SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1                          s..................................................................
cwb_MDP0000153538|PACid:22660264 lp.................................................................
cwb_MDP0000268306|PACid:22630740 lpa................................................................
cwb_MDP0000319957|PACid:22645199 lp.................................................................
cwb_MDP0000232417|PACid:22660261 lpa................................................................
cwb_MDP0000211459|PACid:22629500 fr.................................................................
cwb_MDP0000143749|PACid:22644960 dfg................................................................
cwb_MDP0000412781|PACid:22651617 pt.................................................................
cwb_MDP0000876321|PACid:22663258 l..................................................................
cwb_MDP0000225980|PACid:22683343 pt.................................................................
cwb_MDP0000185253|PACid:22621202 la.................................................................
cwb_MDP0000929655|PACid:22661337 lp.................................................................
cwb_MDP0000886637|PACid:22641953 lk.................................................................
cwb_MDP0000179650|PACid:22675203 st.................................................................
cwb_MDP0000173151|PACid:22632672 tt.................................................................
cwb_MDP0000294251|PACid:22639202 fl.................................................................
cwb_MDP0000134824|PACid:22673229 la.................................................................
cwb_MDP0000194603|PACid:22651584 ap.................................................................
cwb_MDP0000258032|PACid:22620805 v..................................................................
cwb_MDP0000139073|PACid:22644421 cl.................................................................
cwb_MDP0000310875|PACid:22641004 v..................................................................
cwb_MDP0000550049|PACid:22646916 fl.................................................................
cwb_MDP0000123466|PACid:22652651 rt.................................................................
cwb_MDP0000138853|PACid:22674896 prrt...............................................................
cwb_MDP0000229742|PACid:22674723 ekep...............................................................
cwb_MDP0000214352|PACid:22681236 rt.................................................................
cwb_MDP0000138860|PACid:22643076 rt.................................................................
cwb_MDP0000256621|PACid:22648903 erq................................................................
cwb_MDP0000939633|PACid:22667205 q..................................................................
cwb_MDP0000138163|PACid:22622470 e..................................................................
cwb_MDP0000288808|PACid:22628543 re.................................................................
cwb_MDP0000221322|PACid:22644524 nqe................................................................
cwb_MDP0000131481|PACid:22630798 deek...............................................................
cwb_MDP0000247623|PACid:22644692 el.................................................................
cwb_MDP0000232116|PACid:22646641 ler................................................................
cwb_MDP0000945267|PACid:22621253 l..................................................................
cwb_MDP0000750392|PACid:22633787 kp.................................................................
cwb_MDP0000128924|PACid:22664801 q..................................................................
cwb_MDP0000223137|PACid:22662915 el.................................................................
cwb_MDP0000485280|PACid:22659457 l..................................................................
cwb_MDP0000153589|PACid:22644982 el.................................................................
cwb_MDP0000321569|PACid:22635836 el.................................................................
cwb_MDP0000207722|PACid:22671640 l..................................................................
cwb_MDP0000162363|PACid:22677783 l..................................................................
cwb_MDP0000534780|PACid:22663807 l..................................................................
cwb_MDP0000526584|PACid:22649377 l..................................................................
cwb_MDP0000259062|PACid:22632961 l..................................................................
cwb_MDP0000555456|PACid:22659471 fepdnpfcrvvlrpsylyrgcim............................................
cwb_MDP0000165802|PACid:22635978 l..................................................................
cwb_MDP0000291591|PACid:22681743 wrvrsffkplvhddfsrhlclpplfmenfngrpp.................................
cwb_MDP0000238744|PACid:22674921 epvnpfcrvvlrpsylyrgcim.............................................
cwb_MDP0000314333|PACid:22663787 lepqfpsfvkslvrshvascfwmg...........................................
cwb_MDP0000161022|PACid:22675604 fksekphfkvamqpsyifgnlilpagfakrhlmhqpxgnailrlpdggtwcvklkiyekgkvrfqr.
cwb_MDP0000123407|PACid:22657458 fsssnpyfvriiksfnisgsytlnipykfsvahl.................................
cwb_MDP0000226894|PACid:22677142 fspttphffkiipvetsrcrklripkkfvnnygenlsnpvhfklpsgaew.................
cwb_MDP0000124774|PACid:22657498 vrsphffafysadlsserlkipdrfmrhmegrtsglvllfgpsgsawsveliqqngglflhhg....
cwb_MDP0000309680|PACid:22638461 ll.................................................................
cwb_MDP0000258417|PACid:22673144 rqfpsfvkslvrshvascfwmg.............................................
cwb_MDP0000227080|PACid:22645787 fspttphffkiipvetsrcrklripkkfmnnygenlsnpvhfklpsg....................
cwb_MDP0000123407|PACid:22657458 vrsphffafysadlsserlkipxrfmrhmegrtsglvllfgpsgsawsveliqqngglflhhg....
cwb_MDP0000238744|PACid:22674921 ppyfhklivsstlqakqlripesfvqkfrnelstiatltvpdghv......................
cwb_MDP0000316701|PACid:22677141 sattphffkiipneasrytklripekfvnkygenisnpillklpsgveweiqvrtcngdiwfdkgwp
cwb_MDP0000549056|PACid:22637942 ell................................................................
cwb_MDP0000192438|PACid:22632653 yspt...............................................................
cwb_MDP0000312598|PACid:22676419 vrsphffafysadlsserlkiperfmrhmegrtsglvslfgpsgsewsveliqqngglflhr.....
cwb_MDP0000236750|PACid:22623596 sattphffkiipneasrytklripekfvnkygenisnpillklpsgveweiqvrtcngdiwfdkgwp
cwb_MDP0000555456|PACid:22659471 pyfhklivsstlqakqlripesfvqkfrndlstiakltvpdgrvwhvgik.................
cwb_MDP0000249417|PACid:22680044 lgsdhptlvktmlqshvtggfwlglqvsfcknhlpkgdevmxlidedgdeyptiylarktgls....
cwb_MDP0000123407|PACid:22657458 ftscfpnfvkimkkfnisgsytlkvpyqfstqylpnykteillr.......................
cwb_MDP0000316701|PACid:22677141 fksekphfkvvmqpsyifhnlilpsefakrhlmqqptgsailcvp......................
cwb_MDP0000155544|PACid:22633491 dxrfpvllkvmlpshvtggfwlglpkkfccenlpkqdt.............................
cwb_MDP0000146397|PACid:22625573 fsstiphffkvilddtsrdtklkvpmkfvmkygeelsspvylrlpcgseweielrrc..........
cwb_MDP0000236656|PACid:22666211 rqfpsfvkslvrshvascfwmg.............................................
cwb_MDP0000236750|PACid:22623596 fksekphfkvvmqpsyifhnlilpsefakrhlmqqptgsailcvp......................
cwb_MDP0000819543|PACid:22662298 lddkfpsllkvmmpsevsggfylnlakkfrseympkqdsmivledengkefgtkylvekgg......
cwb_MDP0000185981|PACid:22654058 ekkptffqiickgfnteklt...............................................
cwb_MDP0000298218|PACid:22631518 fsstiphffkvilddtsrdtklkvpmkfvmkygeelsspvylrlpcgseweielrrc..........
cwb_MDP0000241245|PACid:22642523 eyrnpffkvplrfsythygylalpvmfvkahltvrpsdatlrvsdgttwpvkvgfdvagh.......
cwb_MDP0000267885|PACid:22661160 vp.................................................................
cwb_MDP0000515096|PACid:22639161 asffkimigdqlskvlflppkfaptvsalvnkkavledsrgwqwkvtisrvdgslafqq........
cwb_MDP0000127640|PACid:22634716 vp.................................................................
cwb_MDP0000229344|PACid:22665895 vp.................................................................
cwb_MDP0000176581|PACid:22669985 mlktlpikkrknmripkkfvmkygegisnpvclklpsgsewivelrrwdgevwfdngwpe.......
cwb_MDP0000192438|PACid:22632653 ftseypflkvamqptylqycylslrskfvkkhlsktcdhvflrrsdgrtwrvkleqye.........
cwb_MDP0000298218|PACid:22631518 fksekphfkvamqpsyifgnlvntlaqvlpagfakrhlmhqphgnailrlp................
cwb_MDP0000320006|PACid:22667113 gsdyptmvkpmlqshvtggfwlgl...........................................
cwb_MDP0000161022|PACid:22675604 fkseypsfxvaixpxyihssylglpyefvrthlnkqrssn...........................
cwb_MDP0000309784|PACid:22654675 sv.................................................................
cwb_MDP0000189426|PACid:22643793 dekkpsffrilvagynteyl...............................................
cwb_MDP0000304769|PACid:22644689 p..................................................................
cwb_MDP0000309784|PACid:22654675 mqpsyifnqlilpsefakry...............................................
cwb_MDP0000126738|PACid:22651879 ppavphffkiilndtsrdkkikippkfvtkygdnms...............................
cwb_MDP0000302532|PACid:22624442 akaptffkivldkalrdgrleippafvmknedcladsvflkdptgrvwrieltrrcgkvwlqkgw..
cwb_MDP0000212684|PACid:22647103 letenpcflhflnhrnrlynvripkqlaldegltdkdsv............................
cwb_MDP0000214729|PACid:22665914 letenpcflhflnhrnrlynvripkqlaldegltdkdsv............................
cwb_MDP0000125949|PACid:22671191 lkaphflvvipksictqtklripnkffrkygddlsnpvflklp........................
cwb_MDP0000237202|PACid:22655382 kn.................................................................
cwb_MDP0000212684|PACid:22647103 kpkkps.............................................................
cwb_MDP0000214729|PACid:22665914 kpkkps.............................................................
cwb_MDP0000283274|PACid:22663974 lgsdhptlvktmlqshvtggfwlglqvsfcknhlpkgdevmxlidedgdeyptiylarktgls....
cwb_MDP0000227080|PACid:22645787 fksenphfkvamqpsyifnqlilpsefakry....................................
cwb_MDP0000242456|PACid:22650200 kavlrippkfvknfngwspckcvlrgpsglrrtveleerxnglffnx....................
cwb_MDP0000241386|PACid:22625419 sekpffevviakanvkpsyqmvipakfqqtlpscsihtvlmfggknwemtytcgsgqr.........
cwb_MDP0000302532|PACid:22624442 fkssnpflvvkmqpsyiasqlrlsgsfvrrhicargvcdmnleissrrswpvkcrvgvyrrkqyarv
cwb_MDP0000125949|PACid:22671191 fksdnpsfivpmkxtyingysvwlpsklcihmrrlgkhpgaitlrvl....................
cwb_MDP0000291592|PACid:22681744 nfngrppckctlrgpsgeswtvglegrkdgkfffrkgwrh...........................
cwb_MDP0000189426|PACid:22643793 fkskfphfksvirtss...................................................
cwb_MDP0000312598|PACid:22676419 wkmstnipykfsvahl...................................................
cwb_MDP0000252727|PACid:22647791 fksenpcfmetlkkhqeyclvipkklaiseglmsmgtxmlrn.........................
cwb_MDP0000252726|PACid:22647790 ivkrlstgcrqigrxripptfvrknfnrrslskcdlkgptgirrtvefedrengiffrn........
cwb_MDP0000125949|PACid:22671191 lqylgakftkehflkwnyhqvilrvsdgrtwpvklskrqknmvrlqng...................
cwb_MDP0000200376|PACid:22644424 ldprfpsllkvmmpsqvsggfclnlatkfrrehmpkqd.............................
cwb_MDP0000263654|PACid:22620434 pvfvksmirsnvsscfcltlpkqfcqlylplhdatltleveggekyrvtflgerr............
cwb_MDP0000197534|PACid:22639927 fe.................................................................
cwb_MDP0000199365|PACid:22642971 si.................................................................
cwb_MDP0000314836|PACid:22664815 rkffkplt...........................................................
cwb_MDP0000179251|PACid:22658518 rkffkplt...........................................................
cwb_MDP0000490521|PACid:22639541 si.................................................................
cwb_MDP0000825602|PACid:22674856 skkpffeviirkanvkpsyqmvipakfqptlpscsiptvltfggknwemtytggsiqrkfdi.....
cwb_MDP0000271785|PACid:22638372 pqlslpagfsqnlnernmkkaviescqgswqvgvartgdgtlyfeg.....................
cwb_MDP0000393956|PACid:22650070 iwk................................................................
