SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments in Arabidopsis thaliana 10

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1        ...................................................................................s-
AT1G30330.2  ...................................................................................l-
AT1G30330.1  ...................................................................................l-
AT5G37020.2  .................................................................................pie-
AT5G37020.1  .................................................................................pie-
AT1G19850.1  .................................................................................lrg-
AT1G19220.1  ..................................................................................lk-
AT1G59750.1  ...................................................................................v-
AT1G59750.3  ...................................................................................v-
AT1G59750.2  ...................................................................................v-
AT1G59750.4  ...................................................................................v-
AT2G33860.1  ..................................................................................vl-
AT5G20730.3  .................................................................................lkl-
AT5G20730.2  .................................................................................lkl-
AT5G20730.1  .................................................................................lkl-
AT5G60450.1  ...................................................................................k-
AT5G62000.4  ...................................................................................q-
AT5G62000.1  ...................................................................................q-
AT5G62000.2  ...................................................................................q-
AT5G62000.3  ...................................................................................q-
AT3G61830.1  .................................................................................ivg-
AT2G46530.2  .................................................................................ldp-
AT2G46530.1  .................................................................................ldp-
AT2G46530.3  .................................................................................ldp-
AT4G23980.1  .................................................................................lqr-
AT4G23980.2  .................................................................................lqr-
AT1G13260.1  ...................................................................................a-
AT1G25560.1  ...................................................................................l-
AT3G61970.1  ...................................................................................e-
AT1G68840.1  ..................................................................................ev-
AT1G68840.2  ..................................................................................ev-
AT3G25730.1  ...................................................................................l-
AT2G36080.2  ..................................................................................ea-
AT1G34310.1  ...................................................................................v-
AT5G06250.1  ...................................................................................s-
AT5G06250.2  ...................................................................................s-
AT2G36080.1  ..................................................................................ea-
AT1G34410.1  ...................................................................................v-
AT3G11580.2  ...................................................................................s-
AT3G11580.1  ...................................................................................s-
AT1G35540.1  ...................................................................................v-
AT2G46870.1  ..................................................................................re-
AT4G01500.1  ..................................................................................re-
AT1G35520.1  ...................................................................................n-
AT1G01030.1  ..................................................................................ke-
AT4G30080.1  .................................................................................ekt-
AT2G28350.1  .................................................................................ekp-
AT1G34390.1  ...................................................................................v-
AT1G35240.1  ...................................................................................v-
AT1G77850.1  ..................................................................................nn-
AT1G34170.2  ...................................................................................v-
AT1G34170.1  ...................................................................................v-
AT1G34170.3  ...................................................................................v-
AT1G51120.1  ...................................................................................q-
AT1G50680.1  ...................................................................................q-
AT5G42700.1  ....................lgsgypsfvksmlqshvsggfwlglpvqfckshlglhdgvitlideegeeyetiylarknglsg-
AT1G16640.1  ........................................................tgevqfmkpfisekssksleiplgfney-
AT4G31690.1  ...............................................ptnqhffqpllpgfqsnlkipvnyfsehiegkhegkt-
AT4G01580.1  ....................espvkkffklvlpstmkdkmmripprfvklqgsklsevvtlvtpagykrsiklkrigeeiwfhe-
AT5G58280.1  ...........................................................lksphpyfvksmvrshvyscfwlgl-
AT2G24690.1  ........................sekqfvtftlapvdgrhcrlrlpmqftrenginkpgkiylvgkdgskwlanlllennrgr-
AT1G43950.1  ...................................................................................n-
AT4G31680.1  ..........................................ptnkhffkpllpgfqrnlnipvkffsehiegkhegetvklra-
AT3G18960.1  ...................espvkkffklvlpstmkdkmmkipprfvklqgsklsevvtletpagfkrsiklkrigeeiwfheg-
AT4G31640.1  .................fspdltcfsqsvtasnltrdlvgiprdfakryglnigrheivlmdeegntwesevksyksgrvfiag-
AT3G19184.1  .......................................................ldseyasftkpmlqshvtggfwlglplpf-
AT3G53310.1  ........................yprffkvflvesaseslmiplpfmafladplpktvklqglggklwtvslkkisgaayltr-
AT3G26790.1  ...................................................................................f-
AT1G49480.1  .............................................................feptnpyfrvvlrpsylyrgcim-
AT3G24650.1  ..................................................................................ll-
AT4G31640.1  ..........................................pksphffqpilpgfkshikipvkffskhiegkhegntvylrs-
AT5G18000.1  ..................................................rdnpaffkilrredhstemmrmiphhlirsisdk-
AT3G18990.1  .............................................................feptnpffrvvlrpsylyrgcim-
AT2G24645.1  ....................pscfvanvapstlrydtlylpkrfmrengvdkrrgemilmnekgkswtldlklkkscgtslirr-
AT3G18990.1  ..................................rpffhklifsstiqekrlrvpdkfvskfkdelsvavaltvpdghvwrvgl-
AT4G00260.1  ................................rdpscfvanvapsslrydlmrfprgfvrdngvvgsgeivlmnekgrswnfnl-
AT1G26680.1  ..................shrsyfvgsvtassikkdklylwksfvssngldkgckkiilknkwgrewklvlkhyksncftiikr-
AT2G24690.1  ...................psqnctltvtitpdslehgrlrlplqfmtensmnkpgeitllgtdgakwmaslllekkgrmslgk-
AT4G00260.1  ..................qdpscfvanvspsslrydtlylpkrfmrengvdkrcgemilinekgkswtldlkvkkssgtslikr-
AT5G66980.1  .....................lqffkvflpefgshelvippafidmlekplpkeaflvdeigrlwcvetktedteerfcvfftk-
AT4G34400.1  .........................prfftvfvshfssefmvipvsyydhiphrfpktvilrgpggcswkvateikddevlfsq-
AT2G24700.1  ...................................cfvatvtgsnlkrdtlyipkefalsnglmnkyqivlmneegeswkidlr-
AT3G06220.1  ...............................prfytvflscvssnslliprsyyehlprrlpktailtgtggrvwkvammskre-
AT4G31680.1  ......................................sadlncfsqsvthsnisndlvtlprdfakrngldkgmheivlmnee-
AT5G60130.2  .........................ldncvpkffkvylpdesgddmvlpisftrflpkslpetvtvrsisgniwklelkkccgd-
AT2G35310.1  ...............kresffkvlqrvdissenmralpydfvrsfsnnelsrkmkikarwgssweveicknprfyfmeksgwek-
AT4G33280.1  ..................................................................fqtlhftqlllpgfhnrl-
AT3G06160.1  ...............................lprfftvflshcssesmviprsyynllprplpktailigtggrfwkvamtskq-
AT5G09780.1  ........................................kqesffkvlkrsdmssedtraipydfvinfsdnelsgdmkfrvq-
AT1G49475.1  .....................eptvkkfikiillsriiekmmkvparfvrfgpkltdnvtlqtpvgfkrsirikrigdevwfek-
AT3G06160.2  ...............................lprfftvflshcssesmviprsyynllprplpktailigtggrfwkvamtskq-
AT4G31690.1  ......................................sssdlncfsqsvthsnisrdavsvprdfvkrsgfskgrheivlmne-
AT2G24650.1  ...................................sqkhfvtltitpssikkdrlilspqfarknnidkpgmiylldtdgtkwl-
AT2G24645.1  ....................scfsanvapsslrydlmlfpmgfvrengvvgsgkivlmnekgrswnfnlrqkpscgtvyvrggw-
AT2G24650.1  .......................qfvtftitptcvgknrlilsaqfarenninqpgtiylldtdgrkwlttvkrdkkgtmslgk-
AT4G31615.1  ...........................................ssknyylvahvtpsnlsrdrlylikafarsnglnercceid-
AT2G24700.1  .............................sspdlssfvatvtasnlsrdrlylpktfimsngllkkfqmclmneegeswtidvk-
AT4G31620.1  ............................qnkfltvtlkhymiqsgqlrlrrsfvrengikeaeeiilvdkngvewpsyvssskq-
AT1G26680.1  ....................sdhscfegsvtpsslrndllylprsfvnsnrldkrcseivlkneqgvkwplvlkrfksvtylpk-
AT4G32010.1  ..................................................................................ip-
AT2G24680.1  ................ssdnscfvalvtasnlrkdalylpqdltssvglerkyreivvtdererrswaldlrfnkssdtfyisr-
AT3G17010.1  ...................................rqmlsffkifqradlssdcmralpysfiskvsekdfsykmviraqwgkt-
AT2G24680.2  ................ssdnscfvalvtasnlrkdalylpqdltssvglerkyreivvtdererrswaldlrfnkssdtfyisr-
AT5G60142.1  ........................................ddclpkffkvylpddsgddlelpisfnsflpkslpknvivrsiy-
AT4G31630.1  ..............................................sssdksylvahvtpssllrdnmcvlskfarsngldrre-
AT5G57720.1  .................................pypdflkifnshedsqllviprsynryypnplpqtavlknpegrfwnvqwt-
AT2G24690.1  ...................sdvknrfltltlapedvkdgnlhlpcqfmringinkpgqitllgrggmkwfayllsgdgtvvvgn-
AT4G31650.1  .............................................pksphffqpllpgfkshinipvkffskyikgkhegktvk-
AT4G31660.1  .........................................spknshffqpllpgfdsylnipvkffskriqgrnegrtvelrt-
AT4G21550.1  ..................................................................................tp-
AT2G24680.1  .....................iqnryvtltltpedvractlilpsqfmkanginklgkktllgqnrkkwfayllsksgfvalgs-
AT2G24650.1  ......................................mrlpkvftrenginkpgritllgkdgikqqtnllfdkangamslgh-
AT2G24680.2  .....................iqnryvtltltpedvractlilpsqfmkanginklgkktllgqnrkkwfayllsksgfvalgs-
AT5G18090.1  ...........................................vpeftltikksyliflgipkmfeelhmpteatmfkihdpeg-
AT1G26680.1  ..........................................sssdhssfvanvtasslnydrlylplsfvssngldkmngkei-
AT2G30470.1  ..................................................................................vp-
AT2G24645.1  ............................................nqhffkpllpgfhthlripvafflkniegryeqktaelrs-
AT4G31650.1  .....................fssdltcfsqsvttsnlmrdsvgvprdfakrygfnigrheivlmneegkpwesevisyksgkv-
AT2G24650.1  ...................dkscfmaiitaldlttdtlylplhftsangltrknreiiltdggersrvldlrfdessgtfyisr-
AT2G16210.2  .............rknesffkvvqsinvssenkralphdfsrsftdkelsrkmkiraqwgnswevgisknprfyfmeksgwekf-
AT5G18000.1  ...................................................ipefkltikkshllflgipkkfvdmhmptettm-
AT1G26680.1  ...........................pinphffqpiltesrthlnipvaffskhvegrnnqnktvtlrsdasdktwlvkmdgl-
AT2G16210.1  .............rknesffkvvqsinvssenkralphdfsrsftdkelsrkmkiraqwgnswevgisknprfyfmeksgwekf-
AT2G24700.1  .........................pinpqffqpllpgftnhldipvafflkylvgtnvgktaelrsdasemtwkvkidgrrls-
AT1G28300.1  ..................................................................................ce-
