..G.H.....VLTGS.RWVGFLRDNGVREG.....D.LCVFQPV...KGTgtrs.KFTVH-------l...........
Ov1_EMT06722 ....N.....G.R.....VTLDQ.GWATYAVVHQIKIG.....Y.MVMFKLL...TPD.....TLKVIIFD----dd..........
Ov1_EMT15692 ...pD.....G.Gva...CWLGA.GWPEIVRKNGIGEG.....W.SVVLRRE...RRG.....MATLTAFDPACC............
Ov1_EMT01571 ....N.....G.A.....YRFIG.DWGDFVTEHGMQIH.....-.-------...---.....------------vdvelwafrsps
Ov1_EMT11111 ....G.....N.-.....-----.---------NVKHD.....S.-------...---.....------------fcllnfppvkvs
Ov1_EMT11662 mrasS.....Q.Q.....MRVIK.GWPSFARDNRLREG.....G.LCLFKLM...ENEeql..TMMVYIIRREKC............
Ov1_EMT18852 ....D.....G.R.....LCLQK.GWKEFVTDSGLMSE.....Q.VVVLNF-...---.....------------feledrtvr...
Ov1_EMT01999 ..gtSdag..R.Rn....LFL--.--YNFAYDNHIREG.....D.ICLFQPI...TNVkqr..TFIVT-------vhvlh.......
Ov1_EMT02000 ..htT.....H.A.....MRVLK.GWTFFARDNRLREG.....D.LCLFKLI...KNKepl..TMVIHIIR----r...........
Ov1_EMT17386 ....Q.....D.K.....FILRS.GWVDF---------.....-.-------...---.....------------t...........
Ov1_EMT08764 ....T.....D.H.....TAIVE.GWASFAGGNRLQEG.....D.ICLFKLM...ESEepl..KMMVYIIRAEEC............
Ov1_EMT28356 ....-.....-.-.....GFNCR.RWSKFVRDNRLREG.....Y.VCVFELM...KGTrka..TMTVHVLR----............
Ov1_EMT33420 ...gG.....H.N.....LYL--.--RDFVPDNHVQEG.....D.LCLFQPI...TE-.....------------veatnfaimvh.
Ov1_EMT25863 ....D.....G.R.....IVFNQ.AWGVFVAQNHLQVN.....D.AVVFNF-...---.....------------r...........
Ov1_EMT02831 ....P.....T.F.....SGFVA.GWADVRAENGLREG.....D.ACELELR...RG-.....------------sy..........
Ov1_EMT33847 ...nG.....G.Y.....RFIGP.GWKDFVAENKL---.....-.-------...---.....------------le..........
Ov1_EMT32040 ....-.....-.R.....HNLYL.GY--FVRENCVQEG.....D.ICLFQPIakaKER.....RFTVT-------v...........
Ov1_EMT18693 .nnnS.....N.R.....WMLVS.GWGDFMRGNEVREGglvdgD.MLLFELK...---.....------------smnek.......
Ov1_EMT28635 ....N.....N.V.....RRICS.FWQDIVSQAGTKEG.....D.ILLVELA...GRSsrrl.RMTVHLIRKS--e...........
Ov1_EMT11663 ....R.....R.N.....LYL--.G--YFVHDNCVQEG.....D.ICLFQPIakvKEG.....RFTVI-------v...........
Ov1_EMT21044 ....SgmvgaG.R.....RNLYL.--GSFVHDNCVQEG.....D.ICLFQPL...---.....------------akvkeekftvi.
Ov1_EMT33420 ....D.....R.R.....MLPGG.GWHEFAADNRLQAG.....D.LCLLEPV...KGEvl...AMSVHIIR----r...........
Ov1_EMT20151 ....D.....D.Q.....VILQS.GLSHFVDGHRMQDN.....D.LLVFRSK...GKA.....RLEVLVLDPSGCek..........
Ov1_EMT31520 ....A.....K.G.....AFLGD.GWPQFVAAHGIGVG.....W.YLVIRHE...GCG.....VLTLKAFN----a...........
Ov1_EMT15692 ....Nt....Y.G.....YLTGK.GWKRFCRDNECEQ-.....-.-------...---.....------------nivpvf......
Ov1_EMT25624 ....N.....G.A.....YRLIA.GWGKFLKANNLH--.....-.-------...---.....------------v...........
Ov1_EMT14307 ....-.....-.-.....MYLGR.GWEQFTRAHDLRLR.....Y.FLVFTFD...GDA.....VLTLKVFDVSMCqrhy........