cwb_MDP0000292968|PACid:22636752 fekqltssdvrddqsrlsmc...............................................
cwb_MDP0000266051|PACid:22641431 spkvpmkfvmkygeelsspvylxlpcgseweielrrcngevwfekgwp...................
cwb_MDP0000236750|PACid:22623596 rymvillrasyplqrlpesavvvygdylgdnvvlkvpngekwpigltsrdgkvwlnk..........
cwb_MDP0000237846|PACid:22646691 skkpffeviirkanvkpsyqmvipakfqptlpscsiptvltfggknwemtytggsiqrkfdi.....
cwb_MDP0000257606|PACid:22645914 lqylgakftkehflkrnyhqvilrvsdgrtwpvklskrqknmvrlqng...................
cwb_MDP0000316701|PACid:22677141 knpffratvrppsklmhvpaefakrlklqkkqiaalrvg............................
cwb_MDP0000685403|PACid:22642568 si.................................................................
cwb_MDP0000166580|PACid:22637283 fl.................................................................
cwb_MDP0000257606|PACid:22645914 fksdnpsfivpmkrningysvwlpsklcihmrrlgkhsgavilrvldgrtwsvemkceiat......
cwb_MDP0000271785|PACid:22638372 tssplfflksisethslpskcyvtipsefvkahglgdrkkmilkvrfvggkwpvelgtwqggrrgaa
cwb_MDP0000251244|PACid:22665628 qglpkyfcsknlpkrddi.................................................
cwb_MDP0000125949|PACid:22671191 fkseypccmvvmrpsyiqantlnleakfaxehllnrthdnv..........................
cwb_MDP0000204389|PACid:22666456 f..................................................................
cwb_MDP0000289385|PACid:22645688 f..................................................................
cwb_MDP0000252726|PACid:22647790 lksenqcflafsnkkhllqcvripkqlavaeglmykntvtxqdpxgrswliqlrirrxsstdhl...
cwb_MDP0000314836|PACid:22664815 ppsfrlimakthwnvkcpsatipldfarstgildkscmrvkdpfgklwpmdigivkd..........
cwb_MDP0000274788|PACid:22660795 tp.................................................................
cwb_MDP0000652415|PACid:22653420 fekqmtetdvnhlyqrlilykndvkrylsplliekesleegvnvtvy....................
cwb_MDP0000266051|PACid:22641431 eylhfrlpfnhlisiglpyefvrthlnkqrssnvil...............................
cwb_MDP0000236750|PACid:22623596 ppsffkvvlddtlrdgxikippigsmkyedfigdkmflevpnglvwpvelsrrdce...........
cwb_MDP0000236750|PACid:22623596 knpffratvrppsklmhvpaefakrlklqkkqiaalrvg............................
cwb_MDP0000152089|PACid:22663193 ell................................................................
cwb_MDP0000291592|PACid:22681744 erdvsknpyrmtvpkelavavglikker.......................................
cwb_MDP0000252727|PACid:22647791 kkqsffkvllgdfskhlriphaflknlsglslgkc................................
cwb_MDP0000179251|PACid:22658518 irllvqtipldfarstgildkscmrvkdpfgklwpmdigivkdkekieaawsr..............
cwb_MDP0000268649|PACid:22647350 f..................................................................
cwb_MDP0000160647|PACid:22627261 p..................................................................
cwb_MDP0000240942|PACid:22638874 lqtdnpsfvktmvrshvyscfwld...........................................
cwb_MDP0000176581|PACid:22669985 fksqnpsfivvmrlsyixsg...............................................
cwb_MDP0000176581|PACid:22669985 iflpsdfhklxhikkscexilqvsnvgtwpvdlnyfsegkkakfgr.....................
cwb_MDP0000627043|PACid:22674813 wpi................................................................
cwb_MDP0000309874|PACid:22623281 hciqlrlppafcrslsgkkpktaliksclgywgvkvgrsgdgnl.......................
cwb_MDP0000123473|PACid:22645384 wpi................................................................
cwb_MDP0000124774|PACid:22657498 fsssnpyfvriiksfnisgsytlnipykfsvahl.................................
cwb_MDP0000187657|PACid:22625109 el.................................................................
cwb_MDP0000258854|PACid:22678384 ryvlddklakmvdskeglpvtvvdwdtcnqreltfkhwnsddf........................
cwb_MDP0000143319|PACid:22673778 lsnpvhfklpsgaeweievtrsdgevwldkgwpefsrvf............................
cwb_MDP0000309874|PACid:22623281 parfarenglhsisklilndprgrlwplslgrwgsrvkaadhrlaikar..................
cwb_MDP0000123668|PACid:22668503 rt.................................................................
cwb_MDP0000573054|PACid:22624774 ivledakgkefgrkylvekgglsg...........................................
cwb_MDP0000794899|PACid:22625108 el.................................................................
cwb_MDP0000291591|PACid:22681743 lqtvpkklavakgliekervrltdpngktwkvklrveeikscgsrllmtegllk.............
cwb_MDP0000201845|PACid:22662296 icqnkirrlfwkmkmginlktkylaekvglsg...................................
cwb_MDP0000266051|PACid:22641431 fksekphfkvamqpsyifgnlvntlaqkvrfkrgw................................
cwb_MDP0000215770|PACid:22651835 ...................................................................
cwb_MDP0000912733|PACid:22637933 ...................................................................
cwb_MDP0000257606|PACid:22645914 akfaxehllnrthdnvilrvsggrtwpvklhqy..................................
cwb_MDP0000242456|PACid:22650200 sksknscfiaifnnprryratiprklavaedvlnkksim............................
cwb_MDP0000128295|PACid:22625136 re.................................................................
cwb_MDP0000143918|PACid:22630013 pedcrl.............................................................
cwb_MDP0000225889|PACid:22683127 htpdrrviflrdttmrlwpvlyidncfskils...................................
cwb_MDP0000766961|PACid:22642958 p..................................................................
cwb_MDP0000795789|PACid:22682846 viekqltktdlrsgrmsmplnqivsisflededmemlengetmtvrlidpglvqgdinlrrlekreg
cwb_MDP0000540442|PACid:22682667 viekqltktdissstnrmsmplnqlisisflededkemlencktmtvqlidpglvqgdinlrrlvmg
cwb_MDP0000260382|PACid:22663192 el.................................................................
cwb_MDP0000233653|PACid:22674667 ypl................................................................
cwb_MDP0000777125|PACid:22671632 ikkkltardlih.......................................................
cwb_MDP0000280317|PACid:22657374 liqkklyptdvnpnhnrlslpplqvlsgsfltsneietlnpkrsqksrdlgflnipfidprlklkek
cwb_MDP0000247573|PACid:22627980 weik...............................................................
cwb_MDP0000566907|PACid:22652228 iqkritmtdispgenrlsmpeaqivsmdfleakekellegqqtmkvqlidpglvkgdinlrlwhmks
cwb_MDP0000212063|PACid:22630334 qkslyntdinkdqgrlslprmqtesknflkpnekeeldktsllmvpligp.................
cwb_MDP0000143207|PACid:22656792 rksltvmdidgrqgrlllprqqtesknflkrn...................................
cwb_MDP0000233293|PACid:22671029 miqkqlfktdlsyghdrlsmprnqvvnkhflgehekrlengrvlevk....................
cwb_MDP0000305249|PACid:22629814 miqkqlfktdlsyghdrlsmprnqvvnkhflgehekrlengrvlevk....................
cwb_MDP0000126738|PACid:22651879 tpedcr.............................................................
cwb_MDP0000236750|PACid:22623596 fksrnpfvvirmrpsyisthlklp...........................................
cwb_MDP0000161022|PACid:22675604 lgwpefskfysldyafwlv................................................
cwb_MDP0000382202|PACid:22682839 viqkpltmtdvnqndnrlsmpeaqivsmdflegaekellkenqtmsvqlidpglvkgginlrrwhmk


                                                      10        20        30        40            50
                                                       |         |         |         |             |
d1na6a1                          .............-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGI..VE.KL.FPS
cwb_MDP0000153538|PACid:22660264 .............----AELGAANKQPTNYFCKTLTASDTSTHG----GFSVPRRA..AE.KV.FPP
cwb_MDP0000268306|PACid:22630740 .............-----GLGSPNKQPTNYFCKTLTASDTSTHG----GFSVPRRA..AE.KV.FPP
cwb_MDP0000319957|PACid:22645199 .............----AELGAANKQPTNYFCKTLTASDTSTHG----GFSVPRRA..AE.KV.FPP
cwb_MDP0000232417|PACid:22660261 .............-----GLGSPNKQPTNYFCKTLTASDTSTHG----GFSVPRRA..AE.KV.FPP
cwb_MDP0000211459|PACid:22629500 .............-------MKPSKHPSEFFCKTLTASDTSTHG----GFSVPRRA..AE.KL.FPP
cwb_MDP0000143749|PACid:22644960 .............-------MRPSKHPSEFFCKTLTASDTSTHG----GFSVPRRA..AE.KL.FPP
cwb_MDP0000412781|PACid:22651617 .............-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRA..AE.DC.FPP
cwb_MDP0000876321|PACid:22663258 .............--------KQSKQPAEFFCKTLTASDTSTHG----GFSVPRRA..AE.KI.FPP
cwb_MDP0000225980|PACid:22683343 .............-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRA..AE.DC.FPP
cwb_MDP0000185253|PACid:22621202 .............-------LKTNKPQPEFFCKTLTASDTSTHG----GFSVPRRA..AE.KI.FPP
cwb_MDP0000929655|PACid:22661337 .............--------ETPQCTVHSFCKTLTASDTSTHG----GFSVLRRH..AD.DC.LPP
cwb_MDP0000886637|PACid:22641953 .............---------QSRQPAEFFCKTLTASDTSTHG----GFSVPRRA..AE.KI.LPP
cwb_MDP0000179650|PACid:22675203 .............-------------TPHMFCKTLTASDTSTHG----GFSVPRRA..AE.DC.FPP
cwb_MDP0000173151|PACid:22632672 .............--------------PHMFCKTLTASDTSTHG----GFSVPRRA..AE.DC.FPP
cwb_MDP0000294251|PACid:22639202 .............---PMELGLPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA..AE.KV.FPP
cwb_MDP0000134824|PACid:22673229 .............-------LKTNKPQPEFFCKTLTASDTSTHG----GFSVPRRA..AE.KI.FPP
cwb_MDP0000194603|PACid:22651584 .............-----------KATVHWFCKILTASDTSTHG----GFSVLRKH..AT.EC.LPP
cwb_MDP0000258032|PACid:22620805 .............---------------HSFCKTLTASDTSTHG----GFSVLRRH..AD.EC.LPP
cwb_MDP0000139073|PACid:22644421 .............-------PEPQKPAVHSFCKVLTASDTSTHG----GFSVLRKH..AT.EC.LPA
cwb_MDP0000310875|PACid:22641004 .............---------------HSFCKTLTASDTSTHG----GFSVLRRH..AD.EC.LPP
cwb_MDP0000550049|PACid:22646916 .............---PMELGLPSKQPTNYFCKTLTASDTSTHG----GFSVPRRA..AE.KV.FPP
cwb_MDP0000123466|PACid:22652651 .............-------------STRSFSKVLTPSDTSTHG----GFSVPKRQ..AD.EC.LPP
cwb_MDP0000138853|PACid:22674896 .............-------------STRSFSKTLTPSDTSTHG----GFSVPKRI..AD.EC.FPP
cwb_MDP0000229742|PACid:22674723 .............----------------MFEKPLTPSDVGKLN----RLVIPKQH..AE.KY.FPL
cwb_MDP0000214352|PACid:22681236 .............-------------STXSFSKTLTPSDTSSHG----GFSVPKRQ..AE.EC.LPA
cwb_MDP0000138860|PACid:22643076 .............-------------STXSFSKTLTPSDTSSHG----GFSVPKRQ..AE.EC.LPA
cwb_MDP0000256621|PACid:22648903 .............-----------DDKVVSFAKILTPSDANNGG----GFSVPRFC..AD.SI.FPP
cwb_MDP0000939633|PACid:22667205 .............----------------LFEKAVTPSDVGKLN----RLVIPKQH..AE.KH.FPL
cwb_MDP0000138163|PACid:22622470 .............---------------HMFEKVVTPSDVGKLN----RLVIPKQH..AE.RF.FPL
cwb_MDP0000288808|PACid:22628543 .............---------------HMFDKVVTPSDVGKLN----RLVIPKQH..AE.RY.FPL
cwb_MDP0000221322|PACid:22644524 .............-------------KPASFAKTLTQSDANNGG----GFSVPRYC..AE.TI.FPK
cwb_MDP0000131481|PACid:22630798 .............--------------PASFAKTLTQSDANNGG----GFSVPRYC..AE.TI.FPK
cwb_MDP0000247623|PACid:22644692 .............----------------LFEKVATPSDVGRLN----RMVIPKRY..AE.KH.FQV
cwb_MDP0000232116|PACid:22646641 .............----------QDDRVFSFAKILTPSDAHNGG----GFSVPKFC..AD.TI.FPP
cwb_MDP0000945267|PACid:22621253 .............----------------LFEKVATPSDVGRLN----RMVIPKQQ..AE.KH.FQV