AT4G33280.1  .................................................flvfmkrshvvskcfltipykwcvknmlitrqevv-
AT5G60140.1  ...................................................kffkpylpsesgddlvlpisfnsclpkslpktv-
AT3G17010.1  ...................................................................gvpefkitirksylkfl-
AT1G26680.1  ........................sssdhssfvgsvnpsslykdqlylprnfvssnfldkrcseivlknergekrtlvlkhfkk-
AT4G31610.1  ....................................pspflivkytpsrettgqlslpvsftrnnsinktgevillnqdgrkws-
AT2G24645.1  ............................................................spsenrfvtlnltpynilrsalrl-
AT4G31610.1  ......................fitarvtrysllhdrldlsrnftllfgghqktceidvvdeqgrrwtmklaknissgvfyirl-
AT5G18090.1  ................................enpgffkilrsadlsseimrgiplnfiksiseeelsakmllkvswgsswpik-
AT4G31615.1  ............................fltmtfkpymlksgqlrlsrpfaieneikeaeditlvdknggnwpsyvasgdgqgg-
AT2G24650.1  ..........................................ypqffhtlvpsfhthlmipedffseyiegrsvaelkldfsdk-
AT2G24650.1  ..........................yspshkqfvtftlppdyarigklslsapfvrenginkpgeiclldkhgrkwltsllld-
AT4G00260.1  ...........................................qhffkpllpgfhasltipvafflkyiegryeqktaklrsda-
AT2G24680.1  ......................spsqnrfmtltlthdnliksrrylplsftrdngldkpgmifllgktgrkweanllreasgri-
AT5G60130.1  ............................................mvlpisftrflpkslpetvtvrsisgniwklelkkccgdd-
AT2G24680.2  ......................spsqnrfmtltlthdnliksrrylplsftrdngldkpgmifllgktgrkweanllreasgri-
AT5G24050.1  aklifektlfvtdvnptknrlsmpfnnllrndfltsvesiiinedinnnnkigvgailvdqrckkwgvmlkrwemkkesgkgsw-
AT4G31650.1  .........................................drtrfltltvtpssirssrlylskkfisvnkmeraggkkitll-
AT4G03170.1  .............................................................ikkqlmssdvdkdqcmlmlskeq-
AT4G31650.1  ..............................................................slprnfvrsdglikgsnkivlm-
AT5G32460.1  ......................sssakphfikpmlpgfetyivipkafysnylegrqegnaaelrsdateitwkikidgrrmtk-
AT2G24650.1  ...........................nrfvtlaltpedvtacklilpsqfmkanginnklgkitllgengvewpgymlsldgt-
AT1G05920.1  ..............dpkliieknldsndvdprqnrlsipintviqndfltldesrlidedeitnegnmgvaaflvdqrtkkwnm-
AT5G25470.1  .......................vskpcfwkslspgqnwksksmrsfpeefvkstpgafehrvvfsvrwgnswqlwlereekdl-
AT5G25470.2  .......................vskpcfwkslspgqnwksksmrsfpeefvkstpgafehrvvfsvrwgnswqlwlereekdl-
AT3G24850.1  ...aklifektlfvtdinptqnrlsmpfnnllqndfltsvesriikedinnnkkigvgailvdqrsvkwgvmlkrwelkkesgk-
AT4G31620.1  ....................ekycllgltasnlrlnrvsftkhfsrangltkrccmidlmnlsgeswtlglrhnkrtgqafirg-
AT4G31615.1  ......................................................................ssptnkhffvivlh-
AT2G24696.1  .................................qerfvtvrlvpdclrnkrlylsrrflknnglgepkmvtlvgtdgtrilanl-
AT1G26680.1  ...................................hsrfvakvsawclsndrlyiplsfarlnglnkinskkiylqneegrswk-
AT2G24700.1  .........................................tsqnrfvtltlthssklnlpfefmkrngikkagkitmvdryda-
AT2G35310.1  .....................................................ssssvaefsmfikksyliymwfpksvqsihm-
AT5G32460.1  .........................sdnssfvvsvtvsnlsedilhlpirlsrsnlldkkiheivlmnkegrtwilslkyskys-
AT2G24681.1  .............................fvtftpedirdcililpsqfikanginnlgeitllgqnrmkwfayllsmskdgsl-
AT3G46770.1  .........................................................................iqdtvlkffrv-
AT1G05930.1  ......................................................................lilektlsttdvit-
AT5G25475.1  ......................nvskpcfwkslspgqtwksksmriipedfvrrtrgafehrvvfsvrwenswqlwlereknel-
AT5G25475.2  ......................nvskpcfwkslspgqtwksksmriipedfvrrtrgafehrvvfsvrwenswqlwlereknel-
AT5G25475.3  ......................nvskpcfwkslspgqtwksksmriipedfvrrtrgafehrvvfsvrwenswqlwlereknel-
AT4G31620.1  ......................................................................ssrsnrpffvrsla-
AT4G00260.1  ..................................................................mfqrlpvpftrmnginee-
AT4G31680.1  .................................................fvkltptlnsleigkqhlpvsftkgnglihpgeii-
AT1G08985.1  ..................................................................................pn-
AT1G20600.1  .............................................................ikkqlmssdvdtdqsrlmlskeq-
AT5G66980.1  ..........................ykpkhphfvrnitrgslqklelpltflrsngieleedielcdesgkkwplkilnhdrg-
AT2G33720.1  ...................wtlkmamtkssignlyrlvlkasfvdihilrylplddqmmvkedsglavevydhdtdsvhnlalk-
AT3G49610.1  ...................................................................................l-
AT5G09780.1  ........................................sssvagfkifisksyikslaipkpfgnympkektrvkihhpdge-
AT2G31720.1  ...................................................klifvkvlpnsdvdelqtrlmmpwkqildmdfl-
AT1G10455.1  ..............................................................................ddpwvl-
AT4G31630.1  .......................................sptnkaffiidlsgqksnpiiptefiwnhfngkiqstnmkltsda-
AT4G31660.1  ........................................sdkscfvahvtdsnlredtlflprkfdrsdglikgsnkivlmne-
AT2G24696.1  ..........................................................sgnssfvalvkasnlkedalylpqdc-
AT5G60140.1  ................................................dhenpyftmtlnpkkksqlhipahvirdydltfper-
AT2G16210.1  ..............................sstaaaftilfkqgylvflripnsvskdqvpdektvfkihhpngkkswnvvyle-
AT4G03160.1  ......................lmdsdvkdnqyrlmlgkepvkkmmdalgkteklgtkglnvsvygpngenhkmvlkiwikgtp-
AT5G25470.1  ...............................................................................lnpkn-
AT5G25470.2  ...............................................................................lnpkn-
AT5G32460.1  ..................................................fvvpvtasnqrvdsfylprgfttssgssklcnei-
AT2G24696.1  ...........................lvitlvpedvkagmlrlpshfmkangidkvgkiymlginemewwwgdlltrdgivsv-
AT2G21920.1  ..................................................................................ii-
AT5G38490.1  ............................prlifertlfksdvnsnlsrllmpfqklirndfltpaecramqkdedndeeddeni-
AT5G25475.4  ..............................................kriipedfvrrtrgafehrvvfsvrwenswqlwlerek-
AT4G05630.1  ....................pynimitlspfdvdrsttimmpkalletnlfpfmeistlvqllqvqdkpkmigvydidtqitty-
AT1G51970.1  ...............................................pwvlkknltesdlnngfiilpkqdfekiirqmerglv-
AT1G78640.1  ................................................pytwtikktlkesdinhqcrlllnttdaenhimrhl-
AT5G60142.1  .........................................nhmnpfftvnqhrqikynmlriptkvitkyglhfpefinlidp-
AT4G31690.1  ....................................................................hlplsftkvnglinpg-
AT5G32460.1  .....................tnfvvpvtasnqrhdsfhlpkglttssglsklckkiifmdqkgrssildlsysisddrftvrr-
AT4G12617.1  ...............................nimitlspfdidlsttimmpktlleanlfrfmdisylvgllqvpnkpkvielf-
AT4G31610.1  ...............................................fltldadflmnhtkvllksdasdkvwkvkldggrlse-
AT5G60130.1  ....................................................drenpsftlilnpkkksqlliparvikdydlh-
AT5G60130.2  ....................................................drenpsftlilnpkkksqlliparvikdydlh-
AT2G32645.1  ..................istrelfksdldkgkarlqvpfnqvktpdfltedetriihenamkirddgvpvnlvdprmnkhale-
AT1G32030.1  ................................................................................prli-
AT2G31420.1  ....................pkliikrrvlcttdlrknqgclsmhlskleksdfltedetrfldedflkakrdglkvflvdpes-
AT2G18810.1  .........................................isdsdkgadvilvnseglqrklklkrwdmtstsnyvlgsgwnk-
AT1G78640.1  ..........................................qqywtikkeltksdacqrltlskssveehilkhllpedsqki-
AT1G43171.1  ................................................................................miis-
AT2G31460.1  .................pqliipkktlfkcdlddkqsrlqvssmhmensgfltedekrtieaqkmkkrrtaglrvafidpesqq-
AT5G54067.1  ................miitkvlsksdivgnvvlpkaevmsvltrmnvndqdllngvevqvddimeddlytvtlkvsgidkpky-
AT4G31630.1  ................................nkiltfdlkpyvfrscqfflpasfarengiveagevtvlnkdgiewkshlvn-
AT5G25475.1  .............................lnpenpyfvqavtkrndvlyvsrpvvqsyrlkfgpvkstityllpgekkeegenr-
AT5G25475.2  .............................lnpenpyfvqavtkrndvlyvsrpvvqsyrlkfgpvkstityllpgekkeegenr-
AT5G25475.3  .............................lnpenpyfvqavtkrndvlyvsrpvvqsyrlkfgpvkstityllpgekkeegenr-
AT5G25475.4  .............................lnpenpyfvqavtkrndvlyvsrpvvqsyrlkfgpvkstityllpgekkeegenr-
AT3G53310.1  ........................................tnphfpttlknriyellipanvvkdnnlefgssikyidgegtlv-
AT5G38500.1  ..............................pklifertlfksdvnsnlsrllipfqklirndfltpeecramqedkdkddedis-
AT5G57720.1  ....................................dpnnpffistsscsrrilviarqvikdyglnfdgtvnlidgfgeltrk-
AT2G24690.1  .......................................................sssqnrfltltitpdslkhgrlrlplqfm-
AT1G50220.1  ..................................................................................mi-
AT2G24670.1  ...............................................kkiidkelfqtdvdphqsrlsipvsqiveleflnhee-
AT2G24681.1  .......................................................iitlvgkdgtkleatlrrenrglmclgng-
AT2G27410.1  ................strqlyktdlkktearlsvpfkqvktpdfltedetriihenamkirdngvpvnfvdpelnkhvlelrk-
AT3G46770.2  ..............................................................emkangntvflrdgwkkivkde-
AT4G02870.1  .............................wtikkklssydirprcgrlilqsssfnehigrhlpkdqmikinvgvnvnvydydt-
AT5G46915.1  ..............................................sstaveftavfqpaylynlrirssvkdqmpvektifkv-
AT3G46770.2  ..........................................sfpvdmtqnrtripsllikdynltfpnmvimrdkigilkrri-
AT3G46770.1  ..........................................sfpvdmtqnrtripsllikdynltfpnmvimrdkigilkrri-
AT4G34400.1  .....................................pknihfetnvknrlyellvhaqlvkdyclrfgdyvnyidrfgklsak-
AT2G31862.1  .................................................................kllelnlrrwnmrstsiyv-


                      10        20         30        40                   50                        
                       |         |          |         |                    |                        
d1na6a1        VFHNWLLEIACENYFVYIKRLS.ANDTGATGGHQVGLYIPSGIVEKL...FP........SINH.........TR..ELNP....
AT1G30330.2  --PAELGVPSRQPTNYFCKTLT.ASDTSTHG----GFSVPRRAAEKV...FP........PL-D.........YS..QQPP....
AT1G30330.1  --PAELGVPSRQPTNYFCKTLT.ASDTSTHG----GFSVPRRAAEKV...FP........PL-D.........YS..QQPP....
AT5G37020.2  -----LGIPSKQPSNYFCKTLT.ASDTSTHG----GFSVPRRAAEKV...FP........PL-D.........YT..LQPP....
AT5G37020.1  -----LGIPSKQPSNYFCKTLT.ASDTSTHG----GFSVPRRAAEKV...FP........PL-D.........YT..LQPP....
AT1G19850.1  ---------SKHPTEFFCKTLT.ASDTSTHG----GFSVPRRAAEKL...FP........PL-D.........YS..AQPP....
AT1G19220.1  --------LNRQPTEFFCKTLT.ASDTSTHG----GFSVPRRAAEKI...FP........PL-D.........FS..MQPP....
AT1G59750.1  ------QEPEKCTVHSFCKTLT.ASDTSTHG----GFSVLRRHADDC...LP........PL-D.........MS..QQPP....
AT1G59750.3  ------QEPEKCTVHSFCKTLT.ASDTSTHG----GFSVLRRHADDC...LP........PL-D.........MS..QQPP....
AT1G59750.2  ------QEPEKCTVHSFCKTLT.ASDTSTHG----GFSVLRRHADDC...LP........PL-D.........MS..QQPP....
AT1G59750.4  ------QEPEKCTVHSFCKTLT.ASDTSTHG----GFSVLRRHADDC...LP........PL-D.........MS..QQPP....
AT2G33860.1  --------KRSNTPHMFCKTLT.ASDTSTHG----GFSVPRRAAEDC...FP........PL-D.........YS..QPRP....
AT5G20730.3  ---------NRQPNEFFCKTLT.ASDTSTHG----GFSVPRRAAEKI...FP........AL-D.........FS..MQPP....
AT5G20730.2  ---------NRQPNEFFCKTLT.ASDTSTHG----GFSVPRRAAEKI...FP........AL-D.........FS..MQPP....
AT5G20730.1  ---------NRQPNEFFCKTLT.ASDTSTHG----GFSVPRRAAEKI...FP........AL-D.........FS..MQPP....
AT5G60450.1  -----------RTPHMFCKTLT.ASDTSTHG----GFSVPRRAAEDC...FA........PL-D.........YK..QQRP....
AT5G62000.4  -------------VHSFCKTLT.ASDTSTHG----GFSVLRRHADEC...LP........PL-D.........MS..RQPP....
AT5G62000.1  -------------VHSFCKTLT.ASDTSTHG----GFSVLRRHADEC...LP........PL-D.........MS..RQPP....
AT5G62000.2  -------------VHSFCKTLT.ASDTSTHG----GFSVLRRHADEC...LP........PL-D.........MS..RQPP....
AT5G62000.3  -------------VHSFCKTLT.ASDTSTHG----GFSVLRRHADEC...LP........PL-D.........MS..RQPP....
AT3G61830.1  --------PTKQEFHSFVKILT.ASDTSTHG----GFSVLRKHATEC...LP........SL-D.........MT..QATP....
AT2G46530.2  ----PLVEPAKPTVDSFVKILT.ASDTSTHG----GFSVLRKHATEC...LP........SL-D.........MT..QPTP....
AT2G46530.1  ----PLVEPAKPTVDSFVKILT.ASDTSTHG----GFSVLRKHATEC...LP........SL-D.........MT..QPTP....
AT2G46530.3  ----PLVEPAKPTVDSFVKILT.ASDTSTHG----GFSVLRKHATEC...LP........SL-D.........MT..QPTP....