Ov1_EMT25671 ..gtSda...G.R.....RNLSL.G--NFVHDNHVREG.....D.IYLFEPM...ANA.....------------kqkrftmiahl.
Ov1_EMT08426 ....Nm....T.Y.....RIIGR.GWREFVRDCRISHG.....D.RV-----...---.....------------diyvg.......
Ov1_EMT30738 ....K.....G.A.....LRISG.GWTSFASENGL---.....-.-------...---.....------------t...........
Ov1_EMT32507 ....A.....G.F.....MFLAR.GWKPFARSDDLRRG.....Q.VLQFRYD...GAA.....TLFVKFFRV---s...........
Ov1_EMT02333 ....-.....-.-.....---RK.DWKKLIEDAGMKAG.....D.ICLFQVV...DRSssgl.TMMVHMIRKS--em..........
Ov1_EMT04013 ....S.....N.Ray...RVVGS.DWRRLVEESHMCKG.....D.RLDMYACrr.GDG.....ERCLFVFRSK--g...........
Ov1_EMT20145 ....D.....G.R.....MVFNK.EWGVFVSTYNLQVG.....S.AAVFTFS...RS-.....------------naap........
Ov1_EMT15081 ....D.....-.-.....-----.--------------.....-.-------...---.....------------d...........
Ov1_EMT01422 ....-.....-.-.....-----.--------------.....-.-------...---.....------------t...........
Ov1_EMT25849 ...nG.....G.Y.....RFIGT.GWNDFVSKNKLVKD.....D.-------...---.....------------............
Ov1_EMT08500 ....-.....-.-.....-----.--------------.....-.-------...---.....------------vi..........
Ov1_EMT01554 ....A.....K.G.....LCWGD.GWPQFVAAHGIGVG.....C.YLVFKHV...LRG.....TVTLKVF-----d...........
Ov1_EMT18234 ....S.....KvY.....RVIGF.DWRRLVEENRMCKG.....D.RLDFYTCrr.GDG.....DRCLFVF-----rsk.........
Ov1_EMT31520 ....P.....N.V.....FFTGS.EWPKFLAYFEIAET.....D.VLLIKYQ...GCM.....NFSF--------etf.........
Ov1_EMT08528 ....D.....K.R.....ATITK.GWSDFFRRTHMNEG.....Q.AYAFGF-...---.....------------kctsk.......
Ov1_EMT15116 ....-.....-.-.....-----.--------------.....-.-------...---.....------------stt.........
Ov1_EMT11222 tndtN.....R.T.....YFGCP.GWKALANAYKMEAG.....E.RATFYLD...---.....------------ydrd........
Ov1_EMT28357 ....-.....-.-.....-----.--------------.....-.-------...---.....------------y...........
Ov1_EMT08188 ....D.....R.T.....YFGCS.NWGAFAKAYKFEEG.....M.AIHFDF-...---.....------------sk..........
Ov1_EMT30738 ....-.....-.-.....-----.--------------.....-.-------...---.....------------f...........
Ov1_EMT28753 ....H.....R.R.....TCICGvGWEDFIRLNNLSEG.....V.LLRFVLD...R--.....------------p...........


                                                                   
                                                                   
d1yela1      ......................................................
Ov1_EMT32630 sdsmhigllaaaaha.......................................
Ov1_EMT04282 ssdsmhigllaaaaha......................................
Ov1_EMT18418 fnsnsskihtlsavanslkhrsvfhic...........................
Ov1_EMT01567 ssdsmhigilaaaaha......................................
Ov1_EMT19609 sdsmhigilaaaaha.......................................
Ov1_EMT31390 ltkvtgfrdeksqllvgvrratnqqtalsssvlstdsmhigvlaaaaha.....
Ov1_EMT09779 isshsmhlgvlatawha.....................................
Ov1_EMT17168 isshsmhlgvlatawha.....................................
Ov1_EMT16165 ......................................................
Ov1_EMT31591 issqsmhlgvlasasha.....................................
Ov1_EMT27817 anrtqtvmpssvlssdsmhigllaaaaha.........................
Ov1_EMT06148 ......................................................
Ov1_EMT06147 ......................................................
Ov1_EMT31332 ......................................................
Ov1_EMT25952 ......................................................
Ov1_EMT08561 ......................................................
Ov1_EMT22525 ......................................................
Ov1_EMT09996 ......................................................
Ov1_EMT23005 ......................................................
Ov1_EMT27061 isshsmhlgvlatasha.....................................
Ov1_EMT29229 ......................................................
Ov1_EMT21501 ......................................................