cwb_MDP0000750392|PACid:22633787 .............---------------ASFAKTLTQSDANNGG----GFSVPRYC..AE.TI.FPR
cwb_MDP0000128924|PACid:22664801 .............----------------LFEKAVTPSDVGKLN----RLVIPKQH..AE.KH.FPL
cwb_MDP0000223137|PACid:22662915 .............----------------LFEKVATPSDVGRLN----RMVIPKRY..AE.KH.FQV
cwb_MDP0000485280|PACid:22659457 .............-----------------FQKELTPSDVGKLN----RLVIPKKY..AV.EY.FPC
cwb_MDP0000153589|PACid:22644982 .............----------------LFEKVATPSDVGRLN----RMVIPKQH..AE.KH.FQV
cwb_MDP0000321569|PACid:22635836 .............----------------LFEKVATPSDVGRLN----RMVIPKQH..AE.KH.FQV
cwb_MDP0000207722|PACid:22671640 .............-----------------FQKELTPSDVSKLN----RLVIPKKY..AV.EY.FPC
cwb_MDP0000162363|PACid:22677783 .............----------------LFQKELTPSDVSKLN----RLVIPVTN..AK.RC.FPS
cwb_MDP0000534780|PACid:22663807 .............----------------LFQKELTPSDVSKLN----RLVIPVTN..AK.RC.FPS
cwb_MDP0000526584|PACid:22649377 .............----------------LFQKELTPSDVSKLN----RLVIPVTN..AK.RC.FPS
cwb_MDP0000259062|PACid:22632961 .............-------------------------------------------..--.--.IPD
cwb_MDP0000555456|PACid:22659471 .............-------------------------------------YLPSCF..AE.KN.LNG
cwb_MDP0000165802|PACid:22635978 .............----------------LFQKELTPSDVGKLN----RLVIPVSN..AK.RC.FPS
cwb_MDP0000291591|PACid:22681743 .............-------------------------------------------..--.--.---
cwb_MDP0000238744|PACid:22674921 .............-------------------------------------YLPSCF..AE.KN.LNG
cwb_MDP0000314333|PACid:22663787 .............-------------------------------------------..--.--.LPS
cwb_MDP0000161022|PACid:22675604 .............-------------------------------------------..--.--.---
cwb_MDP0000123407|PACid:22657458 .............-------------------------------------------..--.--.---
cwb_MDP0000226894|PACid:22677142 .............-------------------------------------------..--.--.---
cwb_MDP0000124774|PACid:22657498 .............-------------------------------------------..--.--.---
cwb_MDP0000309680|PACid:22638461 .............------------------QKVLKQSDVGSLG----RIVLPKKE..AE.TH.LPE
cwb_MDP0000258417|PACid:22673144 .............-------------------------------------------..--.--.LPS
cwb_MDP0000227080|PACid:22645787 .............-------------------------------------------..--.--.---
cwb_MDP0000123407|PACid:22657458 .............-------------------------------------------..--.--.---
cwb_MDP0000238744|PACid:22674921 .............-------------------------------------------..--.--.---
cwb_MDP0000316701|PACid:22677141 ............e-------------------------------------------..--.--.---
cwb_MDP0000549056|PACid:22637942 .............-----------------FEKVATPSDVGRLN----CMVITKQH..AE.KH.VQV
cwb_MDP0000192438|PACid:22632653 .............--------------TPHFFKII-VNDTSKYN----KIKIPTKF..VM.KY.GDG
cwb_MDP0000312598|PACid:22676419 .............-------------------------------------------..--.--.---
cwb_MDP0000236750|PACid:22623596 ............e-------------------------------------------..--.--.---
cwb_MDP0000555456|PACid:22659471 .............-------------------------------------------..--.--.---
cwb_MDP0000249417|PACid:22680044 .............-------------------------------------------..--.--.---
cwb_MDP0000123407|PACid:22657458 .............-------------------------------------------..--.--.---
cwb_MDP0000316701|PACid:22677141 .............-------------------------------------------..--.--.---
cwb_MDP0000155544|PACid:22633491 .............-------------------------------------------..--.--.---
cwb_MDP0000146397|PACid:22625573 .............-------------------------------------------..--.--.---
cwb_MDP0000236656|PACid:22666211 .............-------------------------------------------..--.--.LPS
cwb_MDP0000236750|PACid:22623596 .............-------------------------------------------..--.--.---
cwb_MDP0000819543|PACid:22662298 .............-------------------------------------------..--.--.---
cwb_MDP0000185981|PACid:22654058 .............--------------------------------------VPRKF..LT.HI.LKE
cwb_MDP0000298218|PACid:22631518 .............-------------------------------------------..--.--.---
cwb_MDP0000241245|PACid:22642523 .............-------------------------------------------..--.--.---
cwb_MDP0000267885|PACid:22661160 .............----------------LFEKVLSASDAGRIG----RLVLPKAC..AE.AY.FPP
cwb_MDP0000515096|PACid:22639161 .............-------------------------------------------..--.--.---
cwb_MDP0000127640|PACid:22634716 .............----------------LFEKVLSASDAGRIG----RLVLPKAC..AE.AY.FPP
cwb_MDP0000229344|PACid:22665895 .............----------------LFEKVLSASDAGRIG----RLVLPKAC..AE.AY.FPP
cwb_MDP0000176581|PACid:22669985 .............-------------------------------------------..--.--.---
cwb_MDP0000192438|PACid:22632653 .............-------------------------------------------..--.--.---
cwb_MDP0000298218|PACid:22631518 .............-------------------------------------------..--.--.---
cwb_MDP0000320006|PACid:22667113 .............---------------------------------------PKYF..CS.KN.LPK
cwb_MDP0000161022|PACid:22675604 .............-------------------------------------------..--.--.---
cwb_MDP0000309784|PACid:22654675 .............-------------------------------------------..--.--.---
cwb_MDP0000189426|PACid:22643793 .............-------------------------------------HIPRDF..LK.HI.QKD
cwb_MDP0000304769|PACid:22644689 .............----------------LFNKELKNSDVGPLG----RIIVPKKE..AE.NN.LPM
cwb_MDP0000309784|PACid:22654675 .............-------------------------------------------..--.--.---
cwb_MDP0000126738|PACid:22651879 .............-------------------------------------------..--.--.---
cwb_MDP0000302532|PACid:22624442 .............-------------------------------------------..--.--.---
cwb_MDP0000212684|PACid:22647103 .............-------------------------------------------..--.--.---
cwb_MDP0000214729|PACid:22665914 .............-------------------------------------------..--.--.---
cwb_MDP0000125949|PACid:22671191 .............-------------------------------------------..--.--.---
cwb_MDP0000237202|PACid:22655382 .............-----------QEKPTSFAKTLTQYDANNGG----GFSVPRYC..AE.TI.FPK
cwb_MDP0000212684|PACid:22647103 .............-----------------FIKIL-AGDTSQ------GLRVPPAF..IM.KN.FNG
cwb_MDP0000214729|PACid:22665914 .............-----------------FIKIL-AGDTSQ------GLRVPPAF..IM.KN.FNG
cwb_MDP0000283274|PACid:22663974 .............-------------------------------------------..--.--.---
cwb_MDP0000227080|PACid:22645787 .............-------------------------------------------..--.--.---
cwb_MDP0000242456|PACid:22650200 .............-------------------------------------------..--.--.---
cwb_MDP0000241386|PACid:22625419 .............-------------------------------------------..--.--.---
cwb_MDP0000302532|PACid:22624442 ............y-------------------------------------------..--.--.---
cwb_MDP0000125949|PACid:22671191 .............-------------------------------------------..--.--.---
cwb_MDP0000291592|PACid:22681744 .............-------------------------------------------..--.--.---
cwb_MDP0000189426|PACid:22643793 .............-----------------------------------NVYVPAAF..SR.KH.FSK
cwb_MDP0000312598|PACid:22676419 .............-------------------------------------------..--.--.---
cwb_MDP0000252727|PACid:22647791 .............-------------------------------------------..--.--.---
cwb_MDP0000252726|PACid:22647790 .............-------------------------------------------..--.--.---
cwb_MDP0000125949|PACid:22671191 .............-------------------------------------------..--.--.---
cwb_MDP0000200376|PACid:22644424 .............-------------------------------------------..--.--.---
cwb_MDP0000263654|PACid:22620434 .............-------------------------------------------..--.--.---
cwb_MDP0000197534|PACid:22639927 .............-------------------KQLTSSDVRD-G--QCRFAINKED..VE.NHiFLL
cwb_MDP0000199365|PACid:22642971 .............---------------WKIRKRLAASDLGELS----RLLMPKEA..VR.KHvMSY
cwb_MDP0000314836|PACid:22664815 .............------------------------------PGFQNGMAIPIAF..TR.--.---
cwb_MDP0000179251|PACid:22658518 .............------------------------------PGFQNGMAIPIAF..TR.--.---
cwb_MDP0000490521|PACid:22639541 .............---------------WKIRKRLAASDLGELS----RLLMPKEA..VR.KHvMSY
cwb_MDP0000825602|PACid:22674856 .............-------------------------------------------..--.--.---
cwb_MDP0000271785|PACid:22638372 .............-------------------------------------------..--.--.---
cwb_MDP0000393956|PACid:22650070 .............-----------------IRKRLAASDLGELS----RLLMPKEA..VQ.KHvMSY
cwb_MDP0000292968|PACid:22636752 .............---------------------------------------KKDV..EN.HI.FPL
cwb_MDP0000266051|PACid:22641431 .............-------------------------------------------..--.--.--E
cwb_MDP0000236750|PACid:22623596 .............-------------------------------------------..--.--.---
cwb_MDP0000237846|PACid:22646691 .............-------------------------------------------..--.--.---
cwb_MDP0000257606|PACid:22645914 .............-------------------------------------------..--.--.---
cwb_MDP0000316701|PACid:22677141 .............-------------------------------------------..--.--.---
cwb_MDP0000685403|PACid:22642568 .............---------------WKIRKRLAASDLGELS----RLLMPKEA..VR.KHvMSY
cwb_MDP0000166580|PACid:22637283 .............--------------------------------------LQKKE..AE.TH.LPE
cwb_MDP0000257606|PACid:22645914 .............-------------------------------------------..--.--.---
cwb_MDP0000271785|PACid:22638372 ..........isl-------------------------------------------..--.--.---
cwb_MDP0000251244|PACid:22665628 .............-------------------------------------------..--.--.---
cwb_MDP0000125949|PACid:22671191 .............-------------------------------------------..--.--.---
cwb_MDP0000204389|PACid:22666456 .............------------------EKQLTSSDVRDD---QSRLSMSKED..VEnHI.FPL
cwb_MDP0000289385|PACid:22645688 .............------------------EKQLTSSDVRDD---QSRLSMSKED..VE.NHiFPL
cwb_MDP0000252726|PACid:22647790 .............-------------------------------------------..--.--.---
cwb_MDP0000314836|PACid:22664815 .............-------------------------------------------..--.--.---
cwb_MDP0000274788|PACid:22660795 .............----------------LFEKMLSASDAGRIG----RLVLPKKC..AE.AY.FPP
cwb_MDP0000652415|PACid:22653420 .............-------------------------------------------..--.--.---
cwb_MDP0000266051|PACid:22641431 .............-------------------------------------------..--.--.---
cwb_MDP0000236750|PACid:22623596 .............----------------I--------------------------..--.--.---
cwb_MDP0000236750|PACid:22623596 .............-------------------------------------------..--.--.---
cwb_MDP0000152089|PACid:22663193 .............-----------------FEKVATPSDVGGLN----RMVIPNNM..PR.SI.FRM