AT4G23980.1  -----------PKVHSFSKVLT.ASDTSTHG----GFSVLRKHATEC...LP........PL-D.........MT..QQTP....
AT4G23980.2  -----------PKVHSFSKVLT.ASDTSTHG----GFSVLRKHATEC...LP........PL-D.........MT..QQTP....
AT1G13260.1  ---------------LFEKAVT.PSDVGKLN----RLVIPKHHAEKH...FP........LP-S.........SN..VSVK....
AT1G25560.1  ----------------FEKTVT.PSDVGKLN----RLVIPKQHAEKH...FP........LPAM.........TTamGMNPsp..
AT3G61970.1  --------------HMFDKVVT.PSDVGKLN----RLVIPKQHAERY...FP........LD-N.........ST..TNDS....
AT1G68840.1  ---------------LFEKAVT.PSDVGKLN----RLVIPKQHAEKH...FP........LPSP.........SP..AVTK....
AT1G68840.2  ---------------LFEKAVT.PSDVGKLN----RLVIPKQHAEKH...FP........LPSP.........SP..AVTK....
AT3G25730.1  ---------------LFEKTVT.PSDVGKLN----RLVIPKHQAEKH...FP........LPLGn........NN..VSVK....
AT2G36080.2  ---------------LFEKPLT.PSDVGKLN----RLVIPKQHAERY...FP........LA-A.........AA..ADAV....
AT1G34310.1  --------------NSFTKVLT.ASDTSAHG----GFFVPKKHAIEC...LP........SL-D.........MS..QPLP....
AT5G06250.1  ---------------LFEKSLT.PSDVGKLN----RLVIPKQHAEKY...FPlnavlvssAAAD.........TS..SSEK....
AT5G06250.2  ---------------LFEKSLT.PSDVGKLN----RLVIPKQHAEKY...FPlnavlvssAAAD.........TS..SSEK....
AT2G36080.1  ---------------LFEKPLT.PSDVGKLN----RLVIPKQHAERY...FP........LA-A.........AA..ADAV....
AT1G34410.1  --------------NSFTKVLT.ASDTSAYG----GFSVPKKHAIEC...LP........PL-D.........MS..QPLP....
AT3G11580.2  ---------------LFEKSLT.PSDVGKLN----RLVIPKQHAEKY...FP........LNNNnnnggsgddVA..TTEK....
AT3G11580.1  ---------------LFEKSLT.PSDVGKLN----RLVIPKQHAEKY...FP........LNNNnnnggsgddVA..TTEK....
AT1G35540.1  --------------NSFTKVLT.ASDTSVHG----GFSVPKKHAIEC...LP........PL-D.........MS..QPLP....
AT2G46870.1  --------------HMFDKVVT.PSDVGKLN----RLVIPKQHAERF...FP........L--D.........SS..SNEK....
AT4G01500.1  --------------HMFDKVLT.PSDVGKLN----RLVIPKQHAENF...FP........LEDN.........QN..----....
AT1G35520.1  ---------------SFTKVLT.ASDISANG----VFSVPKKHAIEC...LP........PL-D.........MS..QPLP....
AT1G01030.1  --------------HMFDKVVT.PSDVGKLN----RLVIPKQHAERY...FP........L--D.........SS..NNQN....
AT4G30080.1  --------------PSFAKTLT.QSDANNGG----GFSVPRYCAETI...FP........RL-D.........YN..AEPP....
AT2G28350.1  --------------ASFAKTLT.QSDANNGG----GFSVPRYCAETI...FP........RL-D.........YS..AEPP....
AT1G34390.1  --------------NSFTKVLT.ASDTS--G----GFFVPKKHAIEC...LP........PL-D.........MS..QPLP....
AT1G35240.1  --------------NSFTKVLT.ASDTSAYG----GFFVPKKHAIEC...LP........PL--.........--..-PLP....
AT1G77850.1  ------------KVTTFAKILT.PSDANNGG----GFSVPRFCADSV...FP........LL-N.........FQ..IDPP....
AT1G34170.2  --------------YFFSKILT.ASDVSLSG----GLIIPKQYAIEC...FP........PL-D.........MS..QPIS....
AT1G34170.1  --------------YFFSKILT.ASDVSLSG----GLIIPKQYAIEC...FP........PL-D.........MS..QPIS....
AT1G34170.3  --------------YFFSKILT.ASDVSLSG----GLIIPKQYAIEC...FP........PL-D.........MS..QPIS....
AT1G51120.1  ---------------LFQKELT.PSDVGKLN----RLVIPKKYAVKY...MP........FISD.........DQ..SEKEtseg
AT1G50680.1  ---------------LFQKELT.PSDVGKLN----RLVIPKKYAVKY...MP........FI-S.........AD..QSEKeege
AT5G42700.1  ----------------------.------------------------...--........----.........--..----....
AT1G16640.1  ----------------------.------------------------...FP........A---.........--..----....
AT4G31690.1  ----------------------.------------------------...--........----.........--..----....
AT4G01580.1  ----------------------.------------------------...--........----.........--..----....
AT5G58280.1  ----------------------.----------------PSRFCADN...FP........EE--.........--..----....
AT2G24690.1  ----------------------.------------------------...--........----.........--..----....
AT1G43950.1  ---------------SFTKVLT.ASDTSAQG----EFSVPCKHAIEC...LP........PL-D.........MS..QPIP....
AT4G31680.1  ----------------------.------------------------...--........----.........--..----....
AT3G18960.1  ----------------------.------------------------...--........----.........--..----....
AT4G31640.1  ----------------------.------------------------...--........----.........--..----....
AT3G19184.1  ----------------------.------------------------...--........----.........CK..AHMP....
AT3G53310.1  ----------------------.------------------------...--........----.........--..----....
AT3G26790.1  ---------------LFQKELK.NSDVSSLR----RMILPKKAAEAH...LP........ALEC.........KE..G---....
AT1G49480.1  ----------------------.--------------YLPSGFAEKY...LS........GIS-.........--..----....
AT3G24650.1  -----------------QKVLK.QSDVGNLG----RIVLPKKEAETH...LP........EL--.........--..EARD....
AT4G31640.1  ----------------------.------------------------...--........----.........--..----....
AT5G18000.1  ----------------------.------------------------...--........----.........--..----....
AT3G18990.1  ----------------------.--------------YLPSGFAEKY...LS........GI--.........--..----....
AT2G24645.1  ----------------------.------------------------...--........----.........--..----....
AT3G18990.1  ----------------------.------------------------...--........----.........--..----....
AT4G00260.1  ----------------------.------------------------...--........----.........--..----....
AT1G26680.1  ----------------------.------------------------...--........----.........--..----....
AT2G24690.1  ----------------------.------------------------...--........----.........--..----....
AT4G00260.1  ----------------------.------------------------...--........----.........--..----....
AT5G66980.1  ----------------------.------------------------...--........----.........--..----....
AT4G34400.1  ----------------------.------------------------...--........----.........--..----....
AT2G24700.1  ----------------------.------------------------...--........----.........--..----....
AT3G06220.1  ----------------------.------------------------...--........----.........--..----....
AT4G31680.1  ----------------------.------------------------...--........----.........--..----....
AT5G60130.2  ----------------------.------------------------...--........----.........--..----....
AT2G35310.1  ----------------------.------------------------...--........----.........--..----....
AT4G33280.1  ----------------------.--------------VIPRKFSTHCkrkLP........QI-V.........TL..KSPS....
AT3G06160.1  ----------------------.------------------------...--........----.........--..----....
AT5G09780.1  ----------------------.------------------------...--........----.........--..----....
AT1G49475.1  ----------------------.------------------------...--........----.........--..----....
AT3G06160.2  ----------------------.------------------------...--........----.........--..----....
AT4G31690.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT2G24645.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT4G31615.1  ----------------------.------------------------...--........----.........--..----....
AT2G24700.1  ----------------------.------------------------...--........----.........--..----....
AT4G31620.1  ----------------------.------------------------...--........----.........--..----....
AT1G26680.1  ----------------------.------------------------...--........----.........--..----....
AT4G32010.1  ---------------LFEKVLS.ASDAGRIG----RLVLPKACAEAY...FP........PISL.........PE..----....
AT2G24680.1  ----------------------.------------------------...--........----.........--..----....
AT3G17010.1  ----WDVEVSKNPTYYYIE---.------------------------...--........----.........--..----....
AT2G24680.2  ----------------------.------------------------...--........----.........--..----....
AT5G60142.1  ----------------------.------------------------...--........----.........--..----....
AT4G31630.1  ----------------------.------------------------...--........----.........--..----....
AT5G57720.1  ----------------------.------------------------...--........----.........--..----....
AT2G24690.1  ----------------------.------------------------...--........----.........--..----....
AT4G31650.1  ----------------------.------------------------...--........----.........--..----....
AT4G31660.1  ----------------------.------------------------...--........----.........--..----....
AT4G21550.1  ---------------LFEKILS.ATDTGKR------LVLPKKYAEAF...LP........QLSH.........TK..GV--....
AT2G24680.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT2G24680.2  ----------------------.------------------------...--........----.........--..----....
AT5G18090.1  ----------------------.------------------------...--........----.........--..----....
AT1G26680.1  ----------------------.------------------------...--........----.........--..----....
AT2G30470.1  ---------------LFEKTLS.ASDAGRIG----RLVLPKACAEAY...FP........PI-S.........QS..----....
AT2G24645.1  ----------------------.------------------------...--........----.........--..----....
AT4G31650.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT2G16210.2  ----------------------.------------------------...--........----.........--..----....
AT5G18000.1  ----------------------.------------------------...--........----.........--..----....
AT1G26680.1  ----------------------.------------------------...--........----.........--..----....
AT2G16210.1  ----------------------.------------------------...--........----.........--..----....
AT2G24700.1  ----------------------.------------------------...--........----.........--..----....
AT1G28300.1  ------------------KELK.NSDVGSLG----RIVLPKRDAEAN...LP........KLSD.........KE..----....
AT4G33280.1  ----------------------.------------------------...--........----.........--..----....
AT5G60140.1  ----------------------.------------------------...--........----.........--..----....
AT3G17010.1  ----------------------.--------------AIPKHFVDDH...IP........NK--.........--..----....
AT1G26680.1  ----------------------.------------------------...--........----.........--..----....
AT4G31610.1  ----------------------.------------------------...--........----.........--..----....
AT2G24645.1  ----------------------.-----------------------P...IP........FT-R.........MN..GINE....
AT4G31610.1  ----------------------.------------------------...--........----.........--..----....
AT5G18090.1  ----------------------.------------------------...--........----.........--..----....
AT4G31615.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT4G00260.1  ----------------------.------------------------...--........----.........--..----....
AT2G24680.1  ----------------------.------------------------...--........----.........--..----....
AT5G60130.1  ----------------------.------------------------...--........----.........--..----....
AT2G24680.2  ----------------------.------------------------...--........----.........--..----....
AT5G24050.1  ----------------------.------------------------...--........----.........--..----....
AT4G31650.1  ----------------------.------------------------...--........----.........--..----....
AT4G03170.1  ----------------------.-------------------VKEKM...LP........FLED.........SE..NPVK....
AT4G31650.1  ----------------------.------------------------...--........----.........--..----....
AT5G32460.1  ----------------------.------------------------...--........----.........--..----....
AT2G24650.1  ----------------------.------------------------...--........----.........--..----....
AT1G05920.1  ----------------------.------------------------...--........----.........--..----....
AT5G25470.1  ----------------------.------------------------...--........----.........--..----....
AT5G25470.2  ----------------------.------------------------...--........----.........--..----....
AT3G24850.1  ----------------------.------------------------...--........----.........--..----....
AT4G31620.1  ----------------------.------------------------...--........----.........--..----....
AT4G31615.1  ----------------------.--------GHKSSPMIPAEFFSTY...VE........GKNH.........QS..----....
AT2G24696.1  ----------------------.------------------------...--........----.........--..----....
AT1G26680.1  ----------------------.------------------------...--........----.........--..----....
AT2G24700.1  ----------------------.------------------------...--........----.........--..----....
AT2G35310.1  ----------------------.------------------------...--........----.........--..---P....
AT5G32460.1  ----------------------.------------------------...--........----.........--..----....
AT2G24681.1  ----------------------.------------------------...--........----.........--..----....
AT3G46770.1  ----------------------.--------------YIPNQTADDMn..LP........LVSD.........--..----....
AT1G05930.1  ----------------------.------------------------...--........----.........--..----....
AT5G25475.1  ----------------------.------------------------...--........----.........--..----....
AT5G25475.2  ----------------------.------------------------...--........----.........--..----....
AT5G25475.3  ----------------------.------------------------...--........----.........--..----....
AT4G31620.1  ----------------------.--------GHTSNLIIPDEFFTAH...--........----.........--..----....
AT4G00260.1  ----------------------.------------------------...--........----.........--..----....
AT4G31680.1  ----------------------.------------------------...--........----.........--..----....
AT1G08985.1  --------------MMIVKTLS.ETDCSHDN----KLILPRDKVENI...VR........---S.........TG..VPVP....
AT1G20600.1  ----------------------.-------------------VKEKM...LP........FLEE.........SE..DPVK....
AT5G66980.1  ------FKFSHESWLCFCK---.------------------------...--........----.........--..----....
AT2G33720.1  ----------------------.------------------------...--........----.........--..----....
AT3G49610.1  ---------------IYEKTLT.ATDVK-------------------...--........----.........--..----....