Ov1_EMT29641 ......................................................
Ov1_EMT32462 sdsmhigvlaaaaha.......................................
Ov1_EMT19909 ......................................................
Ov1_EMT13106 ......................................................
Ov1_EMT05021 ......................................................
Ov1_EMT28380 ......................................................
Ov1_EMT09780 ......................................................
Ov1_EMT12434 lysq..................................................
Ov1_EMT19908 ......................................................
Ov1_EMT01685 ......................................................
Ov1_EMT07173 ......................................................
Ov1_EMT13220 ......................................................
Ov1_EMT09213 ......................................................
Ov1_EMT12994 ......................................................
Ov1_EMT17387 ......................................................
Ov1_EMT06248 ......................................................
Ov1_EMT26018 ......................................................
Ov1_EMT20130 ......................................................
Ov1_EMT05921 ......................................................
Ov1_EMT08925 ......................................................
Ov1_EMT28380 ......................................................
Ov1_EMT17385 ......................................................
Ov1_EMT10769 ......................................................
Ov1_EMT30739 ......................................................
Ov1_EMT06472 ......................................................
Ov1_EMT12716 ......................................................
Ov1_EMT20366 ......................................................
Ov1_EMT28479 ......................................................
Ov1_EMT25279 ......................................................
Ov1_EMT09781 ......................................................
Ov1_EMT23621 ......................................................
Ov1_EMT12198 ......................................................
Ov1_EMT25326 ......................................................
Ov1_EMT28355 ......................................................
Ov1_EMT20365 ......................................................
Ov1_EMT19909 ......................................................
Ov1_EMT09782 ......................................................
Ov1_EMT26093 ......................................................
Ov1_EMT08925 ......................................................
Ov1_EMT12830 ......................................................
Ov1_EMT09782 ......................................................
Ov1_EMT23621 ......................................................
Ov1_EMT06404 ......................................................
Ov1_EMT19908 ......................................................
Ov1_EMT02831 ......................................................
Ov1_EMT06404 ......................................................
Ov1_EMT09781 ......................................................
Ov1_EMT01685 ......................................................
Ov1_EMT25326 ......................................................
Ov1_EMT08965 ......................................................
Ov1_EMT26018 ......................................................
Ov1_EMT08925 ......................................................
Ov1_EMT33420 ......................................................
Ov1_EMT01422 ......................................................
Ov1_EMT07265 ......................................................
Ov1_EMT26150 ......................................................
Ov1_EMT08925 ......................................................
Ov1_EMT28357 ......................................................
Ov1_EMT26093 ......................................................
Ov1_EMT11663 ......................................................
Ov1_EMT08965 ......................................................
Ov1_EMT00295 ......................................................
Ov1_EMT12198 ......................................................
Ov1_EMT17386 ......................................................
Ov1_EMT32040 ......................................................
Ov1_EMT15473 ......................................................
Ov1_EMT20366 ......................................................
Ov1_EMT11662 ......................................................
Ov1_EMT05921 ......................................................
Ov1_EMT18170 ......................................................
Ov1_EMT04827 ......................................................
Ov1_EMT13220 ......................................................
Ov1_EMT24022 ......................................................
Ov1_EMT20366 ......................................................
Ov1_EMT20365 ......................................................
Ov1_EMT05921 ......................................................
Ov1_EMT12928 ......................................................
Ov1_EMT28125 ......................................................
Ov1_EMT07265 ......................................................
Ov1_EMT01685 ......................................................
Ov1_EMT05921 ......................................................
Ov1_EMT17387 ......................................................
Ov1_EMT12198 ......................................................
Ov1_EMT07265 ......................................................
Ov1_EMT13166 ......................................................
Ov1_EMT09782 ......................................................
Ov1_EMT15692 ......................................................
Ov1_EMT32039 ......................................................
Ov1_EMT33019 ......................................................
Ov1_EMT00181 ......................................................
Ov1_EMT06474 ......................................................
Ov1_EMT17386 ......................................................
Ov1_EMT20365 ......................................................
Ov1_EMT04827 ......................................................
Ov1_EMT04828 ......................................................
Ov1_EMT27675 ......................................................
Ov1_EMT18170 ......................................................
Ov1_EMT20365 ......................................................
Ov1_EMT30739 ......................................................
Ov1_EMT02182 ......................................................
Ov1_EMT33420 ......................................................
Ov1_EMT04828 ......................................................
Ov1_EMT26160 ......................................................
Ov1_EMT17385 ......................................................
Ov1_EMT20366 ......................................................
Ov1_EMT26088 ......................................................