cwb_MDP0000291592|PACid:22681744 .............-------------------------------------------..--.--.---
cwb_MDP0000252727|PACid:22647791 .............------------------------------------------A..--.--.---
cwb_MDP0000179251|PACid:22658518 .............-------------------------------------------..--.--.---
cwb_MDP0000268649|PACid:22647350 .............----------------LFQKELKNSDVSSLR----RMILPKKA..AE.AH.LPT
cwb_MDP0000160647|PACid:22627261 .............----------------LFKKELKNSDVGPLG----RIILPKKE..AE.NN.LPM
cwb_MDP0000240942|PACid:22638874 .............-------------------------------------------..--.--.---
cwb_MDP0000176581|PACid:22669985 .............-------------------------------------------..--.--.---
cwb_MDP0000176581|PACid:22669985 .............-------------------------------------------..--.--.---
cwb_MDP0000627043|PACid:22674813 .............------------------KKTLTMTDVGRNM-HRARRLVLRRKlvKK.HI.LPY
cwb_MDP0000309874|PACid:22623281 .............-------------------------------------------..--.--.---
cwb_MDP0000123473|PACid:22645384 .............------------------KKTLTMTDVGRNM-HRARRLVLRRKlvKK.HI.LPY
cwb_MDP0000124774|PACid:22657498 .............-------------------------------------------..--.--.---
cwb_MDP0000187657|PACid:22625109 .............----------------LFEKVATPSDVGXLN----RMVIPNNM..PR.SI.F--
cwb_MDP0000258854|PACid:22678384 .............-------------------------------------------..--.--.---
cwb_MDP0000143319|PACid:22673778 .............-------------------------------------------..--.--.---
cwb_MDP0000309874|PACid:22623281 .............-------------------------------------------..--.--.---
cwb_MDP0000123668|PACid:22668503 .............-------------STRSFSKVLTPSDTSTHG----GFSVPKRQ..AD.EC.LPP
cwb_MDP0000573054|PACid:22624774 .............-------------------------------------------..--.--.---
cwb_MDP0000794899|PACid:22625108 .............----------------LFEKVXTPSDVGRLN----RMVIPKQH..AE.KH.FQV
cwb_MDP0000291591|PACid:22681743 .............-------------------------------------------..--.--.---
cwb_MDP0000201845|PACid:22662296 .............-------------------------------------------..--.--.---
cwb_MDP0000266051|PACid:22641431 .............-------------------------------------------..--.--.---
cwb_MDP0000215770|PACid:22651835 .............-------------------------------------------..--.--.---
cwb_MDP0000912733|PACid:22637933 .............-------------------------------------------..--.--.---
cwb_MDP0000257606|PACid:22645914 .............-------------------------------------------..--.--.---
cwb_MDP0000242456|PACid:22650200 .............-------------------------------------------..--.--.---
cwb_MDP0000128295|PACid:22625136 .............---------------HMFDKVVTPSDVGKLN----RLVIPKQH..AE.RY.FPL
cwb_MDP0000143918|PACid:22630013 .............-------------------------------------------..--.--.---
cwb_MDP0000225889|PACid:22683127 .............------------S------------------------------..--.--.---
cwb_MDP0000766961|PACid:22642958 .............-------------------------------------------..--.--.---
cwb_MDP0000795789|PACid:22682846 .............-------------------------------------------..--.--.---
cwb_MDP0000540442|PACid:22682667 ....kekkpgsai-------------------------------------------..--.--.---
cwb_MDP0000260382|PACid:22663192 .............----------------LFEKVATPXDVGXLN----RMVIPKQH..AE.KH.FQ-
cwb_MDP0000233653|PACid:22674667 .............-------------------------------------------..--.--.---
cwb_MDP0000777125|PACid:22671632 .............------------------------------------FYMPASL..MN.KYiLPH
cwb_MDP0000280317|PACid:22657374 kginlslwtlsns-------------------------------------------..--.--.---
cwb_MDP0000247573|PACid:22627980 .............-------------------KKLTARDLT-------HFYVPANL..MN.KHiLPY
cwb_MDP0000566907|PACid:22652228 .............-------------------------------------------..--.--.---
cwb_MDP0000212063|PACid:22630334 .............-------------------------------------------..--.--.---
cwb_MDP0000143207|PACid:22656792 .............-------------------------------------------..--.--.---
cwb_MDP0000233293|PACid:22671029 .............-------------------------------------------..--.--.---
cwb_MDP0000305249|PACid:22629814 .............-------------------------------------------..--.--.---
cwb_MDP0000126738|PACid:22651879 .............-------------------------------------------..--.--.---
cwb_MDP0000236750|PACid:22623596 .............-------------------------------------------..--.--.---
cwb_MDP0000161022|PACid:22675604 .............-------------------------------------------..--.--.---
cwb_MDP0000382202|PACid:22682839 ....kkpdnnssk-------------------------------------------..--.--.---


                                                 60         70           80           90         100
                                                  |          |            |            |           |
d1na6a1                          INH......TRELNP..SVFLTAHVSS.H.D.C.PDSEARAIYYNSAHF...GKTR.NEKRIT.RWG
cwb_MDP0000153538|PACid:22660264 L-D......YSQQPP..AQELIAR--D.L.H.D.NEWKFRHIFRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000268306|PACid:22630740 L-D......FSQQPP..AQELIAR--D.L.H.D.NEWKFRHIFRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000319957|PACid:22645199 L-D......YSQQPP..AQELIAR--D.L.H.D.NEWKFRHIFRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000232417|PACid:22660261 L-D......FTQQPP..AQELIAR--D.L.H.D.NEWKFRHIFRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000211459|PACid:22629500 L-D......FTMQPP..TQELVVR--D.L.H.D.NTWTFRHIYRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000143749|PACid:22644960 L-D......FTMQPP..TQELVVR--D.L.H.D.NTWTFRHIYRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000412781|PACid:22651617 L-D......YKQQRP..SQELVAK--D.L.H.G.VEWRFRHIYRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000876321|PACid:22663258 L-D......FSMQPP..AQELVAK--D.L.H.D.SAWTFRHIYRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000225980|PACid:22683343 L-D......YKQQRP..SQELVAK--D.L.H.G.VEWRFRHIYRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000185253|PACid:22621202 L-D......FSMQPP..AQELVAR--D.L.H.D.TVWTFRHIYRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000929655|PACid:22661337 L-D......MTQQPP..WQELVAS--D.L.H.G.NEWHFRHIFRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000886637|PACid:22641953 L-D......FSMQPP..AQELVAK--D.L.H.D.SAWTFRHIYRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000179650|PACid:22675203 L-D......YTQQRP..SQELVAK--D.L.H.G.LEWRFRHIYRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000173151|PACid:22632672 L-D......YTQQRP..SQELVAK--D.L.H.G.LEWRFRHIYRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000294251|PACid:22639202 L-D......FSLQPP..AQELIAR--D.L.H.D.VEWKFRHIFRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000134824|PACid:22673229 L-D......FSMQPP..AQELVAR--D.L.H.D.AVWTFRHIXRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000194603|PACid:22651584 L-D......MNQATP..TQELIAK--D.L.H.G.YEWKFKHIFRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000258032|PACid:22620805 L-D......MSRQPP..TQELVAK--D.L.H.G.NEWRFRHIFRGQ---...--PR.RHLLQS.GW-
cwb_MDP0000139073|PACid:22644421 L-D......MTQATP..TQELVAK--D.L.H.G.YEWRFKHIFRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000310875|PACid:22641004 L-D......MSRQPP..TQELVAK--D.L.H.G.SEWRFRHIFRGQ---...--PR.RHLLQS.GW-
cwb_MDP0000550049|PACid:22646916 L-D......FTLQPP..AQELIAR--D.L.H.D.VEWKFRHIFRGQ---...--PK.RHLLTT.GW-
cwb_MDP0000123466|PACid:22652651 L-D......MSQQPP..VQDLVAK--D.L.Q.G.YEWCFRHIFRGQ---...--PK.RHLLTS.GW-
cwb_MDP0000138853|PACid:22674896 L-D......MSQQPP..VQDLVAK--D.L.Q.G.YEWHFRHVYRGQ---...--PK.RHLLTN.DW-
cwb_MDP0000229742|PACid:22674723 G--......----SG..DSGLLLSFED.E.S.G.KSWRFRYSYWNS---...--SQ.SYVLTK.GW-
cwb_MDP0000214352|PACid:22681236 L-D......MSQQPP..VQDLVAK--D.L.Q.G.NEWSFRHIFRGQ---...--PR.RHLLTS.GW-
cwb_MDP0000138860|PACid:22643076 L-D......MSQQPP..VQDLVAK--D.L.Q.G.NEWSFRHIFRGQ---...--PR.RHLLTS.GW-
cwb_MDP0000256621|PACid:22648903 L-N......YQADPP..VQMLSVT--D.L.H.G.VVWEFRHIYRGT---...--PR.RHLLTT.GW-
cwb_MDP0000939633|PACid:22667205 QSGstatitVSASSA..CKGVLLNFED.V.G.G.KVWRFRYSYWNS---...--SQ.SYVLTK.GW-
cwb_MDP0000138163|PACid:22622470 --D......SSSNDN..GLFLNFQ--D.R.T.G.KPWRFRYSYWNS---...--SQ.SYVITK.GW-
cwb_MDP0000288808|PACid:22628543 --D......SSSNDK..GLLLNFQ--D.R.T.G.KPWRFRYSYWNS---...--SQ.SYVMTK.GW-
cwb_MDP0000221322|PACid:22644524 L-D......YSADPP..VQTVIAK--D.V.H.G.EVWKFRHIYRGT---...--PR.RHLLTT.GW-
cwb_MDP0000131481|PACid:22630798 L-D......YSADPP..VQTVIAK--D.V.H.G.EVWKFRHIYRGT---...--PR.RHLLTT.GW-
cwb_MDP0000247623|PACid:22644692 H-Q......SVGFGK..GVLLKFE--D.E.V.G.KLWRFGYCYWSS---...--SQ.SYVLSK.GW-
cwb_MDP0000232116|PACid:22646641 L-N......FQADPP..IQALFLT--D.L.H.G.VVWEFRHIYRGT---...--PR.RHLLTT.GW-
cwb_MDP0000945267|PACid:22621253 H-E......SVELCK..GVLLNFE--D.E.E.G.NVWRFRYCYWSS---...--SQ.SYVLTK.GW-
cwb_MDP0000750392|PACid:22633787 L-D......YSANPP..VQTILAK--D.V.H.G.ETWKFKHIYRGT---...--PR.RHLLTT.GW-
cwb_MDP0000128924|PACid:22664801 QSGsaatltVSASTA..CKGVLLNFED.V.G.G.KVWRFRYSYWNS---...--SQ.SYVLTK.GW-
cwb_MDP0000223137|PACid:22662915 H-Q......SVGFGK..GVLLKFE--D.E.V.G.KLWRFGYCYWSS---...--SQ.SYVLSK.GW-
cwb_MDP0000485280|PACid:22659457 ICE......NXEENV..TEDIELVFYD.K.L.M.RVWKFRYCYWRS---...--SQ.SFVFTR.GW-
cwb_MDP0000153589|PACid:22644982 H-L......SVGFGK..GVLLKFE--D.E.L.G.NVWRFGYCYWSS---...--SQ.SYVLSK.GW-
cwb_MDP0000321569|PACid:22635836 H-L......SVGFGK..GVLLKFE--D.E.L.G.KVWRFGYCYWSS---...--SQ.SYVLSK.GW-
cwb_MDP0000207722|PACid:22671640 ICE......NVEVNG..TEDIELVFYD.K.L.M.RVWKFRYCYWRS---...--SQ.XFAFTR.GW-
cwb_MDP0000162363|PACid:22677783 ISEsis...QKVESG..SSQLVFY--D.K.M.M.RSWTFRYCYWKS---...--SR.SFVFTR.GW-
cwb_MDP0000534780|PACid:22663807 ISEsis...QKVESG..SSQLVFY--D.K.M.M.RSWTFRYCYWKS---...--SR.SFVFTR.GW-
cwb_MDP0000526584|PACid:22649377 ISEsis...QKVESG..SSQLVFY--D.K.M.M.RSWTFRYCYWKS---...--SR.SFVFTR.GW-
cwb_MDP0000259062|PACid:22632961 AND......MTQATP..TQELVAK--D.L.H.G.YEWRFKHIFRGQ---...--PR.RHLLTT.GW-
cwb_MDP0000555456|PACid:22659471 V--......------..SGFIKLQ--S.A.D.G.RQWSVRCLYRGG---...----.RAKLSQ.GW-
cwb_MDP0000165802|PACid:22635978 ISEats...QKVESC..SSQLVFY--D.N.M.M.RSWTFRYCYWKS---...--SR.SFVFTK.GW-
cwb_MDP0000291591|PACid:22681743 ---......------..---C------.-.-.-.---------------...----.------.---
cwb_MDP0000238744|PACid:22674921 V--......------..SGFIKLQ--S.A.D.G.RQWSVRCLYRGG---...----.RAKLSQ.GW-
cwb_MDP0000314333|PACid:22663787 L-F......CKSHLP..DKDITMTLED.E.S.G.RQYQSKYIACKT---...----.--GLSS.GW-
cwb_MDP0000161022|PACid:22675604 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000123407|PACid:22657458 ---......-----P..NCKVKIVLQN.W.K.G.ESWTVN-------SV...PSTR.VHTSHT.LCG
cwb_MDP0000226894|PACid:22677142 ---......------..----------.-.-.-.---------------...----.-EIEVT.RRG