AT5G09780.1  ----------------------.------------------------...--........----.........--..----....
AT2G31720.1  ------NEEELEKIDRHHKKIS.ASDKG-------------------...--........----.........--..----....
AT1G10455.1  -----------------KKKLS.DSDLYYSA----QLYLPKQEMEHFv..LP........EM-D.........HD..LVRKlga.
AT4G31630.1  ----------------------.------------------------...--........----.........--..----....
AT4G31660.1  ----------------------.------------------------...--........----.........--..----....
AT2G24696.1  ----------------------.------------------------...--........----.........--..----....
AT5G60140.1  ----------------------.------------------------...--........----.........--..----....
AT2G16210.1  ----------------------.------------------------...--........----.........--..----....
AT4G03160.1  ----------------------.------------------------...--........----.........--..----....
AT5G25470.1  --------------PYFVKTLTkGNDV---------LYVPKTVIK--...--........----.........--..----....
AT5G25470.2  --------------PYFVKTLTkGNDV---------LYVPKTVIK--...--........----.........--..----....
AT5G32460.1  ----------------------.------------------------...--........----.........--..----....
AT2G24696.1  ----------G-----------.------------------------...--........----.........--..----....
AT2G21920.1  -----------------SKTLS.RTDVDHHG----RLFLPKNQVLSV...LK........KMRN.........VT..KESL....
AT5G38490.1  ----------------------.------------------------...--........----.........--..----....
AT5G25475.4  ----------------------.------------------------...--........----.........--..----....
AT4G05630.1  ----------------------.------------------------...--........----.........--..----....
AT1G51970.1  ----------------------.------------------------...--........----.........-K..----....
AT1G78640.1  ----------------------.------------------------...-P........TD-D.........QK..KIQE....
AT5G60142.1  ----------------------.------------------------...--........----.........--..----....
AT4G31690.1  ----------------------.------------------------...--........----.........--..----....
AT5G32460.1  ----------------------.------------------------...--........----.........--..----....
AT4G12617.1  ----------------------.------------------------...--........----.........--..----....
AT4G31610.1  ----------------------.------------------------...--........----.........--..----....
AT5G60130.1  ----------------------.------------------------...F-........----.........--..----....
AT5G60130.2  ----------------------.------------------------...F-........----.........--..----....
AT2G32645.1  ----------------------.------------------------...--........----.........--..----....
AT1G32030.1  ----------------YEKTLT.ETDV--------------------...--........----.........--..----....
AT2G31420.1  -----------D----------.------------------------...--........----.........--..----....
AT2G18810.1  ----------------------.------------------------...--........----.........--..----....
AT1G78640.1  ----------------------.------------------------...--........----.........-D..KGKP....
AT1G43171.1  ------------------KTLT.KTDIV--G----NVALPKAQVMSV...LT........RMNG.........VT..DEGL....
AT2G31460.1  ----------------------.------------------------...--........----.........--..----....
AT5G54067.1  ----------------------.------------------------...--........----.........--..----....
AT4G31630.1  ----------------------.------------------------...--........----.........--..----....
AT5G25475.1  ----------------------.------------------------...--........----.........--..----....
AT5G25475.2  ----------------------.------------------------...--........----.........--..----....
AT5G25475.3  ----------------------.------------------------...--........----.........--..----....
AT5G25475.4  ----------------------.------------------------...--........----.........--..----....
AT3G53310.1  ----------------------.------------------------...--........----.........--..----....
AT5G38500.1  ----------------------.------------------------...--........----.........--..----....
AT5G57720.1  ----------------------.------------------------...--........----.........--..----....
AT2G24690.1  ----------------------.------------------------...--........----.........--..----....
AT1G50220.1  ----------------ISKTLT.KSDIV--G----NVALPKAQVMSV...LT........RMNG.........VT..DEGL....
AT2G24670.1  ----------------------.------------------------...--........----.........--..----....
AT2G24681.1  ----------------------.------------------------...--........----.........--..----....
AT2G27410.1  ----------------------.------------------------...--........----.........--..----....
AT3G46770.2  ----------------------.------------------------...--........----.........--..----....
AT4G02870.1  ----------------------.------------------------...--........----.........--..----....
AT5G46915.1  ----------------------.------------------------...--........----.........--..----....
AT3G46770.2  ----------------------.------------------------...--........----.........--..----....
AT3G46770.1  ----------------------.------------------------...--........----.........--..----....
AT4G34400.1  ----------------------.------------------------...--........----.........--..----....
AT2G31862.1  ----------------------.------------------------...--........----.........--..----....


                    60        70           80         90       100        110             120       
                     |         |            |          |         |          |               |       
d1na6a1        ......SVFLTAHVSSHD.C.PD.SEARAIYYNSAHF.GKTRNEKRITRWGRG.SPLQDPENTGALT......LLAFKLDEQGGD
AT1G30330.2  ......AQELMAR--DLH.D.NE.WKFRHIFRGQ---.--PKRHLLTTGW-SV.FVSAKRLVAGDSV......LFIWNDKNQL-L
AT1G30330.1  ......AQELMAR--DLH.D.NE.WKFRHIFRGQ---.--PKRHLLTTGW-SV.FVSAKRLVAGDSV......LFIWNDKNQL-L
AT5G37020.2  ......AQELIAR--DLH.D.VE.WKFRHIFRGQ---.--PKRHLLTTGW-SV.FVSAKRLVAGDSV......IFIRNEKNQL-F
AT5G37020.1  ......AQELIAR--DLH.D.VE.WKFRHIFRGQ---.--PKRHLLTTGW-SV.FVSAKRLVAGDSV......IFIRNEKNQL-F
AT1G19850.1  ......TQELVVR--DLH.E.NT.WTFRHIYRGQ---.--PKRHLLTTGW-SL.FVGSKRLRAGDSV......LFIRDEKSQL-M
AT1G19220.1  ......AQEIVAK--DLH.D.TT.WTFRHIYRGQ---.--PKRHLLTTGW-SV.FVSTKRLFAGDSV......LFVRDEKSQL-M
AT1G59750.1  ......WQELVAT--DLH.N.SE.WHFRHIFRGQ---.--PRRHLLTTGW-SV.FVSSKKLVAGDAF......IFLRGENEEL-R
AT1G59750.3  ......WQELVAT--DLH.N.SE.WHFRHIFRGQ---.--PRRHLLTTGW-SV.FVSSKKLVAGDAF......IFLRGENEEL-R
AT1G59750.2  ......WQELVAT--DLH.N.SE.WHFRHIFRGQ---.--PRRHLLTTGW-SV.FVSSKKLVAGDAF......IFLRGENEEL-R
AT1G59750.4  ......WQELVAT--DLH.N.SE.WHFRHIFRGQ---.--PRRHLLTTGW-SV.FVSSKKLVAGDAF......IFLRGENEEL-R
AT2G33860.1  ......SQELLAR--DLH.G.LE.WRFRHIYRGQ---.--PRRHLLTTGW-SA.FVNKKKLVSGDAV......LFLRGDDGKLRL
AT5G20730.3  ......CQELVAK--DIH.D.NT.WTFRHIYRGQ---.--PKRHLLTTGW-SV.FVSTKRLFAGDSV......LFIRDGKAQL-L
AT5G20730.2  ......CQELVAK--DIH.D.NT.WTFRHIYRGQ---.--PKRHLLTTGW-SV.FVSTKRLFAGDSV......LFIRDGKAQL-L
AT5G20730.1  ......CQELVAK--DIH.D.NT.WTFRHIYRGQ---.--PKRHLLTTGW-SV.FVSTKRLFAGDSV......LFIRDGKAQL-L
AT5G60450.1  ......SQELIAK--DLH.G.VE.WKFRHIYRGQ---.--PRRHLLTTGW-SI.FVSQKNLVSGDAV......LFLRDEGGEL-R
AT5G62000.4  ......TQELVAK--DLH.A.NE.WRFRHIFRGQ---.--PRRHLLQSGW-SV.FVSSKRLVAGDAF......IFLRGENGEL-R
AT5G62000.1  ......TQELVAK--DLH.A.NE.WRFRHIFRGQ---.--PRRHLLQSGW-SV.FVSSKRLVAGDAF......IFLRGENGEL-R
AT5G62000.2  ......TQELVAK--DLH.A.NE.WRFRHIFRGQ---.--PRRHLLQSGW-SV.FVSSKRLVAGDAF......IFLRGENGEL-R
AT5G62000.3  ......TQELVAK--DLH.A.NE.WRFRHIFRGQ---.--PRRHLLQSGW-SV.FVSSKRLVAGDAF......IFLRGENGEL-R
AT3G61830.1  ......TQELVTR--DLH.G.FE.WRFKHIFRGQ---.--PRRHLLTTGW-ST.FVSSKRLVAGDAF......VFLRGENGDL-R
AT2G46530.2  ......TQELVAR--DLH.G.YE.WRFKHIFRGQ---.--PRRHLLTTGW-ST.FVTSKRLVAGDAF......VFLRGETGDL-R
AT2G46530.1  ......TQELVAR--DLH.G.YE.WRFKHIFRGQ---.--PRRHLLTTGW-ST.FVTSKRLVAGDAF......VFLRGETGDL-R
AT2G46530.3  ......TQELVAR--DLH.G.YE.WRFKHIFRGQ---.--PRRHLLTTGW-ST.FVTSKRLVAGDAF......VFLRGETGDL-R
AT4G23980.1  ......TQELVAE--DVH.G.YQ.WKFKHIFRGQ---.--PRRHLLTTGW-ST.FVTSKRLVAGDTF......VFLRGENGEL-R
AT4G23980.2  ......TQELVAE--DVH.G.YQ.WKFKHIFRGQ---.--PRRHLLTTGW-ST.FVTSKRLVAGDTF......VFLRGENGEL-R
AT1G13260.1  ......GVLLNFE--DVN.G.KV.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKEKNLRAGDVV......SFSRSNGQDQ--
AT1G25560.1  ......TKGVLINLEDRT.G.KV.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKEKNLRAGDVV......CFERSTGPDR--
AT3G61970.1  ......NKGLLLNFEDRS.G.NS.WRFRYSYWNS---.--SQSYVMTKGW-SR.FVKDKKLDAGDIV......SFQRDSCNKD--
AT1G68840.1  ......GVLINFE--DVN.G.KV.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKEKNLRAGDVV......TFERST------
AT1G68840.2  ......GVLINFE--DVN.G.KV.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKEKNLRAGDVV......TFERST------
AT3G25730.1  ......GMLLNFE--DVN.G.KV.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKEKRLCAGDLI......SFKRSNDQDQK-
AT2G36080.2  ......EKGLLLCFEDEE.G.KP.WRFRYSYWNS---.--SQSYVLTKGW-SR.YVKEKHLDAGDVV......LFHRHRSDGGR-
AT1G34310.1  ......AQELLAI--DLH.G.NQ.WRFNHNYRGT---.--PQRHLLTTGW-NA.FTTSKKLVAGDVI......VFVRGETGEL-R
AT5G06250.1  ......GMLLSFE--DES.G.KS.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKDKQLDPGDVV......FFQRHRSDSRR-
AT5G06250.2  ......GMLLSFE--DES.G.KS.WRFRYSYWNS---.--SQSYVLTKGW-SR.FVKDKQLDPGDVV......FFQRHRSDSRR-
AT2G36080.1  ......EKGLLLCFEDEE.G.KP.WRFRYSYWNS---.--SQSYVLTKGW-SR.YVKEKHLDAGDVV......LFHRHRSDGGR-
AT1G34410.1  ......AQEILAI--DLH.D.NQ.WRFRHNYRGT---.--PQRHSLTTGW-NE.FITSKKLVKGDVI......VFVRGETGEL-R
AT3G11580.2  ......GMLLSFE--DES.G.KC.WKFRYSYWNS---.--SQSYVLTKGW-SR.YVKDKHLDAGDVV......FFQRHRFDLH--
AT3G11580.1  ......GMLLSFE--DES.G.KC.WKFRYSYWNS---.--SQSYVLTKGW-SR.YVKDKHLDAGDVV......FFQRHRFDLH--
AT1G35540.1  ......TQEILAI--DLH.G.NQ.WRFRHIYRGT---.--AQRHLLTIGW-NA.FTTSKKLVEGDVI......VFVRGETGEL-R
AT2G46870.1  ......GLLLNFE--DLT.G.KS.WRFRYSYWNS---.--SQSYVMTKGW-SR.FVKDKKLDAGDIV......SFQRCV------
AT4G01500.1  ......GTVLDFQ--DKN.G.KM.WRFRYSYWNS---.--SQSYVMTKGW-SR.FVKEKKLFAGDTV......SFYR--------
AT1G35520.1  ......AQELLAI--DLH.G.NQ.WSFRHSYRGT---.--PQRHLLTTGW-NE.FTTSKKLVKGDVI......VFVRGETGEL-R
AT1G01030.1  ......GTLLNFQ--DRN.G.KM.WRFRYSYWNS---.--SQSYVMTKGW-SR.FVKEKKLDAGDIV......SFQR--------
AT4G30080.1  ......VQTILAK--DVH.G.DV.WKFRHIYRGT---.--PRRHLLTTGW-SN.FVNQKKLVAGDSI......VFMRAENGDL-C
AT2G28350.1  ......VQTVIAK--DIH.G.ET.WKFRHIYRGT---.--PRRHLLTTGW-ST.FVNQKKLIAGDSI......VFLRSESGDL-C
AT1G34390.1  ......TQELLAT--DLH.G.NQ.WRFNHNYRGT---.--PQRHLLTTGW-NA.FTTSKKLVAGDVI......VFVRGETGEL-R
AT1G35240.1  ......AQELLAK--DLH.G.NQ.WRFRHSYRGT---.--PQRHSLTTGW-NE.FTTSKKLVKGDVI......VFVRGETGEL-R
AT1G77850.1  ......VQKLYVT--DIH.G.AV.WDFRHIYRGT---.--PRRHLLTTGW-SK.FVNSKKLIAGDSV......VFMRKSADEM-F
AT1G34170.2  ......TQNLVAK--DLY.G.QE.WSFKHVFRGT---.--PQRHMFTSGGGWSvFATTKRLIVGDIF......VLLRGENGEL-R
AT1G34170.1  ......TQNLVAK--DLY.G.QE.WSFKHVFRGT---.--PQRHMFTSGGGWSvFATTKRLIVGDIF......VLLRGENGEL-R