Ov1_EMT22877 ......................................................
Ov1_EMT32415 ......................................................
Ov1_EMT08965 ......................................................
Ov1_EMT09249 ......................................................
Ov1_EMT02000 ......................................................
Ov1_EMT26998 ......................................................
Ov1_EMT09780 ......................................................
Ov1_EMT08925 ......................................................
Ov1_EMT12525 ......................................................
Ov1_EMT23566 ......................................................
Ov1_EMT23566 ......................................................
Ov1_EMT04827 ......................................................
Ov1_EMT22877 ......................................................
Ov1_EMT26088 ......................................................
Ov1_EMT01811 ......................................................
Ov1_EMT26046 ......................................................
Ov1_EMT01685 ......................................................
Ov1_EMT01999 ......................................................
Ov1_EMT28635 ......................................................
Ov1_EMT06472 ......................................................
Ov1_EMT11663 ......................................................
Ov1_EMT25672 ......................................................
Ov1_EMT21044 ......................................................
Ov1_EMT20151 ......................................................
Ov1_EMT00295 ......................................................
Ov1_EMT31520 ......................................................
Ov1_EMT18170 ......................................................
Ov1_EMT20151 ......................................................
Ov1_EMT13199 ......................................................
Ov1_EMT14114 ......................................................
Ov1_EMT28355 ......................................................
Ov1_EMT14307 ......................................................
Ov1_EMT33385 ......................................................
Ov1_EMT30659 ......................................................
Ov1_EMT28125 ......................................................
Ov1_EMT13199 ......................................................
Ov1_EMT28635 ......................................................
Ov1_EMT26998 ......................................................
Ov1_EMT02000 ......................................................
Ov1_EMT06472 ......................................................
Ov1_EMT01999 ......................................................
Ov1_EMT05389 ve....................................................
Ov1_EMT08502 ......................................................
Ov1_EMT01554 ......................................................
Ov1_EMT32039 ......................................................
Ov1_EMT30659 ......................................................
Ov1_EMT07124 ......................................................
Ov1_EMT01422 ......................................................
Ov1_EMT11662 ......................................................
Ov1_EMT26998 ......................................................
Ov1_EMT32039 ......................................................
Ov1_EMT27996 ......................................................
Ov1_EMT14989 ......................................................
Ov1_EMT25672 ......................................................
Ov1_EMT32373 ......................................................
Ov1_EMT18170 ......................................................
Ov1_EMT04828 ......................................................
Ov1_EMT06722 ......................................................
Ov1_EMT15692 ......................................................
Ov1_EMT01571 lpv...................................................
Ov1_EMT11111 qsgifslqagvslndnnqlllgirratrpqtvmpssvlssdsmhigllaaaaha
Ov1_EMT11662 ......................................................
Ov1_EMT18852 ......................................................
Ov1_EMT01999 ......................................................
Ov1_EMT02000 ......................................................
Ov1_EMT17386 ......................................................
Ov1_EMT08764 ......................................................
Ov1_EMT28356 ......................................................
Ov1_EMT33420 ......................................................
Ov1_EMT25863 ......................................................
Ov1_EMT02831 ......................................................
Ov1_EMT33847 ......................................................
Ov1_EMT32040 ......................................................
Ov1_EMT18693 ......................................................
Ov1_EMT28635 ......................................................
Ov1_EMT11663 ......................................................
Ov1_EMT21044 ......................................................
Ov1_EMT33420 ......................................................
Ov1_EMT20151 ......................................................
Ov1_EMT31520 ......................................................
Ov1_EMT15692 ......................................................
Ov1_EMT25624 ......................................................
Ov1_EMT14307 ......................................................
Ov1_EMT25671 ......................................................
Ov1_EMT08426 ......................................................
Ov1_EMT30738 ......................................................
Ov1_EMT32507 ......................................................
Ov1_EMT02333 ......................................................
Ov1_EMT04013 ......................................................
Ov1_EMT20145 ......................................................
Ov1_EMT15081 ......................................................
Ov1_EMT01422 ......................................................
Ov1_EMT25849 ......................................................
Ov1_EMT08500 ......................................................
Ov1_EMT01554 ......................................................
Ov1_EMT18234 ......................................................
Ov1_EMT31520 ......................................................
Ov1_EMT08528 ......................................................
Ov1_EMT15116 ......................................................
Ov1_EMT11222 ......................................................
Ov1_EMT28357 ......................................................
Ov1_EMT08188 ......................................................
Ov1_EMT30738 ......................................................
Ov1_EMT28753 ......................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0051290 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]