cwb_MDP0000124774|PACid:22657498 ---......------..----------.-.-.-.---------------...----.------.-W-
cwb_MDP0000309680|PACid:22638461 L-D......AR---D..GISIAME--D.I.GtS.RVWNMRYRYWPN---...-NKS.RMYLLE.NT-
cwb_MDP0000258417|PACid:22673144 L-F......CKSHLP..DKDITMTLED.E.S.G.RQYQLKYIACKTGLS...----.-----A.GW-
cwb_MDP0000227080|PACid:22645787 ---......------..----------.-.-.-.---------------...--AE.WEIEVT.RRG
cwb_MDP0000123407|PACid:22657458 ---......------..----------.-.-.-.---------------...----.------.-W-
cwb_MDP0000238744|PACid:22674921 ---......------..----------.-.-.-.W--------------...----.------.---
cwb_MDP0000316701|PACid:22677141 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000549056|PACid:22637942 Q-L......SVGFGR..GVLLKFE--D.E.V.G.KGWRFGYCYWRS---...--SQ.SYVLSK.GW-
cwb_MDP0000192438|PACid:22632653 L--......------..SNSVVLQVPS.G.S.E.WEMELR---------...----.------.---
cwb_MDP0000312598|PACid:22676419 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000236750|PACid:22623596 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000555456|PACid:22659471 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000249417|PACid:22680044 ---......------..----------.-.-.-.---------------...----.-----G.GW-
cwb_MDP0000123407|PACid:22657458 ---......------..---------N.S.K.G.GCWTVNSI-------...PDSK.GRVVHT.FCG
cwb_MDP0000316701|PACid:22677141 ---......------..----------.-.D.G.GTWRVKFTYANQ---...----.ISRFLC.GW-
cwb_MDP0000155544|PACid:22633491 ---......------..--MIVLE--D.E.S.G.EEFHTKYLVEKVGLS...GG--.------.-W-
cwb_MDP0000146397|PACid:22625573 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000236656|PACid:22666211 L-F......CKSHLP..DKDITMTLED.E.S.G.RQYQLKYIACKTGLS...----.-----A.GW-
cwb_MDP0000236750|PACid:22623596 ---......------..----------.-.D.G.GTWRVKFTYANQ---...----.ISRFLC.GW-
cwb_MDP0000819543|PACid:22662298 ---......------..----------.-.-.-.-------------LS...GG--.------.-W-
cwb_MDP0000185981|PACid:22654058 L--......----SE..RASLKLK--G.S.S.D.YSWTVN-------VT...KTPK.GAVRFN.GGW
cwb_MDP0000298218|PACid:22631518 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000241245|PACid:22642523 ---......------..----------.-.-.-.---------------...----.-CRFLS.GW-
cwb_MDP0000267885|PACid:22661160 I-S......Q-----..SEGLPIRIQD.V.K.G.NEWTFQFRFWPN---...-NNS.RMYVLE.GV-
cwb_MDP0000515096|PACid:22639161 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000127640|PACid:22634716 I-S......Q-----..SEGLPIRIQD.V.K.G.NEWTFQFRFWPN---...-NNS.RMYVLE.GV-
cwb_MDP0000229344|PACid:22665895 I-S......Q-----..SEGLPIRIQD.V.K.G.NEWTFQFRFWPN---...-NNS.RMYVLE.GV-
cwb_MDP0000176581|PACid:22669985 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000192438|PACid:22632653 ---......------..----------.-.-.-.---------------...--TG.RCRLLS.GW-
cwb_MDP0000298218|PACid:22631518 ---......------..---------D.G.G.T.WCVKLK--LYKQQKV...RFKR.------.GW-
cwb_MDP0000320006|PACid:22667113 R--......------..-DDIVIL-ID.E.D.G.NECEVIYLAEKRGLS...G---.------.GW-
cwb_MDP0000161022|PACid:22675604 ---......------..---VILQILD.G.S.T.WPVTFK--YDXT---...--PR.---FQN.GW-
cwb_MDP0000309784|PACid:22654675 ---......----NP..SFWIVMQPS-.-.Y.V.TQS---YLYLRSE--...-FTQ.RHLXMK.SA-
cwb_MDP0000189426|PACid:22643793 L--......----SE..RAFLTLT--D.S.L.D.CSWSVK-------VS...RTTM.GAVRFT.DGW
cwb_MDP0000304769|PACid:22644689 LSG......KE----..GIQLTVR--DvH.S.D.QHWEFKYKYWSN---...--NR.SRMYVF.EYT
cwb_MDP0000309784|PACid:22654675 ---......-LTQHP..TGSVILRVPD.G.R.T.WNVKFK--YENK---...----.RARFLL.DW-
cwb_MDP0000126738|PACid:22651879 --X......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000302532|PACid:22624442 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000212684|PACid:22647103 ---......------..------TLQD.P.D.G.RSWFVRLRTHYTDR-...--FD.YLNLST.GW-
cwb_MDP0000214729|PACid:22665914 ---......------..------TLQD.P.D.G.RSWFVRLRTHYTDR-...--FD.YLNLST.GW-
cwb_MDP0000125949|PACid:22671191 ---......------..---------T.-.-.-.---------------...----.------.---
cwb_MDP0000237202|PACid:22655382 L-D......YSTDPP..VQTVIAK--N.V.H.D.EVWKFRHIYRGT---...--PR.RHLLTA.---
cwb_MDP0000212684|PACid:22647103 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000214729|PACid:22665914 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000283274|PACid:22663974 ---......------..----------.-.-.-.---------------...----.-----G.GW-
cwb_MDP0000227080|PACid:22645787 ---......-LTQHP..TGSVILRVPD.G.R.T.WNVKFK--YENKR--...----.------.---
cwb_MDP0000242456|PACid:22650200 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000241386|PACid:22625419 ---......------..----------.-.-.-.---------------...----.--KFDT.NW-
cwb_MDP0000302532|PACid:22624442 ---......------..----------.-.-.-.---------------...----.-----D.GW-
cwb_MDP0000125949|PACid:22671191 ---......------..---------D.G.G.T.WSVEMK-------CE...KATR.PKLRLQ.YGW
cwb_MDP0000291592|PACid:22681744 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000189426|PACid:22643793 Q--......------..-KHFKIFMKN.A.E.E.KTWAVNVVHLNT---...----.SHSFSA.GW-
cwb_MDP0000312598|PACid:22676419 ---......-----P..NCKVKIVLQN.W.K.G.ESWTVNSV-------...PSNR.VHTSHT.LCG
cwb_MDP0000252727|PACid:22647791 ---......------..----------.E.S.G.RXWCAKVILRPKSS-...--FH.RMELTT.GW-
cwb_MDP0000252726|PACid:22647790 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000125949|PACid:22671191 ---......------..----------.-.-.-.---------------...----.------.-W-
cwb_MDP0000200376|PACid:22644424 ---......------..-SMIVLE--D.E.N.G.REFETKYLVEKGGLS...GG--.------.-W-
cwb_MDP0000263654|PACid:22620434 ---......------..----------.-.-.-.---------------...----.--IVSA.GW-
cwb_MDP0000197534|PACid:22639927 LKK......GEDIRK..GIHVTTY--D.V.D.G.NDYP--MVYKLW---...-AGK.IHVLTG.GW-
cwb_MDP0000199365|PACid:22642971 LDDks....AKMVDS..KEGLPVTIVD.W.D.T.C--------------...--NR.RELTFK.HW-
cwb_MDP0000314836|PACid:22664815 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000179251|PACid:22658518 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000490521|PACid:22639541 LDDks....AKMVDS..KEGLPVTIVD.W.D.T.C--------------...--NR.RELTFK.HW-
cwb_MDP0000825602|PACid:22674856 ---......------..----------.-.-.-.---------------...----.------.NW-
cwb_MDP0000271785|PACid:22638372 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000393956|PACid:22650070 LDDkl....AKMVDS..KEGLTVTVVD.W.D.T.CN-------------...---R.HELTFK.HW-
cwb_MDP0000292968|PACid:22636752 LK-......-DDEDP..NRGIPVTTYD.M.G.G.NKY--PMVFKTW---...-VSK.THVLTG.GW-
cwb_MDP0000266051|PACid:22641431 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000236750|PACid:22623596 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000237846|PACid:22646691 ---......------..----------.-.-.-.---------------...----.------.NW-
cwb_MDP0000257606|PACid:22645914 ---......------..----------.-.-.-.---------------...----.------.-W-
cwb_MDP0000316701|PACid:22677141 ---......------..----------.-.-.E.QLWPVNIIGYNN---...EGSR.HSHISG.GW-
cwb_MDP0000685403|PACid:22642568 LDDks....AKMVDS..KEGLPVTIVD.W.D.T.C--------------...--NR.RELTFK.HW-
cwb_MDP0000166580|PACid:22637283 L-D......AR---D..GISIAME--D.IgT.S.RVWNMRYRYWPN---...-NKS.RMYLLE.NT-
cwb_MDP0000257606|PACid:22645914 ---......------..----------.-.-.-.---------------...---R.PKLRLQyGW-
cwb_MDP0000271785|PACid:22638372 ---......------..----------.-.-.-.---------------...---R.TAIRTR.GW-
cwb_MDP0000251244|PACid:22665628 ---......------..----VIL-ID.E.D.G.NECEVIYLAEKRGLS...G---.------.GW-
cwb_MDP0000125949|PACid:22671191 ---......------..----------.-.-.-.---------------...----.---I--.---
cwb_MDP0000204389|PACid:22666456 LKD......--GEDP..NQGVHVTIYD.M.D.G.KEY------------...----.------.---
cwb_MDP0000289385|PACid:22645688 F--......KDGEDP..NQGVHVTIYD.M.D.G.KEY------------...----.------.---
cwb_MDP0000252726|PACid:22647790 ---......------..----------.-.-.-.---------------...----.--DIXT.GW-
cwb_MDP0000314836|PACid:22664815 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000274788|PACid:22660795 ISQ......PEG---..---LPLKVQD.S.K.G.KEWIFQFRFWPN---...----.------.---
cwb_MDP0000652415|PACid:22653420 ---......------..---------D.-.-.-.---------------...----.------.---
cwb_MDP0000266051|PACid:22641431 ---......------..------QILD.G.S.T.WPVNFK--YDVTXRF...----.----QN.GW-
cwb_MDP0000236750|PACid:22623596 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000236750|PACid:22623596 ---......------..----------.-.-.E.QLWPVNIIGYNN---...EGSR.HSHISG.GW-
cwb_MDP0000152089|PACid:22663193 R--......------..-------WGK.C.G.G.LDIVIGVVVRAS---...----.--YVLSkGW-
cwb_MDP0000291592|PACid:22681744 ---......------..-----VRLID.P.N.G.KSWKVKLRLDDTKYG...S---.GHLRMT.EGL
cwb_MDP0000252727|PACid:22647791 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000179251|PACid:22658518 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000268649|PACid:22647350 LES......KE----..GMAINMD--D.I.D.GlHVWSFKYRFWPN---...----.------.---
cwb_MDP0000160647|PACid:22627261 LSD......REG---..-IQLTVR--D.V.HsN.RHWEFKYKFWSN---...--NR.------.---
cwb_MDP0000240942|PACid:22638874 ---......------..----------.-.-.-.------AVYIGSRTGls.G---.------.GW-
cwb_MDP0000176581|PACid:22669985 ---......------..----------.-.-.-.-X-------------...----.------.---
cwb_MDP0000176581|PACid:22669985 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000627043|PACid:22674813 L-S......YQIINCveNQGAGITIYD.L.N.T.CS-EHQLIFK---RW...KGSG.TYVLMS.AWS
cwb_MDP0000309874|PACid:22623281 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000123473|PACid:22645384 L-S......YQIINCveNQGAGITIYD.L.N.T.CS-EHQLIFK---RW...KGSG.TYVLMS.AWS
cwb_MDP0000124774|PACid:22657498 ---......-----P..NCKVKIVLQN.W.K.G.ESWTVN-------SV...PSTR.VHTSHT.LC-
cwb_MDP0000187657|PACid:22625109 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000258854|PACid:22678384 ---......------..----------.-.-.-.--------------YvlkGGWR.PE----.---
cwb_MDP0000143319|PACid:22673778 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000309874|PACid:22623281 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000123668|PACid:22668503 LV-......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000573054|PACid:22624774 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000794899|PACid:22625108 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000291591|PACid:22681743 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000201845|PACid:22662296 ---......------..----------.-.-.-.---------------...----.------.GW-
cwb_MDP0000266051|PACid:22641431 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000215770|PACid:22651835 ---......------..----------.-.-.-.---------------...--PR.RHLLTA.GW-
cwb_MDP0000912733|PACid:22637933 ---......------..----------.-.-.-.---------------...--PR.RHLLTA.GW-
cwb_MDP0000257606|PACid:22645914 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000242456|PACid:22650200 ---......------..-------IQD.S.T.G.RSWLVKLNVRGK---...-GSQcRVDMAT.GL-
cwb_MDP0000128295|PACid:22625136 --D......SSSNDK..GLLLNFQ---.-.-.-.---------------...----.------.---