AT1G34170.3  ......TQNLVAK--DLY.G.QE.WSFKHVFRGT---.--PQRHMFTSGGGWSvFATTKRLIVGDIF......VLLRGENGEL-R
AT1G51120.1  ....veDVEVVFY--DRA.M.RQ.WKFRYCYWRS---.--SQSFVFTRGW-NG.FVKEKNLKEKDII......VFY---------
AT1G50680.1  ivgsveDVEVVFY--DRA.M.RQ.WKFRYCYWKS---.--SQSFVFTRGW-NS.FVKEKNLKEKDVI......AF----------
AT5G42700.1  ......------------.-.--.-------------.----------GW-MG.FAVAHNLAYGDTL......VFEL--------
AT1G16640.1  ......PFPITVDLLDYS.G.RS.WTVRMKKRGE---.----KVFLTVGW-EN.FVKDNNLEDGKYL......QFIYDRDRTFY-
AT4G31690.1  ......---VTLRT-DAS.E.RT.WEVK---------.--MEGHRLTEGW-KE.FVEAHDLRIGDFV......VFRH--------
AT4G01580.1  ......------------.-.--.-------------.----------G----.-------------......------------
AT5G58280.1  ......--TMEIELEDEE.G.EV.YEAVYI--GR---.----RAGLSGGW-KR.FALDHKLDDGDAL......LFELVEPKKF--
AT2G24690.1  ......------------.-.--.-------------.-----MTLGDGW-KS.FVKANGLKTGDTY......TFKLLWEDTTP-
AT1G43950.1  ......AQELIAI--DLH.G.NQ.WRFKHSYRVP---.-----RGDTTGW-NA.FTTSKKLVVGDVI......VFARGETGELR-
AT4G31680.1  ......---------DAS.K.RT.WEVK--MDGN---.---------------.-------------......------------
AT3G18960.1  ......------------.-.--.-------------.-----------W---.-------------......------------
AT4G31640.1  ......------------.-.--.-------------.----------GW-TS.LCTANKLEVGDSC......TFK---------
AT3G19184.1  ......KRDVIMTLVDEE.E.EE.SQAKYLAQKNGLS.GG---------W-RG.FAIDHQLVDGDAV......VFHLI-------
AT3G53310.1  ......------------.-.--.-------------.----------GW-PK.FAEEHELKNGEFM......TFV---------
AT3G26790.1  ......---IPIRMEDLD.G.FHvWTFKYRYWPN---.-NNSRMYVLENT-GD.FVNAHGLQLGDFI......MVYQDLYSNNYV
AT1G49480.1  ......-GFIKL---QLG.E.KQ.WPVRCLYKAGRA-.------KFSQGW-YE.FTLENNIGEGDVC......VFELLRTRDF--
AT3G24650.1  ......GISLAME--DIGtS.RV.WNMRYRFWPN---.-NKSRMYLLENT-GD.FVKTNGLQEGDFI......VIYSD-------
AT4G31640.1  ......------------.-.--.------YPSRRTWkVKMEGHKLTEGW-KE.FVEAHDLRVGDFV......VFKHK-------
AT5G18000.1  ......------------.-.-S.-------------.---------------.-------------......------------
AT3G18990.1  ......SGFIKVQ---LA.E.KQ.WPVRCLYKAGRA-.------KFSQGW-YE.FTLENNLGEGDVC......VFELLRTRDF--
AT2G24645.1  ......------------.-.--.-------------.----------GW-RS.FCSANGLRAGSII......TFKLIKKSG---
AT3G18990.1  ......------------.-.--.---R---------.---------------.-------------......------------
AT4G00260.1  ......------------.-.--.-------------.---------------.-------------......------------
AT1G26680.1  ......------------.-.--.-------------.----------GW-TS.FCQGNGLKAGDSF......KFKL--------
AT2G24690.1  ......------------.-.--.-------------.----------GW-KD.FAKANGLKTGDSI......TLEPIW------
AT4G00260.1  ......------------.-.--.-------------.----------GW-RS.FCSANGLRAGSII......TLK---------
AT5G66980.1  ......------------.-.--.-------------.----------GW-QS.FANDQSLEFGDFL......VFSYDGDSRF--
AT4G34400.1  ......------------.-.--.-------------.----------GW-PK.FVRDNTLNDGDFL......TFAYN-------
AT2G24700.1  ......------------.-.--.---REAYNYGRFY.-------MRRGW-RS.FCIANGKKPGDVF......AFKLVKNEETPM
AT3G06220.1  ......------------.-.--.-------------.----QVYLARGW-EN.FVADNELKDGEFL......TFVFDGYKSY--
AT4G31680.1  ......----------GK.S.WE.SEVRSRMSGQ---.---------------.-------------......------------
AT5G60130.2  ......------------.-.--.---------D---.-DTEKFVMVNGW-KR.IVKDEDLKGGDFL......EFEFDGSSC---
AT2G35310.1  ......------------.-.--.-------------.---------------.--FVSDNALGASE......FLTFTHKGNM--
AT4G33280.1  ......GVTYNVGVEEDD.E.KT.MAFRF--------.----------GW-DK.FVKDHSLEENDLL......VFKFHGV-----
AT3G06160.1  ......------------.-.--.---EQVYFEQ---.----------GW-GN.FVADNQLKEGEFL......TFVFDGHKSY--
AT5G09780.1  ......------------.-.--.------W------.---------------.-------------......------------
AT1G49475.1  ......------------.-.--.-------------.----------G----.-------------......------------
AT3G06160.2  ......------------.-.--.---EQVYFEQ---.----------GW-GN.FVADNQLKEGEFL......TFVFDGHKSY--
AT4G31690.1  ......---------EGK.S.WE.SEVKSYMSGA---.-----VYLVGGW-TT.FCTENKLDVGDSC......TFKLLQ------
AT2G24650.1  ......------------.-.--.--I----------.---------------.-------------......------------
AT2G24645.1  ......------------.-.--.-------------.-------------VS.FCDANGLQAGDIY......TFKL--------
AT2G24650.1  ......------------.-.--.-------------.----------GW-KE.FADTKDLKSGDSF......TM----------
AT4G31615.1  ......-----LM--NKH.G.KS.WTLGLRYSTV---.---NDQASISGGWRD.FCLVNGLEAGSFY......RFKLVQNGER--
AT2G24700.1  ......------------.-.--.------HEAH---.--TGRFLTIRGW-RR.FCVANGKKPGDLL......KFKLVHNEET--
AT4G31620.1  ......------------.-.--.-------------.--RREFYMAHGW-IR.FCEANKLKTGETF......TLEFVRGE----
AT1G26680.1  ......------------.-.--.-------------.----------GW-TS.FCQVNRIKA----......------------
AT4G32010.1  ......--GLPLKIQDIK.G.KE.WVFQFRFWPN---.-NNSRMYVLEGV-TP.CIQSMQLQAGDTV......TFSRTEPEGKLV
AT2G24680.1  ......------------.-.--.-------------.----------GW-RS.FCDENGKKPGGVF......VFKLVGNR----
AT3G17010.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G24680.2  ......------------.-.--.-------------.----------GW-RS.FCDENGKKPGGVF......VFKLVGNR----
AT5G60142.1  ......------------.G.NI.WKVAF----RKFC.GDSERFVMVNGW-KK.IVKDEDLKGGEFL......EFEFD-------
AT4G31630.1  ......-CEIDLR--DEH.E.KS.WTLLLRHNKK---.--TGQAFMRGGW-RS.FCRNNGIKAGSIC......RFK---------
AT5G57720.1  ......------------.-.--.-------------.---K-----------.-------------......------------
AT2G24690.1  ......------------.-.--.-------------.----------GW-KG.FCEANGVMLGETF......VLEFIPKDD---
AT4G31650.1  ......---L--R-SDSS.K.RT.WKVK---------.--IEGHTLTDGW-KE.FVEAHDLRISDFV......IFKH--------
AT4G31660.1  ......---------DAS.E.KT.WQVK---------.--IQGRRLTVGW-KE.FASAHDFRVGDII......VFRH--------
AT4G21550.1  ......--PLTVQ--DPM.G.KE.WRFQFRFWPS---.-SKGRIYVLEGV-TP.FIQTLQLQAGDTV......IFSRLDPERKLI
AT2G24680.1  ......------------.-.--.-------------.----------GW-KG.FCEANGVKTGESF......------------
AT2G24650.1  ......------------.-.--.-------------.----------GW-KD.FVKDNGLKTGDSF......TLKLIWEDQTPV
AT2G24680.2  ......------------.-.--.-------------.----------GW-KG.FCEANGVKTGESF......------------
AT5G18090.1  ......------------.K.RS.WDVMYKFSNN---.---------------.-------------......------------
AT1G26680.1  ......----VLL--NEE.G.LS.WKFNLKYNQA---.--GKHTYVRPGW-SR.FCDANGMSQGQQF......TFKLVQ------
AT2G30470.1  ......-EGIPLKIQDVR.G.RE.WTFQFRYWPN---.-NNSRMYVLEGV-TP.CIQSMMLQAGDTV......TFSRVDPG----
AT2G24645.1  ......---------DAS.K.IT.WEVK--IDGQ---.-------RLTDGWKE.FALSHDLRIGDIV......VFRQERD-----
AT4G31650.1  ......------------.-.--.-------------.------I--------.-------------......------------
AT2G24650.1  ......------------.-.--.-------------.----------GW-RN.FCDENGQKAGGFF......LFKLVGKGET--
AT2G16210.2  ......------------.-.--.-------------.---------------.-V--RDNALGNSE......LLTFTHKG----
AT5G18000.1  ......---F--------.-.--.-------------.---------------.-------------......------------
AT1G26680.1  ......------------.-.--.-------------.------KLTDGW-ED.FAFAHDLRTGDIV......VFRL--------
AT2G16210.1  ......------------.-.--.-------------.---------------.-V--RDNALGNSE......LLTFTHKG----
AT2G24700.1  ......------------.-.--.-------------.---------NGW-ED.FTIAHDLRVGDIV......VFRQ--------
AT1G28300.1  ......--GIVVQMRDVF.SmQS.WSFKYKFWSN---.-NKSRMYVLENT-GE.FVKQNGAEIGDFL......TIYEDESKNLYF
AT4G33280.1  ......-----MQV-DQT.K.WE.MKFN-------IF.GARGSGGISTGW-KK.FVQDNNLREGDVC......VFEPANSETK--
AT5G60140.1  ......------TVRSIS.G.NI.WKLGFKKC----G.GEVERFVMVSGW-KK.IVRDENLNGGDLL......SFEFDGS-----
AT3G17010.1  ......SKIFTIRHPNG-.-.--.-------------.---------------.-------------......------------
AT1G26680.1  ......------------.-.--.-------------.--------------D.-------------......------------
AT4G31610.1  ......------------.-.--.-------------.----SYLQITGLGR-.-------------......------------
AT2G24645.1  ......ETKMTLL--DKH.G.MK.WLTT---------.---------------.-------------......------------
AT4G31610.1  ......------------.-.--.-------------.----------GW-GN.FCCANGLTQGDLC......KFKLFQNEE---
AT5G18090.1  ......------------.-.--.-------------.---------------.-------------......------------
AT4G31615.1  ......------------.-.--.-------------.----KYYLAKGW-RS.FCAANRLKTGETF......TLEFVRGEGT--
AT2G24650.1  ......------------.-.-S.WEVK---------.---LSDRRITDGWEE.FVVANDFRIGDVV......AFRY--------
AT2G24650.1  ......------------.-.--.--------S----.---------------.-------------......------------
AT4G00260.1  ......-----------S.K.RT.WEVK--IDGQ---.-------RLTDGWKE.FAVSHDLRIGDIV......VFRQESD-----
AT2G24680.1  ......------------.-.--.-------------.-------VLTGKGWKeFAMANGLKSGELF......TL----------
AT5G60130.1  ......------------.-.--.-------------.-DTEKFVMVNGW-KR.IVKDEDLKGGDFL......EFEFDGSSCF--
AT2G24680.2  ......------------.-.--.-------------.-------VLTGKGWKeFAMANGLKSGELF......TL----------
AT5G24050.1  ......------------.-.--.-------------.----SYNLICGW-ND.IVEANRLKEGDNI......------------
AT4G31650.1  ......---------D--.-.--.-------------.---------------.-------------......------------
AT4G03170.1  ......GIDVSVYGPDGK.V.QQ.MEFK-------MW.NGDKTPVLTSGW-KQ.FVEDYGLSM----......-----------T
AT4G31650.1  ......---------NEG.A.RT.WTLILKFRDS---.--RRSFYSRGGW-RS.FCRENGLKPGDSV......TFKLESSN----
AT5G32460.1  ......------------.-.--.-------------.----------GW-EE.FAVAHNLQVDDIL......VF----------
AT2G24650.1  ......------------.-.--.-------------.---------------.-------------......------------
AT1G05920.1  ......------------.-.--.-------------.-GFKQWFMTTDSGSS.YW-----------......------------
AT5G25470.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G25470.2  ......------------.-.--.-------------.---------------.-------------......------------
AT3G24850.1  ......------------.-.--.-------------.-GSWNYNLICGW-ND.VVEANGLKEGD--......------------
AT4G31620.1  ......------------.-.--.-------------.----------RW-RS.FCHANELKPGSFY......RFK---------
AT4G31615.1  ......-TKLKLT-SDAF.D.RT.WEVK--LNGRRFA.GGWE-----------.-------------......------------
AT2G24696.1  ......------------.-.--.-------------.---------------.-------------......-----L------
AT1G26680.1  ......------------.-.--.--L----------.---------------.-------------......------------
AT2G24700.1  ......------------.-.-K.-------------.---------------.-------------......------------
AT2G35310.1  ......KQRTIFKI-HHP.N.MK.KSWNVVYVVS---.-GTKSSFS-AGW-KG.LAQEYPLAVGDTC......K-----------
AT5G32460.1  ......------------.-.--.-------------.----GRFRITRGWKS.FCEANGQKPGCTF......L-----------
AT2G24681.1  ......------------.-.--.-------------.------A--------.-------------......------------
AT3G46770.1  ......------------.-.--.-------------.---------------.-------------......------------
AT1G05930.1  ......------------.-.--.-------------.---------TTHGRF.SMHFNRLISNDFLkpeersILEEDTYNDE-T
AT5G25475.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G25475.2  ......------------.-.--.-------------.---------------.-------------......------------
AT5G25475.3  ......------------.-.--.-------------.---------------.-------------......------------
AT4G31620.1  ......------------.-.--.-------------.---------------.-------------......------------
AT4G00260.1  ......---TKMTLLDKH.G.VK.WLTTLRFEDD---.-KRKRLRMVGGW-QG.FIQANDVKANESI......MLELIW------
AT4G31680.1  ......------------.-.--.-------------.---------------.-------------......------------
AT1G08985.1  ......RMGIQVEILDNT.N.SY.WV--------NLR.QSQRGYFIGRGW-GE.LRDARNLKAGDVI......KL----------
AT1G20600.1  ......GVDVSVYGPDGE.V.QQ.MKFK-------MW.NGDKTPVLTSGW-MQ.F------------......------------
AT5G66980.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G33720.1  ......------------.-.--.-----------KW.AKSSSFVLVSGWRKC.FVDRRGLQVGDVI......GMYWDRSESK--
AT3G49610.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G09780.1  ......------------.K.--.-------------.---------------.-------------......------------
AT2G31720.1  ......------------.-.--.-------------.---------------.-------------......------------
AT1G10455.1  ......GVEVKVRDVDSV.D.DF.YTVRLKVRNGQYY.LGK-------GW-GL.IKNAKVLNTGDHI......GLF---------
AT4G31630.1  ......-----------S.-.--.-------------.---------------.-------------......------------
AT4G31660.1  ......-----------E.A.RT.WT-----------.---------------.-------------......------------
AT2G24696.1  ......--------TSSN.G.LN.KKCRKIFLTD---.GGDRSW---------.-------------......------------
AT5G60140.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G16210.1  ......------------.-.--.-------R-----.---------------.-------------......------------
AT4G03160.1  ......------------.-.--.-------------.------V--------.-------------......------------
AT5G25470.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G25470.2  ......------------.-.--.-------------.---------------.-------------......------------
AT5G32460.1  ......----I--LIDEK.D.RP.STLKLRYNKS---.--SNRFCVSRGW-RA.FCCRNGYRTGCFL......RIILVRKG----
AT2G24696.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G21920.1  ......RKGIELEVVDII.E.ND.S------------.---------------.-------------......------------
AT5G38490.1  ......------------.-.--.-------------.---------------.---------G---......------------
AT5G25475.4  ......------------.-.--.-------------.---------------.-------------......------------
AT4G05630.1  ......------------.-.--.-------------.---------------.-------------......V-----------
AT1G51970.1  ......------------.-.--.-------------.---------------.-------------......------------
AT1G78640.1  ......GIGVDVKAYDHD.T.YT.EH-DMVFK--RHV.KTSKSYVFNGGWAKA.FVGRRELKEGDKI......GLFWAKKSQ---
AT5G60142.1  ......------------.-.--.-------------.---------------.-------------......------------
AT4G31690.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G32460.1  ......------------.-.--.-------------.----------GW-KA.FCCRNEHKTG---......------------
AT4G12617.1  ......---------DID.T.KI.TTFLTIRRDG---.----DNFKFHGW-NN.ILERKHYKAGDVI......AFWWDLH-----
AT4G31610.1  ......------------.-.--.-------------.----------GW-EE.FACDQKFRDGDVL......VFKHHGDE----
AT5G60130.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G60130.2  ......------------.-.--.-------------.---------------.-------------......------------
AT2G32645.1  ......------------.-.--.-------------.---------------.--L----------......------------
AT1G32030.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G31420.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G18810.1  ......------------.-.--.-------------.---------------.VVTENILETG---......------------
AT1G78640.1  ......GITVKVYD-NDT.D.TE.HELCLAFQCS---.-----YVLKNGWVKT.FVKRRGLEEGDMI......GLFWECST----
AT1G43171.1  ......DNGFEVQVHDIM.E.DD.LYTVTLKR-----.IDDMKYYFGTGW-ST.MKHSLDLVEGDVL......KLYWDQFE----
AT2G31460.1  ......------------.-.--.-------------.---------------.-------------......---------Y--
AT5G54067.1  ......------------.-.--.-------------.------YFGTGW-ST.MKHSLDLSEGDVL......KLYWSHLDNK--
AT4G31630.1  ......------------.-.--.IKGRDQFYNR---.-GCQ---------DF.FVANGVKNVGDPF......------------
AT5G25475.1  ......------------.-.--.-----IYNGKP--.-------CFSGW-SV.LCRRHNLNIGDSV......V-----------
AT5G25475.2  ......------------.-.--.-----IYNGKP--.-------CFSGW-SV.LCRRHNLNIGDSV......V-----------
AT5G25475.3  ......------------.-.--.-----IYNGKP--.-------CFSGW-SV.LCRRHNLNIGDSV......V-----------
AT5G25475.4  ......------------.-.--.-----IYNGKP--.-------CFSGW-SV.LCRRHNLNIGDSV......V-----------
AT3G53310.1  ......------------.-.--.-G-----------.---------------.-------------......------------
AT5G38500.1  ......------------.-.--.-------------.---------------.-------------......------------
AT5G57720.1  ......------------.-.--.------------V.GKWKDRVVIYKW-NE.MFTRNKVKQGDVI......------------
AT2G24690.1  ......------------.-.--.-------------.---------------.-------------......------I-----
AT1G50220.1  ......DNGFEVQVHDIM.E.DD.LYTVTLKR-----.IDDMKYYFGTGW-ST.MKHSLDLVEGDVQ......KLYWDQFENK--
AT2G24670.1  ......------------.-.--.-------------.---------------.-------------......------------
AT2G24681.1  ......------------.-.--.-------------.-----------W---.-------------......------------
AT2G27410.1  ......------------.-.W-.-------------.---------------.-------------......------------
AT3G46770.2  ......------------.-.--.-------------.---------------.-------N-----......------------
AT4G02870.1  ......------------.G.TL.HELRL--------.---------------.-------------......------------
AT5G46915.1  ......------------.-.--.-------------.---------------.-------------......----H-------
AT3G46770.2  ......------------.-.VI.WKNRSVYLNG---.-----------I-GS.IIRRNHVKPGNEV......VF----------
AT3G46770.1  ......------------.-.VI.WKNRSVYLNG---.-----------I-GS.IIRRNHVKPGNEV......VF----------
AT4G34400.1  ......------------.-.--.---T---------.---------------.-------------......------------
AT2G31862.1  ......------------.-.--.-------------.-------LASRW-KK.VVSDNTLIEGQR-......------------


               130       140       150       160       170                                          
                 |         |         |         |         |                                          
d1na6a1        CKEVNIWVCASTDEEDVIETAIGEVIPGALISGPAGQILGGLSLQQ--ap...................................
AT1G30330.2  LGIRRANRPQT-------------VMPSSVLSSDSMHLGLLAAAAH--a....................................
AT1G30330.1  LGIRRANRPQT-------------VMPSSVLSSDSMHLGLLAAAAH--a....................................
AT5G37020.2  LGIRHATRPQT-------------IVPSSVLSSDSMHIGLLAAAAH--a....................................
AT5G37020.1  LGIRHATRPQT-------------IVPSSVLSSDSMHIGLLAAAAH--a....................................
AT1G19850.1  VGVRRANRQQT-------------ALPSSVLSADSMHIGVLAAAAH--a....................................
AT1G19220.1  LGIRRANRQTP-------------TLSSSVISSDSMHIGILAAAAH--a....................................
AT1G59750.1  VGVRRHMRQQT-------------NIPSSVISSHSMHIGVLATAAH--a....................................
AT1G59750.3  VGVRRHMRQQT-------------NIPSSVISSHSMHIGVLATAAH--a....................................
AT1G59750.2  VGVRRHMRQQT-------------NIPSSVISSHSMHIGVLATAAH--a....................................
AT1G59750.4  VGVRRHMRQQT-------------NIPSSVISSHSMHIGVLATAAH--a....................................
AT2G33860.1  ----GVRRASQIEGTAALSAQYNQNM----------------------nhnnfsevah...........................
AT5G20730.3  LGIRRANRQQP-------------ALSSSVISSDSMHIGVLAAAAH--a....................................
AT5G20730.2  LGIRRANRQQP-------------ALSSSVISSDSMHIGVLAAAAH--a....................................
AT5G20730.1  LGIRRANRQQP-------------ALSSSVISSDSMHIGVLAAAAH--a....................................
AT5G60450.1  LGIRRAARPRN-------------------------------------glp..................................
AT5G62000.4  VGVRRAMRQQG-------------NVPSSVISSHSMHLGVLATAWH--a....................................
AT5G62000.1  VGVRRAMRQQG-------------NVPSSVISSHSMHLGVLATAWH--a....................................
AT5G62000.2  VGVRRAMRQQG-------------NVPSSVISSHSMHLGVLATAWH--a....................................
AT5G62000.3  VGVRRAMRQQG-------------NVPSSVISSHSMHLGVLATAWH--a....................................
AT3G61830.1  VGVRRLARHQS-------------TMPTSVISSQSMHLGVLATASH--a....................................
AT2G46530.2  VGVRRLAKQQS-------------TMPASVISSQSMRLGVLATASH--a....................................
AT2G46530.1  VGVRRLAKQQS-------------TMPASVISSQSMRLGVLATASH--a....................................
AT2G46530.3  VGVRRLAKQQS-------------TMPASVISSQSMRLGVLATASH--a....................................
AT4G23980.1  VGVRRANLQQS-------------SMPSSVISSHSMHLGVLATARH--a....................................
AT4G23980.2  VGVRRANLQQS-------------SMPSSVISSHSMHLGVLATARH--a....................................
AT1G13260.1  ------------------------------------------------qlyigwksrsgs.........................
AT1G25560.1  ------------------------------------------------qlyihwk..............................
AT3G61970.1  ------------------------------------------------klyidwrrrpki.........................
AT1G68840.1  ------------------------------------------------glerqlyidw...........................
AT1G68840.2  ------------------------------------------------glerqlyidw...........................
AT3G25730.1  ------------------------------------------------ffigwksksg...........................
AT2G36080.2  ------------------------------------------------ffigwrrr.............................
AT1G34310.1  VGIRRARHQQG-------------NIPSSIVSIDC-------------mrhg.................................
AT5G06250.1  ------------------------------------------------lfigwrrr.............................
AT5G06250.2  ------------------------------------------------lfigwrrr.............................
AT2G36080.1  ------------------------------------------------ffigwrrr.............................
AT1G34410.1  VGIRRARHQQG-------------NIPSSIVSIDC-------------mrhg.................................
AT3G11580.2  ------------------------------------------------rlfigwrrrg...........................
AT3G11580.1  ------------------------------------------------rlfigwrrrg...........................
AT1G35540.1  VGIRRAGHQQG-------------NIPSSIVSIESMR-----------hgi..................................
AT2G46870.1  ------------------------------------------------gds..................................
AT4G01500.1  ------------------------------------------------.....................................
AT1G35520.1  VGIRRARHQQG-------------------------------------ni...................................
AT1G01030.1  ------------------------------------------------g....................................
AT4G30080.1  VGIRRA------------------------------------------kr...................................
AT2G28350.1  VGIR--------------------------------------------ra...................................
AT1G34390.1  VGIRRAGHQQG-------------NIPSSIISIESMR-----------hgv..................................