cwb_MDP0000143918|PACid:22630013 ---......------..----------.-.-.-.---------------...----.----LG.GW-
cwb_MDP0000225889|PACid:22683127 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000766961|PACid:22642958 ---......------..----------.-.-.-.---------------...GQPR.XHLLTT.GW-
cwb_MDP0000795789|PACid:22682846 ---......---K--..----------.-.-.-.---------------...----.------.---
cwb_MDP0000540442|PACid:22682667 ---......------..----------.-.-.-.---------------...----.-FVLRT.QW-
cwb_MDP0000260382|PACid:22663192 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000233653|PACid:22674667 ---......------..--RLPLKVQD.S.K.G.KEWIFQFRFWPN---...-NNS.RMYVLE.GV-
cwb_MDP0000777125|PACid:22671632 VNDef....TKALEN..RQGAQITFHD.G.D.T.HTTHHRYIFKQS---...----.NNSYVL.VWH
cwb_MDP0000280317|PACid:22657374 ---......------..----------.-.-.-.---------------...-DRK.SYALKT.SW-
cwb_MDP0000247573|PACid:22627980 ADDkf....TKALEN..RQGAEITFLD.G.D.T.HTICHQYVFKQS---...----.DNSYIF.VWH
cwb_MDP0000566907|PACid:22652228 ---......------..----------.-.-.-.---------------...--SK.LYVLRT.QW-
cwb_MDP0000212063|PACid:22630334 ---......-K----..----------.-.-.-.---------------...----.------.---
cwb_MDP0000143207|PACid:22656792 --A......MDRLKK..DKVMRVQLID.-.-.-.---------------...----.------.---
cwb_MDP0000233293|PACid:22671029 ---......------..-------V--.-.-.-.---------------...----.------.---
cwb_MDP0000305249|PACid:22629814 ---......------..-------V--.-.-.-.---------------...----.------.---
cwb_MDP0000126738|PACid:22651879 ---......------..----------.-.-.-.---------------...----.---LLG.GW-
cwb_MDP0000236750|PACid:22623596 ---......------..----------.-.-.-.-------IYFAQEHI...----.------.---
cwb_MDP0000161022|PACid:22675604 ---......------..----------.-.-.-.---------------...----.------.---
cwb_MDP0000382202|PACid:22682839 ---......------..----------.-.-.-.---------------...----.------.---


                                          110       120       130       140       150       160     
                                            |         |         |         |         |         |     
d1na6a1                          RG..SPLQDPENTGALTLLAFKLDEQGGDCKEVNIWVCASTDEEDVIETAIGEVIPGALISGPAGQI
cwb_MDP0000153538|PACid:22660264 SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT-------------VMPSSVLSSDSMHI
cwb_MDP0000268306|PACid:22630740 SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT-------------VMPSSVLSSDSMHL
cwb_MDP0000319957|PACid:22645199 SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRPQT-------------VMPSSVLSSDSMHI
cwb_MDP0000232417|PACid:22660261 SV..FVSAKRLVAGDSVLFIWNEKNQL-LLGIRRANRQQT-------------VMPSSVLSSDSMHL
cwb_MDP0000211459|PACid:22629500 SV..FVGAKRLRAGDSVLFIRDEKSQL-LIGVRRANRQQT-------------TLPSSVLSADSMHI
cwb_MDP0000143749|PACid:22644960 SL..FVGAKRLRAGDSVLFIRDEKSQL-LIGVRRANRQQT-------------TLPSSVLSADSMHI
cwb_MDP0000412781|PACid:22651617 SI..FISQKNLVAGDAVLFLRGENGEL-RLGIRRAVRPRN---------------------------
cwb_MDP0000876321|PACid:22663258 SI..FVSTKRLFAGDSVLFIRDEKSQL-LLGIRRANRQQP-------------AICSSVISSDSMHI
cwb_MDP0000225980|PACid:22683343 SI..FISQKNLVSGDAVLFLRGENGEL-RLGIRKAVRPRN-------------CLPD----------
cwb_MDP0000185253|PACid:22621202 SL..FVSGKRLFAGDSVLFIRDEKQQL-LLGIRRANRQPT-------------NLSSSVLSSDSMHI
cwb_MDP0000929655|PACid:22661337 SV..FVSSKKLVAGDAFIFLRGENGEL-RVGVRRLMRQPS-------------NMPSSVISSHSMHL
cwb_MDP0000886637|PACid:22641953 SV..FVSNKRLFAGDSVLFIRDEKSQL-LLGIRRAHRQQP-------------ALSSSVISSDSMHI
cwb_MDP0000179650|PACid:22675203 SA..FVNKKKLVSGDAVLFLRGDDGEL-RLGIRRAAQ------------------------------
cwb_MDP0000173151|PACid:22632672 SA..FVNKKKLVSGDAVLFLRGDDGEL-RLGIRRAAQ------------------------------
cwb_MDP0000294251|PACid:22639202 SV..FVSAKRLVAGDSVLFIWYIF-------------------------------------------
cwb_MDP0000134824|PACid:22673229 SL..FISGKRLFAGDSVLFIRDEKQQL-LLGIRRANRQPT-------------NLSSSVLSSDSMHI
cwb_MDP0000194603|PACid:22651584 ST..FVTSKRLVAGDAFVFLRGDNGEL-RVGVRRLARQQS-------------QIPSSVISSQSMHL
cwb_MDP0000258032|PACid:22620805 SV..FVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG-------------SVPSSVISSHSMHL
cwb_MDP0000139073|PACid:22644421 ST..FVTSKRLSAGDSFVFLRGGNGEL-RVGVRRLARQQS-------------SMPSSVISSQSMHV
cwb_MDP0000310875|PACid:22641004 SV..FVSSKRLVAGDAFIFVRGENGEL-RVGVRRAMRQQG-------------SVPSSVISSHSMHL
cwb_MDP0000550049|PACid:22646916 SV..FVSAKRLVAGDS---------------------------------------------------
cwb_MDP0000123466|PACid:22652651 ST..FVTTKRLVAGDACIFARGENGEL-CVGIRRATKTQD-------------TASTSLISGHSMQH
cwb_MDP0000138853|PACid:22674896 ST..FVAAKRLVAGDACIFARTS--------------------------------------------
cwb_MDP0000229742|PACid:22674723 SR..YVKEKRLNAGDVVLFERRRAN------------------------------------------
cwb_MDP0000214352|PACid:22681236 TT..FVTAKRLVSGDACIFASMQH-------------------------------------------
cwb_MDP0000138860|PACid:22643076 TT..FVTAKRLVSGDACIFASMQH-------------------------------------------
cwb_MDP0000256621|PACid:22648903 SK..FVNHKMLVAGDSVVFMRNGRGEM-FIGVRRAVRSTASSDCARLSSQIGG--------------
cwb_MDP0000939633|PACid:22667205 SR..FVKEKNLKAGDIVSFQRSTGPDK----------------------------------------
cwb_MDP0000138163|PACid:22622470 SR..FVKEKKLDAGDIVSFERGVGESG----------------------------------------
cwb_MDP0000288808|PACid:22628543 SR..FVKEKKLDAGDIVSFERGVGEXGK---------------------------------------
cwb_MDP0000221322|PACid:22644524 ST..FVNQKKLVAGDSIVFLRAENGDL-CVGIRRAK-------------------------------
cwb_MDP0000131481|PACid:22630798 ST..FVNQKKLVAGDSIVFLRAENGDL-CVGIRRAK-------------------------------
cwb_MDP0000247623|PACid:22644692 IR..FVKEKKLKVGDVVRFERSVGEDK----------------------------------------
cwb_MDP0000232116|PACid:22646641 SK..FVNHKMLVAGDSVVFMRNGRGEM-FIGVRRAVRASASSDCARWS-------------------
cwb_MDP0000945267|PACid:22621253 TR..FVKEKKLKAGDVLRFQRSVREDK----------------------------------------
cwb_MDP0000750392|PACid:22633787 ST..FVNHKKLVSGDSIVFLRAENGDL-CVGIRRAK-------------------------------
cwb_MDP0000128924|PACid:22664801 SR..FVKEKNLMAGDIVSFQRSTGPDK----------------------------------------
cwb_MDP0000223137|PACid:22662915 IR..FVKEKKLKVGDVVRFERSVGEDK----------------------------------------
cwb_MDP0000485280|PACid:22659457 NR..FVKENNLKANDVITFY-----------------------------------------------
cwb_MDP0000153589|PACid:22644982 IR..FVKEKKLKAGDVVRFERSVGEDK----------------------------------------
cwb_MDP0000321569|PACid:22635836 IR..FVKEKKLKAGDIVMFQRSVGEDK----------------------------------------
cwb_MDP0000207722|PACid:22671640 NR..FVKENNLKANDVITFY-----------------------------------------------
cwb_MDP0000162363|PACid:22677783 SR..FVKTHHLKAKDILTFF-----------------------------------------------
cwb_MDP0000534780|PACid:22663807 SR..FVKTHHLKAKDILTFF-----------------------------------------------
cwb_MDP0000526584|PACid:22649377 SR..FVKTHHLKAKDILTFF-----------------------------------------------
cwb_MDP0000259062|PACid:22632961 ST..FVTSKRLSAGDSFVFLRGXNGEL-RVGVRRLARQQS-------------SMPSSVISSQSMHV
cwb_MDP0000555456|PACid:22659471 YE..FTMDNNLGEGDVCVFEFLKMKDI----------------------------------------
cwb_MDP0000165802|PACid:22635978 SR..FVKTHHLKAKDILTFF-----------------------------------------------
cwb_MDP0000291591|PACid:22681743 --..---------------------------------------------------------------
cwb_MDP0000238744|PACid:22674921 YE..FTMDNNLGEGDVCVFELLKMKDI----------------------------------------
cwb_MDP0000314333|PACid:22663787 RQ..FAASHNLLEGDVLAFQLVEPTKF----------------------------------------
cwb_MDP0000161022|PACid:22675604 LE..FVRDNNLKTGDVCVFIL----------------------------------------------
cwb_MDP0000123407|PACid:22657458 GWmaFVRCNDIQLGDICIFELV---------------------------------------------
cwb_MDP0000226894|PACid:22677142 GE..VWFDK----------------------------------------------------------
cwb_MDP0000124774|PACid:22657498 PA..FVRDHYVECGDFLVFRYDS--------------------------------------------
cwb_MDP0000309680|PACid:22638461 GD..FVRANGLQEGDFIVIYSDVK-------------------------------------------
cwb_MDP0000258417|PACid:22673144 RQ..FAASHNLLEGDVLVFQLVELT------------------------------------------
cwb_MDP0000227080|PACid:22645787 GK..VWFDKG---------------------------------------------------------
cwb_MDP0000123407|PACid:22657458 PA..FVRDHYVECGDFLVFRYDS--------------------------------------------
cwb_MDP0000238744|PACid:22674921 --..---------------------------------------------------------------
cwb_MDP0000316701|PACid:22677141 --..FSEFYSLDYGDSLVF------------------------------------------------
cwb_MDP0000549056|PACid:22637942 IR..FVKEKKLKAGDVVRLERSVGEDK----------------------------------------
cwb_MDP0000192438|PACid:22632653 --..---------------------------------------------------------------
cwb_MDP0000312598|PACid:22676419 PA..FVRDHYVECGDFLIFRY----------------------------------------------
cwb_MDP0000236750|PACid:22623596 --..FSEFYSLDYGDSLVF------------------------------------------------
cwb_MDP0000555456|PACid:22659471 --..K--------------------------------------------------------------
cwb_MDP0000249417|PACid:22680044 KG..FAVAHDLVDGDALVFQLIR--------------------------------------------
cwb_MDP0000123407|PACid:22657458 GWmaFVRGNDINFGDVCIFELVGKDEM----------------------------------------
cwb_MDP0000316701|PACid:22677141 LA..FVGDNDLRVGDVCVFILIK--------------------------------------------
cwb_MDP0000155544|PACid:22633491 RG..FSIAHNLLEGDVVVFHVLAPSKL----------------------------------------
cwb_MDP0000146397|PACid:22625573 --..----------------------------------------------N----------------
cwb_MDP0000236656|PACid:22666211 RQ..FAASHNLLEGDVLVFQLV---------------------------------------------
cwb_MDP0000236750|PACid:22623596 LA..FVGDNDLRVGDVCVFILIK--------------------------------------------
cwb_MDP0000819543|PACid:22662298 RG..FSIAHKIKKGDVVIFHLVTPSKF----------------------------------------
cwb_MDP0000185981|PACid:22654058 QE..FLKDNSLGHGDFLVFTYDGKM------------------------------------------
cwb_MDP0000298218|PACid:22631518 --..----------------------------------------------N----------------
cwb_MDP0000241245|PACid:22642523 RL..FVNDNGLEIGDICVFVL----------------------------------------------
cwb_MDP0000267885|PACid:22661160 TP..CIQSMQLQAGDTVTFSRIDPGGRLVIGFR----------------------------------
cwb_MDP0000515096|PACid:22639161 NA..FALDNDLQVGELLFFNYVTDSHF----------------------------------------
cwb_MDP0000127640|PACid:22634716 TP..CIQSMQLQAGDTVTFSRIDPGGRLVIGFR----------------------------------
cwb_MDP0000229344|PACid:22665895 TP..CIQSMELQAGDTVTFSRIDPGGRLVIGFR----------------------------------
cwb_MDP0000176581|PACid:22669985 --..F--------------------------------------------------------------
cwb_MDP0000192438|PACid:22632653 KK..FVQENSLAIGDVCVFVL----------------------------------------------
cwb_MDP0000298218|PACid:22631518 LE..FVRDNNLKTGDVCVFIL----------------------------------------------