AT1G35240.1  VGIRRARHQQG-------------NIPSSIVSIDC-------------mrhg.................................
AT1G77850.1  IGVRR-------------------------------------------tpisss...............................
AT1G34170.2  FGIRRAKHQQ--------------------------------------g....................................
AT1G34170.1  FGIRRAKHQQ--------------------------------------g....................................
AT1G34170.3  FGIRRAKHQQ--------------------------------------g....................................
AT1G51120.1  ------------------------------------------------tc...................................
AT1G50680.1  ------------------------------------------------ytc..................................
AT5G42700.1  ------------------------------------------------vrrtafkvyitrvgsc.....................
AT1G16640.1  ------------------------------------------------viiyghnmc............................
AT4G31690.1  ------------------------------------------------egdmvfhvtalgpscceiqyp................
AT4G01580.1  ------------------------------------------------wsefaeahsieeghfllfeykknssfrviifnasac.
AT5G58280.1  ------------------------------------------------kiyvfkg..............................
AT2G24690.1  ------------------------------------------------vlslcfeey............................
AT1G43950.1  ------------------------------------------------vgi..................................
AT4G31680.1  ------------------------------------------------rltegwkefveahdlrirdfvvfrhegdmvfhvtalg
AT3G18960.1  ------------------------------------------------sefaeahsieeghfllfeykenssfrviifnvsac..
AT4G31640.1  ------------------------------------------------llrnpkipvfrlc........................
AT3G19184.1  ------------------------------------------------arttfkvyiirvn........................
AT3G53310.1  ------------------------------------------------ydghrtfevsvfdr.......................
AT3G26790.1  IQARK-------------------------------------------ase..................................
AT1G49480.1  ------------------------------------------------vlevtafrvn...........................
AT3G24650.1  ------------------------------------------------vkcgky...............................
AT4G31640.1  ------------------------------------------------gdmlfhvtaigpsccevqy..................
AT5G18000.1  ------------------------------------------------ssfkmvlrvpwgrswqvkisknpnfhymedrgwnqfv
AT3G18990.1  ------------------------------------------------vlkvtafrvn...........................
AT2G24645.1  ------------------------------------------------tlvlcllsnepeee.......................
AT3G18990.1  ------------------------------------------------kadnkiwfqdgwqefvdrysirigyllifryegnsaf
AT4G00260.1  ---R--------------------------------------------qkpsngtvyvrggwvsfcdanglkagdnytfklikra
AT1G26680.1  ------------------------------------------------vgtgekpvlslcpae......................
AT2G24690.1  ------------------------------------------------edrtpvlsiks..........................
AT4G00260.1  ------------------------------------------------likkratlvlrlipnepe...................
AT5G66980.1  ------------------------------------------------svtifandgc...........................
AT4G34400.1  ------------------------------------------------gahifevsifr..........................
AT2G24700.1  IQL---------------------------------------------fpm..................................
AT3G06220.1  ------------------------------------------------evsiygrgsc...........................
AT4G31680.1  ------------------------------------------------vfivggwkslcsenklkggdsctfkllqnaktpvfql
AT5G60130.2  ------------------------------------------------fhfciye..............................
AT2G35310.1  ------------------------------------------------rftvnifmqdgkeml......................
AT4G33280.1  ------------------------------------------------sefevlvfd............................
AT3G06160.1  ------------------------------------------------evsiygrgdc...........................
AT5G09780.1  ------------------------------------------------gnswkvkisknprfyfmeksgwekfvidnalgdhefl
AT1G49475.1  ------------------------------------------------wsefaeahslsdghflffhyegdscfrvvifdvs...
AT3G06160.2  ------------------------------------------------evsiygrgdc...........................
AT4G31690.1  ------------------------------------------------kaktpvfqlc...........................
AT2G24650.1  ------------------------------------------------slqrdkkgtmslgkgwkefaeandfklgesftmelvw
AT2G24645.1  ------------------------------------------------ikrggtlvlrllpkgae....................
AT2G24650.1  ------------------------------------------------eliwedtnpvlsllrt.....................
AT4G31615.1  ------------------------------------------------pllrlcydt............................
AT2G24700.1  ------------------------------------------------pvlq.................................
AT4G31620.1  ------------------------------------------------gttpmlkfcs...........................
AT1G26680.1  ------------------------------------------------gdsfkfklvgtwkkpvlslcptq..............
AT4G32010.1  MGYR--------------------------------------------ka...................................
AT2G24680.1  ------------------------------------------------etpvlsfcst...........................
AT3G17010.1  ------------------------------------------------trgwdlfvsdnalgqnefitfthrgnmvfhvniyeqn
AT2G24680.2  ------------------------------------------------etpvlsfcst...........................
AT5G60142.1  ------------------------------------------------gswcfnfciygratc......................
AT4G31630.1  ------------------------------------------------lvqsgikpvlqlcpn......................
AT5G57720.1  ------------------------------------------------sqeviislqegwvkfvkdnglidrdfllftydgsrsf
AT2G24690.1  ------------------------------------------------tnhvfkf..............................
AT4G31650.1  ------------------------------------------------kgdmffdvtalgsscwes...................
AT4G31660.1  ------------------------------------------------egslvfhvtalgpscceiqy.................
AT4G21550.1  LGF---------------------------------------------rk...................................
AT2G24680.1  ------------------------------------------------nleyideqdttpvfkfcsn..................
AT2G24650.1  LS----------------------------------------------lcpadcsid............................
AT2G24680.2  ------------------------------------------------nleyideqdttpvfkfcsn..................
AT5G18090.1  ------------------------------------------------qtrfcagwirlakelgleigdvctftlikptemlvrv
AT1G26680.1  ------------------------------------------------khgppvmyl............................
AT2G30470.1  ------------------------------------------------gklim................................
AT2G24645.1  ------------------------------------------------msfhvtmlgpscceiqyg...................
AT4G31650.1  ------------------------------------------------vaggwkslctesklevgdsctfkllhnakmpvfrlcs
AT2G24650.1  ------------------------------------------------lvlsfcpt.............................
AT2G16210.2  ------------------------------------------------kmhftvnifkldgkemmq...................
AT5G18000.1  ------------------------------------------------kihyprgkkswdvtyvvtdvqsrfsggwsrlakelgl
AT1G26680.1  ------------------------------------------------egemvfhvtalgpscceiqy.................
AT2G16210.1  ------------------------------------------------kmhftvnifkldgkemmq...................
AT2G24700.1  ------------------------------------------------egelvfhvtalgpscceiqy.................
AT1G28300.1  ------------------------------------------------a....................................
AT4G33280.1  ------------------------------------------------plhlnvyifrgee........................
AT5G60140.1  ------------------------------------------------hffnfsifdh...........................
AT3G17010.1  ------------------------------------------------gswkvlclvreirtifsggysklarefplmvgdkctf
AT1G26680.1  ------------------------------------------------ltflkkgwtsfcqvnrikagdsfkfklvgtwnkpvls
AT4G31610.1  ------------------------------------------------gagsewfylrrgwremceangvgvndsfklelvwega
AT2G24645.1  ------------------------------------------------lrlvdykrkrlgmvggwkgfiqangvkanesimleli
AT4G31610.1  ------------------------------------------------rpvlwlcpqe...........................
AT5G18090.1  -----------------------------I------------------crnpsfyfmekkgwdqflsdnglgndefltfthqgnm
AT4G31615.1  ------------------------------------------------tpmlkfcsksk..........................
AT2G24650.1  ------------------------------------------------vgnlvfhvsnlgpnyyeie..................
AT2G24650.1  ------------------------------------------------kgtmslgkgwkefvkansletgftlkliweettpvls
AT4G00260.1  ------------------------------------------------lafhvtllgpsccgiqyg...................
AT2G24680.1  ------------------------------------------------eai..................................
AT5G60130.1  ------------------------------------------------hfciyehr.............................
AT2G24680.2  ------------------------------------------------eai..................................
AT5G24050.1  ------------------------------------------------tlwsfrccgilcfameq....................
AT4G31650.1  ------------------------------------------------kngeewpvtllmdkrytrmvlgsglrefcnaigvkay
AT4G03170.1  CDFVTVWMF---------------------------------------rhiktrklcfai.........................
AT4G31650.1  ------------------------------------------------tktplllf.............................
AT5G32460.1  ------------------------------------------------rhegnllfhvtpfglsfc...................
AT2G24650.1  ------------------------------------L-----------algngwegfceangvklgqtftlefvneqdttttpvl
AT1G05920.1  ------------------------------------------------sfvlrgewsnvvetnglkegdkislwsfrsndilcfa
AT5G25470.1  ---------------F--------------------------------mieedwdefvddnhlgpndnvffrhddkmflevqifk
AT5G25470.2  ---------------F--------------------------------mieedwdefvddnhlgpndnvffrhddkmflevqifk
AT3G24850.1  ------------------------------------------------nisvwsfrcrgvlcfameq..................
AT4G31620.1  ------------------------------------------------lvrngtrpllqlcfkv.....................
AT4G31615.1  ------------------------------------------------nfstvhslqdddvvifreigdmtfhvtasgrsfc...
AT2G24696.1  ------------------------------------------------restgrmslgrgwvdfakanrlkigeyftlesiwend
AT1G26680.1  ------------------------------------------------vlrhdksgmqtfvqsgwrrfcsengirqgqytfklvr
AT2G24700.1  ------------------------------------------------wrtsllmdkigtmslgrgskgfcevngvemnesfile
AT2G35310.1  ------------------------------------------------fsfikqhelilfv........................
AT5G32460.1  ------------------------------------------------lklh.................................
AT2G24681.1  ------------------------------------------------lgsgwkgiceangvntgeaftleyideqe........
AT3G46770.1  ------------------------------------------------kisgkplprkvtvksvssgniwrmemkangntvflrd
AT1G05930.1  MGVGAILVDQRSQKWSVILKRWGQ------------------------nyflscgwndvvkanklkagddiclwafrcdgvlcfa
AT5G25475.1  ---------------FMIEEDWNEF-----------------------vddnhlgpndnlfikhdetmnlevqifknng......
AT5G25475.2  ---------------FMIEEDWNEF-----------------------vddnhlgpndnlfikhdetmnlevqifknng......
AT5G25475.3  ---------------FMIEEDWNEF-----------------------vddnhlgpndnlfikhdetmnlevqifknng......
AT4G31620.1  ------------------------------------------------legktgltklkltsdasdriwdvrlngrrfaggwddf
AT4G00260.1  ------------------------------------------------eeetscvlkfcs.........................
AT4G31680.1  -------------------------------LVDKDRVEWSMK-----lqvdnrggmhifggndwksfcaanevgagesltleli
AT1G08985.1  ------------------------------------------------ywqntk...............................
AT1G20600.1  ------------------------------------------------vadygllktsdf.........................
AT5G66980.1  ------------------------------------------------shemiltnkclfefivps...................
AT2G33720.1  ------------------------------------------------lhfcvls..............................
AT3G49610.1  ------------------------------------------------psesrllipfnkllrndfltpeesraiaidkeeeeed
AT5G09780.1  ------------------------------------------------twkvvfvvkergqifsggwkrlckeypvvfgdtckft
AT2G31720.1  ------------------------------------------------advivvnskglqrklklkrwdmtstsnyvlglgwnkv
AT1G10455.1  ------------------------------------------------wdkltr...............................
AT4G31630.1  ------------------------------------------------drnwdvkldgarfaggwkdfsvshsvrdddllsfrhd
AT4G31660.1  ------------------------------------------------lilkfrnssrtfymrggwtsfsmsmgln.........
AT2G24696.1  ------------------------------------------------emdlkfdknldsfcitrgwrhfcdeng..........
AT5G60140.1  -----------------------------I------------------tvvdemgalekaikiqkngcifvkgfgsfirrnkmkm
AT2G16210.1  ------------------------------------------------fgafsggwrrvvkeyplavgdtckftfikpkelllvv
AT4G03160.1  ------------------------------------------------ltsgwknfvksyklekhvdfltiwmfrhkktreicfa
AT5G25470.1  ------------------------------------------------kyglkfgphlspmhyllpgdkingstkiygggsapcf
AT5G25470.2  ------------------------------------------------kyglkfgphlspmhyllpgdkingstkiygggsapcf
AT5G32460.1  ------------------------------------------------ktpvlr...............................
AT2G24696.1  ------------------------------------------------cgwryfcesngvkigksftlecmykydtrpvfkfcpk
AT2G21920.1  ------------------------------------------------ysvilksrnttndfvlasgwsimkhsldlqegddikl
AT5G38490.1  ------------------------------------------------vgtvlvnqrfqkwglrfkiwamekdsghgtlnytlnw
AT5G25475.4  ------------NELFMIEEDWNEFVDDNH------------------lgpndnlfikhdetmnlevqifknng...........
AT4G05630.1  ------------------------------------------------iirqdgnnfkfhgwndilkrkhykagdtiafwwd...
AT1G51970.1  ------------------------------------------------nlgngvevkvhiieegpesddytltlvkcrgncmfrg
AT1G78640.1  ------------------------------------------------tfm..................................
AT5G60142.1  -----------------------------------L------------eknfgklkrkvkgqtikgfrsiirrnnvklndkvice
AT4G31690.1  ----------------------------KIILVDKDRAEWSMM-----lkvdsrgavyiiggndwksfcaanevgageslaleli
AT5G32460.1  ------------------------------------------------cflrlilvqngktpvlr....................