cwb_MDP0000320006|PACid:22667113 RG..FAIDHDLVDGDALVFQLIRPK------------------------------------------
cwb_MDP0000161022|PACid:22675604 SV..FARENNLKVGDLCVFELVNHDELTF--------------------------------------
cwb_MDP0000309784|PACid:22654675 GG..NAILKGPNXGTWSVKLKCENSKARFLQGWQAFVXDNNLEVDDV--------------------
cwb_MDP0000189426|PACid:22643793 HE..FLRDNSLGHGNFVVFIYD---------------------------------------------
cwb_MDP0000304769|PACid:22644689 GA..FVRQKRLEAGDCIYLYEDECKNIY---------------------------------------
cwb_MDP0000309784|PACid:22654675 LA..FVEDNNLKIGDVCVFML----------------------------------------------
cwb_MDP0000126738|PACid:22651879 --..---------------------------------------------------------------
cwb_MDP0000302532|PACid:22624442 SE..FAKFYSLNHGY----------------------------------------------------
cwb_MDP0000212684|PACid:22647103 RE..CGKANQISLGDTIVFEFVKQ-------------------------------------------
cwb_MDP0000214729|PACid:22665914 RE..CGKANQISLGDTIVFEFVKQ-------------------------------------------
cwb_MDP0000125949|PACid:22671191 --..---------------------------------------------------------------
cwb_MDP0000237202|PACid:22655382 --..---------------------------------------------------------------
cwb_MDP0000212684|PACid:22647103 --..---------------------------------------------------------------
cwb_MDP0000214729|PACid:22665914 --..---------------------------------------------------------------
cwb_MDP0000283274|PACid:22663974 KG..FAVAHDLVDGDALVFQL----------------------------------------------
cwb_MDP0000227080|PACid:22645787 --..---------------------------------------------------------------
cwb_MDP0000242456|PACid:22650200 QY..FVKDHHLENGDLLVFKYDGESKF----------------------------------------
cwb_MDP0000241386|PACid:22625419 RE..FVNDNNLKVGDACVFELLECS------------------------------------------
cwb_MDP0000302532|PACid:22624442 KA..FARENRVKVGDACVFELINKGGTRS--------------------------------------
cwb_MDP0000125949|PACid:22671191 TE..FVRGNNLEVGDVCVLVLIDDTKL----------------------------------------
cwb_MDP0000291592|PACid:22681744 --..FVGDHLLEIGNFLVF------------------------------------------------
cwb_MDP0000189426|PACid:22643793 SR..FASSNQIGIGDTCIFELLSSNEM----------------------------------------
cwb_MDP0000312598|PACid:22676419 GWmaFVRYNDIQLGDICTFEL----------------------------------------------
cwb_MDP0000252727|PACid:22647791 AX..FCXANQISVGDTVIFEFVKQ-------------------------------------------
cwb_MDP0000252726|PACid:22647790 QG..FVKDHHLEAGDLLVFDYDGE-------------------------------------------
cwb_MDP0000125949|PACid:22671191 IT..FVQDNHLEIGDVCVFALI---------------------------------------------
cwb_MDP0000200376|PACid:22644424 RG..FSIAHKIMKGDAVIFHL----------------------------------------------
cwb_MDP0000263654|PACid:22620434 QK..FSTANKLLVGNLLVFRL----------------------------------------------
cwb_MDP0000197534|PACid:22639927 KN..FVHDH----------------------------------------------------------
cwb_MDP0000199365|PACid:22642971 --..-------NSGDFYVLNGGWRPE-----------------------------------------
cwb_MDP0000314836|PACid:22664815 --..---------------------------------------------------------------
cwb_MDP0000179251|PACid:22658518 --..---------------------------------------------------------------
cwb_MDP0000490521|PACid:22639541 --..-------NSGDFYVLNGGWRP------------------------------------------
cwb_MDP0000825602|PACid:22674856 RE..FVNDNNLKVGDACVFELLECSS-----------------------------------------
cwb_MDP0000271785|PACid:22638372 EE..FVKYHNLKVGDFLVFKH----------------------------------------------
cwb_MDP0000393956|PACid:22650070 --..-------NSGDFYVLNGGWR-------------------------------------------
cwb_MDP0000292968|PACid:22636752 KS..FCHDRGL--------------------------------------------------------
cwb_MDP0000266051|PACid:22641431 --..---------------------------------------------------------------
cwb_MDP0000236750|PACid:22623596 SK..FAEFYSLDHGNLLIFSFEGDHSH----------------------------------------
cwb_MDP0000237846|PACid:22646691 RE..FVNDNNLKVGDACVFELQECSS-----------------------------------------
cwb_MDP0000257606|PACid:22645914 IT..FVQDSHLEIGDVCVFAL----------------------------------------------
cwb_MDP0000316701|PACid:22677141 RV..FAEENRLREGDVCTFELVEINDI----------------------------------------
cwb_MDP0000685403|PACid:22642568 --..-------NSGDFYVLNGGWRP------------------------------------------
cwb_MDP0000166580|PACid:22637283 GD..FVRANGLQEGDFIVIYSDVKCN-----------------------------------------
cwb_MDP0000257606|PACid:22645914 TE..FVRGNNLEVGDVYVLVLIDDTKL----------------------------------------
cwb_MDP0000271785|PACid:22638372 YK..FYEDNRLKIGDCC--------------------------------------------------
cwb_MDP0000251244|PACid:22665628 RG..FAIDHDLVDGDALVFQLIRPK------------------------------------------
cwb_MDP0000125949|PACid:22671191 --..---------------------------------------------------------------
cwb_MDP0000204389|PACid:22666456 --..---------------------------------------------------------------
cwb_MDP0000289385|PACid:22645688 --..---------------------------------------------------------------
cwb_MDP0000252726|PACid:22647790 TD..CVKANRISPGDTMIFXFVKQGLM----------------------------------------
cwb_MDP0000314836|PACid:22664815 --..------------------------------------------------------------K--
cwb_MDP0000274788|PACid:22660795 --..---------------------------------------------------------------
cwb_MDP0000652415|PACid:22653420 --..---------------------------------------------------------------
cwb_MDP0000266051|PACid:22641431 SV..FARENNXKVGDLCVFELINRNELT---------------------------------------
cwb_MDP0000236750|PACid:22623596 --..---------------------------------------------------------------
cwb_MDP0000236750|PACid:22623596 RV..FAEENRLREGDVCTFELVEINDI----------------------------------------
cwb_MDP0000152089|PACid:22663193 IF..FVKEKKLKVGDVVKFERSVG-------------------------------------------
cwb_MDP0000291592|PACid:22681744 IA..CWRANNISPGDTVVFELVNKK------------------------------------------
cwb_MDP0000252727|PACid:22647791 --..---------------------------------------------------------------
cwb_MDP0000179251|PACid:22658518 --..-------------------R-------------------------------------------
cwb_MDP0000268649|PACid:22647350 --..---------------------------------------------------------------
cwb_MDP0000160647|PACid:22627261 --..---------------------------------------------------------------
cwb_MDP0000240942|PACid:22638874 RA..FALEHKLDDGDALVFELTEP-------------------------------------------
cwb_MDP0000176581|PACid:22669985 --..---------------------------------------------------------------
cwb_MDP0000176581|PACid:22669985 ME..VVRDNNLESGDVCVFVSTNNSPKPLFDV-----------------------------------
cwb_MDP0000627043|PACid:22674813 RE..FVWRRQLKEGDLIGFCWDAHKLMLVF-------------------------------------
cwb_MDP0000309874|PACid:22623281 --..-----------------------------------------A---------------------
cwb_MDP0000123473|PACid:22645384 RE..FVWRRQLKEGDLIGFCWDAHKLMLVF-------------------------------------
cwb_MDP0000124774|PACid:22657498 --..---------------------------------------------------------------
cwb_MDP0000187657|PACid:22625109 --..---------------------------------------------------------------
cwb_MDP0000258854|PACid:22678384 --..---------------------------------------------------------------
cwb_MDP0000143319|PACid:22673778 PS..FLSFTPLDYGDCLVFRYEGN-------------------------------------------
cwb_MDP0000309874|PACid:22623281 CK..FYASNGLKEGDVCLFKL----------------------------------------------
cwb_MDP0000123668|PACid:22668503 --..---------------------------------------------------------------
cwb_MDP0000573054|PACid:22624774 RG..FSIAHKIMKGDVVIFHLVT--------------------------------------------
cwb_MDP0000794899|PACid:22625108 --..---------------------------------------------------------------
cwb_MDP0000291591|PACid:22681743 --..CWHANNISPGDTAVF------------------------------------------------
cwb_MDP0000201845|PACid:22662296 RG..FSIARKLQEGDAVIFHLVTPSKF----------------------------------------
cwb_MDP0000266051|PACid:22641431 LE..FVRDNNLKTGDVCVFIL----------------------------------------------
cwb_MDP0000215770|PACid:22651835 ST..FVNRNKLVAGDSIVFLRAENGDL----------------------------------------
cwb_MDP0000912733|PACid:22637933 ST..FVNRNKLVAGDSIVFLRAENGDL----------------------------------------
cwb_MDP0000257606|PACid:22645914 --..----------------------------------------------------------S----
cwb_MDP0000242456|PACid:22650200 GE..CXKANQVLPGDEVVFEFVKQSL-----------------------------------------
cwb_MDP0000128295|PACid:22625136 --..---------------------------------------------------------------
cwb_MDP0000143918|PACid:22630013 KQ..FVRENSLAIGDECVFTVIN--------------------------------------------
cwb_MDP0000225889|PACid:22683127 --..---------------------------------------------------------------
cwb_MDP0000766961|PACid:22642958 SV..FVSCKKLVSGDGFIFLRGENGAL-RVGVRRLMRQPS-------------NMPSSAISS-----
cwb_MDP0000795789|PACid:22682846 --..---------------------------------------------------------------
cwb_MDP0000540442|PACid:22682667 GD..VARKNKLKAGDVVQ-------------------------------------------------
cwb_MDP0000260382|PACid:22663192 --..---------------------------------------------------------------
cwb_MDP0000233653|PACid:22674667 TP..CIQSMQLLAGDIVTFSRLEPEGKLVMGFR----------------------------------
cwb_MDP0000777125|PACid:22671632 PA..FVKRRQLKEGDEIGLHWF---------------------------------------------
cwb_MDP0000280317|PACid:22657374 GK..VVKKNKLVAGDVIQ-------------------------------------------------
cwb_MDP0000247573|PACid:22627980 PA..FVKRRQLRKGDKIGLHW----------------------------------------------
cwb_MDP0000566907|PACid:22652228 --..---------------------------------------------------------------
cwb_MDP0000212063|PACid:22630334 --..---------------------------------------------------------------
cwb_MDP0000143207|PACid:22656792 --..---------------------------------------------------------------
cwb_MDP0000233293|PACid:22671029 --..---------------------------------------------------------------
cwb_MDP0000305249|PACid:22629814 --..---------------------------------------------------------------
cwb_MDP0000126738|PACid:22651879 KQ..FVRENSLAIGDECWIGF----------------------------------------------
cwb_MDP0000236750|PACid:22623596 --..---------------------------------------------------------------
cwb_MDP0000161022|PACid:22675604 --..----------------FGYEGNS----------------------------------------
cwb_MDP0000382202|PACid:22682839 --..-----P---------------------------------------------------------


                                   170                                                              
                                     |                                                              
d1na6a1                          LGGLSLQQ--ap.......................................................