AT4G12617.1  ------------------------------------------------h....................................
AT4G31610.1  ------------------------------------------------vfhvavvsp............................
AT5G60130.1  ------------------------------------------------pesitlvdplvkkfgtlekqikiqtngsvfvkgfgsi
AT5G60130.2  ------------------------------------------------pesitlvdplvkkfgtlekqikiqtngsvfvkgfgsi
AT2G32645.1  ------------------------------------------------rkwkmkgnwnyvfvkgwndvldanksnsfkekdvfpl
AT1G32030.1  ------------------------------------------------kpvqsrllmpfntlirndfltpvelrilleleddtdg
AT2G31420.1  ------------------------------------------------khvvylkkwngntvwkyvlshgwnnvidkkifkvndv
AT2G18810.1  ------------------------------------------------trlrlwsfhspdmlffalvlsdpd.............
AT1G78640.1  ------------------------------------------------sklhfsvl.............................
AT1G43171.1  ------------------------------------------------n....................................
AT2G31460.1  ------------------------------------------------vlelhkwtksyafvkgwnkvvdkndktfkvgdvfslw
AT5G54067.1  ------------------------------------------------fvvlnf...............................
AT4G31630.1  ------------------------------------------------tlevirggpspilkics....................
AT5G25475.1  ------------------------------------------------celersg..............................
AT5G25475.2  ------------------------------------------------celersg..............................
AT5G25475.3  ------------------------------------------------celersg..............................
AT5G25475.4  ------------------------------------------------celersg..............................
AT3G53310.1  ------------------------------------------------lrgkwadkrvcfkgwdricrrnrlkkhqdtvecellh
AT5G38500.1  --V---------------------------------------------gtilvcqakqededkddedigagtilvnqrfkmwglr
AT5G57720.1  ------------------------------------------------iceiire..............................
AT2G24690.1  ------------------------------------------------ensmnkpgeitvlgkdgakwlvslllerrgrm.....
AT1G50220.1  ------------------------------------------------fivlnfq..............................
AT2G24670.1  --------------K---------------------------------raieedanrvrkegvdailvdshlrefpvnlrlrdmr
AT2G24681.1  ------------------------------------------------kdlsisnglksgksftlelilengtpmlslv......
AT2G27410.1  ------------------------------------------------kmkgnwiyvfvkgwknvldacktlfkeddvyplwsfr
AT3G46770.2  ------------------------------------------------vtepiflefefdgygvfhfcvyey.............
AT4G02870.1  ------------------------------------------------eyqrqyglahgwqedfvrrrhlkqkdeigllwdfsss
AT5G46915.1  ------------------------------------------------hpngkkfwnvvylgsygafsggwqclvkeyplvvgdi
AT3G46770.2  ------------------------------------------------elkmvngy.............................
AT3G46770.1  ------------------------------------------------elkmvngy.............................
AT4G34400.1  ------------------------------------------------akwkdqrvcikrwmrickrnklkkedrilcellrkgt
AT2G31862.1  ------------------------------------------------irlwsfhslakly........................


                                                                                           
                                                                                           
d1na6a1        ............................................................................
AT1G30330.2  ............................................................................
AT1G30330.1  ............................................................................
AT5G37020.2  ............................................................................
AT5G37020.1  ............................................................................
AT1G19850.1  ............................................................................
AT1G19220.1  ............................................................................
AT1G59750.1  ............................................................................
AT1G59750.3  ............................................................................
AT1G59750.2  ............................................................................
AT1G59750.4  ............................................................................
AT2G33860.1  ............................................................................
AT5G20730.3  ............................................................................
AT5G20730.2  ............................................................................
AT5G20730.1  ............................................................................
AT5G60450.1  ............................................................................
AT5G62000.4  ............................................................................
AT5G62000.1  ............................................................................
AT5G62000.2  ............................................................................
AT5G62000.3  ............................................................................
AT3G61830.1  ............................................................................
AT2G46530.2  ............................................................................
AT2G46530.1  ............................................................................
AT2G46530.3  ............................................................................
AT4G23980.1  ............................................................................
AT4G23980.2  ............................................................................
AT1G13260.1  ............................................................................
AT1G25560.1  ............................................................................
AT3G61970.1  ............................................................................
AT1G68840.1  ............................................................................
AT1G68840.2  ............................................................................
AT3G25730.1  ............................................................................
AT2G36080.2  ............................................................................
AT1G34310.1  ............................................................................
AT5G06250.1  ............................................................................
AT5G06250.2  ............................................................................
AT2G36080.1  ............................................................................
AT1G34410.1  ............................................................................
AT3G11580.2  ............................................................................
AT3G11580.1  ............................................................................
AT1G35540.1  ............................................................................
AT2G46870.1  ............................................................................
AT4G01500.1  ............................................................................
AT1G35520.1  ............................................................................
AT1G01030.1  ............................................................................
AT4G30080.1  ............................................................................
AT2G28350.1  ............................................................................
AT1G34390.1  ............................................................................
AT1G35240.1  ............................................................................
AT1G77850.1  ............................................................................
AT1G34170.2  ............................................................................
AT1G34170.1  ............................................................................
AT1G34170.3  ............................................................................
AT1G51120.1  ............................................................................
AT1G50680.1  ............................................................................
AT5G42700.1  ............................................................................
AT1G16640.1  ............................................................................
AT4G31690.1  ............................................................................
AT4G01580.1  ............................................................................
AT5G58280.1  ............................................................................
AT2G24690.1  ............................................................................
AT1G43950.1  ............................................................................
AT4G31680.1  pscceiqyp...................................................................
AT3G18960.1  ............................................................................
AT4G31640.1  ............................................................................
AT3G19184.1  ............................................................................
AT3G53310.1  ............................................................................
AT3G26790.1  ............................................................................
AT1G49480.1  ............................................................................
AT3G24650.1  ............................................................................
AT4G31640.1  ............................................................................
AT5G18000.1  ndnglgeneyltftheanmcfnvtifeadgtem...........................................
AT3G18990.1  ............................................................................
AT2G24645.1  ............................................................................
AT3G18990.1  svyifnl.....................................................................
AT4G00260.1  gtlvlrllpnepk...............................................................
AT1G26680.1  ............................................................................
AT2G24690.1  ............................................................................
AT4G00260.1  ............................................................................
AT5G66980.1  ............................................................................
AT4G34400.1  ............................................................................
AT2G24700.1  ............................................................................
AT3G06220.1  ............................................................................
AT4G31680.1  c...........................................................................
AT5G60130.2  ............................................................................
AT2G35310.1  ............................................................................
AT4G33280.1  ............................................................................
AT3G06160.1  ............................................................................
AT5G09780.1  tfthkgqmsftvkifnkdgkemmq....................................................
AT1G49475.1  ............................................................................
AT3G06160.2  ............................................................................
AT4G31690.1  ............................................................................
AT2G24650.1  edttpmlsllrt................................................................
AT2G24645.1  ............................................................................
AT2G24650.1  ............................................................................
AT4G31615.1  ............................................................................
AT2G24700.1  ............................................................................
AT4G31620.1  ............................................................................
AT1G26680.1  ............................................................................
AT4G32010.1  ............................................................................
AT2G24680.1  ............................................................................
AT3G17010.1  glem........................................................................
AT2G24680.2  ............................................................................
AT5G60142.1  ............................................................................
AT4G31630.1  ............................................................................
AT5G57720.1  wvrihrn.....................................................................
AT2G24690.1  ............................................................................
AT4G31650.1  ............................................................................
AT4G31660.1  ............................................................................
AT4G21550.1  ............................................................................
AT2G24680.1  ............................................................................
AT2G24650.1  ............................................................................
AT2G24680.2  ............................................................................
AT5G18090.1  ............................................................................
AT1G26680.1  ............................................................................
AT2G30470.1  ............................................................................
AT2G24645.1  ............................................................................
AT4G31650.1  ............................................................................
AT2G24650.1  ............................................................................
AT2G16210.2  ............................................................................
AT5G18000.1  lvgdvctfklikptemrvkv........................................................
AT1G26680.1  ............................................................................
AT2G16210.1  ............................................................................
AT2G24700.1  ............................................................................
AT1G28300.1  ............................................................................
AT4G33280.1  ............................................................................
AT5G60140.1  ............................................................................
AT3G17010.1  klikpfefvlltsk..............................................................
AT1G26680.1  lcp.........................................................................
AT4G31610.1  npmfkfcskienhe..............................................................
AT2G24645.1  weeetscvlkfcs...............................................................
AT4G31610.1  ............................................................................
AT5G18090.1  cftvdiyqidgke...............................................................
AT4G31615.1  ............................................................................
AT2G24650.1  ............................................................................
AT2G24650.1  lc..........................................................................
AT4G00260.1  ............................................................................
AT2G24680.1  ............................................................................
AT5G60130.1  ............................................................................
AT2G24680.2  ............................................................................
AT5G24050.1  ............................................................................
AT4G31650.1  esvvlelvweetttlpmfkfc.......................................................
AT4G03170.1  ............................................................................
AT4G31650.1  ............................................................................
AT5G32460.1  ............................................................................
AT2G24650.1  kf..........................................................................
AT1G05920.1  lvpp........................................................................
AT5G25470.1  nd..........................................................................
AT5G25470.2  nd..........................................................................
AT3G24850.1  ............................................................................
AT4G31620.1  ............................................................................
AT4G31615.1  ............................................................................
AT2G24696.1  spils.......................................................................
AT1G26680.1  ksappvirlcraka..............................................................
AT2G24700.1  liwedtvpllkfcs..............................................................
AT2G35310.1  ............................................................................
AT5G32460.1  ............................................................................
AT2G24681.1  ............................................................................
AT3G46770.1  gwkkivkdenvtepiflefefdgygvfhfcvyey..........................................
AT1G05930.1  mr..........................................................................
AT5G25475.1  ............................................................................
AT5G25475.2  ............................................................................
AT5G25475.3  ............................................................................
AT4G31620.1  saahclrdddvlvfrldvkmvfhvtpsg................................................
AT4G00260.1  ............................................................................
AT4G31680.1  rgglsplfkffskie.............................................................
AT1G08985.1  ............................................................................
AT1G20600.1  ............................................................................
AT5G66980.1  ............................................................................
AT2G33720.1  ............................................................................
AT3G49610.1  tkkigvktiivnqfskewslrfliwvmkkkksgngtlyytlnrgwngvvsgnklkandnislwtfrcggvlcfale
AT5G09780.1  litplelllvv.................................................................
AT2G31720.1  vtdnilqrgtrlriwsfhspdmlffafvlsdpd...........................................
AT1G10455.1  ............................................................................
AT4G31630.1  ggmvfhvspfgrs...............................................................
AT4G31660.1  ............................................................................
AT2G24696.1  ............................................................................
AT5G60140.1  tdkmicelkrtggnlvhtik........................................................
AT2G16210.1  ............................................................................
AT4G03160.1  i...........................................................................
AT5G25470.1  ngwvdlcrkynlktgdsmvcelersgel................................................
AT5G25470.2  ngwvdlcrkynlktgdsmvcelersgel................................................
AT5G32460.1  ............................................................................
AT2G24696.1  ............................................................................
AT2G21920.1  fwd.........................................................................
AT5G38490.1  gwndvvkssslkvgdkislwtfrcrgvlcfald...........................................
AT5G25475.4  ............................................................................
AT4G05630.1  ............................................................................
AT1G51970.1  gwynmvkakcykpddeiglmwdkwsrrflfhh............................................
AT1G78640.1  ............................................................................
AT5G60142.1  lekemdglvreikvhvir..........................................................
AT4G31690.1  qggvllnq....................................................................
AT5G32460.1  ............................................................................
AT4G12617.1  ............................................................................
AT4G31610.1  ............................................................................
AT5G60130.1  irrnkvkttdkmifeikktgdn......................................................
AT5G60130.2  irrnkvkttdkmifeikktgdn......................................................
AT2G32645.1  wsfrsgtgklc.................................................................
AT1G32030.1  vgatlvdpwevkwgvilkkremkkysgkgslnyaiicgwndiveanvlekdddisiwsfrrgrn............
AT2G31420.1  ieiwsfrdgsg.................................................................
AT2G18810.1  ............................................................................
AT1G78640.1  ............................................................................
AT1G43171.1  ............................................................................
AT2G31460.1  vfrcgg......................................................................
AT5G54067.1  ............................................................................
AT4G31630.1  ............................................................................
AT5G25475.1  ............................................................................
AT5G25475.2  ............................................................................
AT5G25475.3  ............................................................................
AT5G25475.4  ............................................................................
AT3G53310.1  ddqkmvhsirv.................................................................
AT5G38500.1  fkiwgmekdsghgtlnyilnwdwndvvkgnslkagdniglwtfrcrgvlcfald......................
AT5G57720.1  ............................................................................
AT2G24690.1  ............................................................................
AT1G50220.1  ............................................................................
AT2G24670.1  gillynlvagwnqvvtdclleentnirlwsfhaddtlyfal...................................
AT2G24681.1  ............................................................................
AT2G27410.1  sgtgklc.....................................................................
AT3G46770.2  ............................................................................
AT4G02870.1  rlqfgv......................................................................
AT5G46915.1  y...........................................................................
AT3G46770.2  ............................................................................
AT3G46770.1  ............................................................................
AT4G34400.1  fv..........................................................................
AT2G31862.1  ............................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]