cwb_MDP0000153538|PACid:22660264 GLLAAAAH--a........................................................
cwb_MDP0000268306|PACid:22630740 GLLAAAAH--a........................................................
cwb_MDP0000319957|PACid:22645199 GLLAAAAH--a........................................................
cwb_MDP0000232417|PACid:22660261 GLLAAAAH--a........................................................
cwb_MDP0000211459|PACid:22629500 GVLAAAAH--a........................................................
cwb_MDP0000143749|PACid:22644960 GVLAAAAH--a........................................................
cwb_MDP0000412781|PACid:22651617 ----------glpdsvv..................................................
cwb_MDP0000876321|PACid:22663258 GILAAAAH--a........................................................
cwb_MDP0000225980|PACid:22683343 ----------svv......................................................
cwb_MDP0000185253|PACid:22621202 GILAAAAH--a........................................................
cwb_MDP0000929655|PACid:22661337 GVLATASH--a........................................................
cwb_MDP0000886637|PACid:22641953 GILAAAAH--a........................................................
cwb_MDP0000179650|PACid:22675203 ----------vkss.....................................................
cwb_MDP0000173151|PACid:22632672 ----------fkss.....................................................
cwb_MDP0000294251|PACid:22639202 ----------rls......................................................
cwb_MDP0000134824|PACid:22673229 GILAAAAH--a........................................................
cwb_MDP0000194603|PACid:22651584 GVLATASH--a........................................................
cwb_MDP0000258032|PACid:22620805 GVLATAWH--a........................................................
cwb_MDP0000139073|PACid:22644421 GVLATASH--a........................................................
cwb_MDP0000310875|PACid:22641004 GVLATAWH--a........................................................
cwb_MDP0000550049|PACid:22646916 ----------v........................................................
cwb_MDP0000123466|PACid:22652651 GILASAFH--a........................................................
cwb_MDP0000138853|PACid:22674896 ----------paa......................................................
cwb_MDP0000229742|PACid:22674723 ----------tdrlsigwrr...............................................
cwb_MDP0000214352|PACid:22681236 ----------gil......................................................
cwb_MDP0000138860|PACid:22643076 ----------gil......................................................
cwb_MDP0000256621|PACid:22648903 ----------gvtystrlnt...............................................
cwb_MDP0000939633|PACid:22667205 ----------hlyidwktr................................................
cwb_MDP0000138163|PACid:22622470 ----------kdrlfidwkgrp.............................................
cwb_MDP0000288808|PACid:22628543 ----------drlyidwrrrp..............................................
cwb_MDP0000221322|PACid:22644524 ----------rgldg....................................................
cwb_MDP0000131481|PACid:22630798 ----------rgldg....................................................
cwb_MDP0000247623|PACid:22644692 ----------klfidcrs.................................................
cwb_MDP0000232116|PACid:22646641 ----------yhiggg...................................................
cwb_MDP0000945267|PACid:22621253 ----------klfie....................................................
cwb_MDP0000750392|PACid:22633787 ----------rgsg.....................................................
cwb_MDP0000128924|PACid:22664801 ----------qlyidw...................................................
cwb_MDP0000223137|PACid:22662915 ----------klfidcrs.................................................
cwb_MDP0000485280|PACid:22659457 ----------aces.....................................................
cwb_MDP0000153589|PACid:22644982 ----------klfidc...................................................
cwb_MDP0000321569|PACid:22635836 ----------klfie....................................................
cwb_MDP0000207722|PACid:22671640 ----------aces.....................................................
cwb_MDP0000162363|PACid:22677783 ----------qch......................................................
cwb_MDP0000534780|PACid:22663807 ----------qc.......................................................
cwb_MDP0000526584|PACid:22649377 ----------qc.......................................................
cwb_MDP0000259062|PACid:22632961 GVLATASH--a........................................................
cwb_MDP0000555456|PACid:22659471 ----------vlkvtvfr.................................................
cwb_MDP0000165802|PACid:22635978 ----------qc.......................................................
cwb_MDP0000291591|PACid:22681743 ----------kctlrgpsgeswtvglegredgkfffrkgwqnfvedhlleignflvfkydgdtkfdv
cwb_MDP0000238744|PACid:22674921 ----------vlkvtvfr.................................................
cwb_MDP0000314333|PACid:22663787 ----------kvyiirsng................................................
cwb_MDP0000161022|PACid:22675604 ----------ikgielafev...............................................
cwb_MDP0000123407|PACid:22657458 ----------recefrvhiq...............................................
cwb_MDP0000226894|PACid:22677142 ----------gwpkfsefyslgygdrlifryegnskfhacifdrs......................
cwb_MDP0000124774|PACid:22657498 ----------dlcftvlifdqsac...........................................
cwb_MDP0000309680|PACid:22638461 ----------cnkym....................................................
cwb_MDP0000258417|PACid:22673144 ----------kfkvyiirsng..............................................
cwb_MDP0000227080|PACid:22645787 ----------wpkfsefyslgygdclifryegnskfhacifdrs.......................
cwb_MDP0000123407|PACid:22657458 ----------dlcftvlifdqsac...........................................
cwb_MDP0000238744|PACid:22674921 ----------hvgvkkvdnkfwfhsgwqdfiehysirvgyfltfrhegrssftvhifnl........
cwb_MDP0000316701|PACid:22677141 ----------ryegnskfhvcifdrs.........................................
cwb_MDP0000549056|PACid:22637942 ----------klfidc...................................................
cwb_MDP0000192438|PACid:22632653 ----------rydgevwlekgwpdfshfysldfahwlvfgyegnskflvrifdrsc...........
cwb_MDP0000312598|PACid:22676419 ----------dgdlcftvlifdqsac.........................................
cwb_MDP0000236750|PACid:22623596 ----------ryegnskfhvcifdrs.........................................
cwb_MDP0000555456|PACid:22659471 ----------vdnkfwfhggwlefiehysirvgyfltfryeghssftvhifnl..............
cwb_MDP0000249417|PACid:22680044 ----------pttfkvyiirv..............................................
cwb_MDP0000123407|PACid:22657458 ----------qvhisg...................................................
cwb_MDP0000316701|PACid:22677141 ----------diplsfevvfyr.............................................
cwb_MDP0000155544|PACid:22633491 ----------kvyivrsng................................................
cwb_MDP0000146397|PACid:22625573 ----------gevwfekgwpefskfysldyafwlvfgyegnsrfhvfifdrsc..............
cwb_MDP0000236656|PACid:22666211 ----------eltkf....................................................
cwb_MDP0000236750|PACid:22623596 ----------diplsfevvfyr.............................................
cwb_MDP0000819543|PACid:22662298 ----------kvyivrsn.................................................
cwb_MDP0000185981|PACid:22654058 ----------qfsidifdntac.............................................
cwb_MDP0000298218|PACid:22631518 ----------gevwfekgwpefskfysldyafwlvfgyegnsrfhvfifdrsc..............
cwb_MDP0000241245|PACid:22642523 ----------inkixflfe................................................
cwb_MDP0000267885|PACid:22661160 ----------ka.......................................................
cwb_MDP0000515096|PACid:22639161 ----------dvkicdksgc...............................................
cwb_MDP0000127640|PACid:22634716 ----------ka.......................................................
cwb_MDP0000229344|PACid:22665895 ----------k........................................................
cwb_MDP0000176581|PACid:22669985 ----------skfysldcghwlvfryegnskfnvcifdksc..........................
cwb_MDP0000192438|PACid:22632653 ----------idnikplfnviff............................................
cwb_MDP0000298218|PACid:22631518 ----------ikgiela..................................................
cwb_MDP0000320006|PACid:22667113 ----------tlkvx....................................................
cwb_MDP0000161022|PACid:22675604 ----------evvffra..................................................
cwb_MDP0000309784|PACid:22654675 ----------cvftlmkdvklsfevfvfg......................................
cwb_MDP0000189426|PACid:22643793 ----------grmkfsirvfgmnac..........................................
cwb_MDP0000304769|PACid:22644689 ----------vyv......................................................
cwb_MDP0000309784|PACid:22654675 ----------ikgfkitfevafyrs..........................................
cwb_MDP0000126738|PACid:22651879 ----------pvffkvpsalewkielrkwdgevwfengwqdfssfysldyghllvlgyernskfrvl
cwb_MDP0000302532|PACid:22624442 ----------llvfsheggfshflvrifqrn....................................
cwb_MDP0000212684|PACid:22647103 ----------sviqvhifrkg..............................................
cwb_MDP0000214729|PACid:22665914 ----------sviqvhifrkg..............................................
cwb_MDP0000125949|PACid:22671191 ----------gsewkielriwegevwfgegwpkfskfcsldcchslvfgyegnstfrvsvfdkd...
cwb_MDP0000237202|PACid:22655382 ----------gs.......................................................
cwb_MDP0000212684|PACid:22647103 ----------rslckcdlkgptgirrtveleerenglffhdgwqgfvkdhlleagdflvfxydgvsk
cwb_MDP0000214729|PACid:22665914 ----------rslckcdlkgptgirrtveleerenglffhdgwqgfvkdhlleagdflvfxydgvsk
cwb_MDP0000283274|PACid:22663974 ----------irpttf...................................................
cwb_MDP0000227080|PACid:22645787 ----------arflldwlafvednnlkigd.....................................
cwb_MDP0000242456|PACid:22650200 ----------kvaiydttacekd............................................
cwb_MDP0000241386|PACid:22625419 ----------stklif...................................................
cwb_MDP0000302532|PACid:22624442 ----------atfkvgvyr................................................
cwb_MDP0000125949|PACid:22671191 ----------efevvifra................................................
cwb_MDP0000291592|PACid:22681744 ----------eydgntnfevkiynptgc.......................................
cwb_MDP0000189426|PACid:22643793 ----------kvriiq...................................................
cwb_MDP0000312598|PACid:22676419 ----------vrefefcvhiq..............................................
cwb_MDP0000252727|PACid:22647791 ----------sviqihvfr................................................
cwb_MDP0000252726|PACid:22647790 ----------tkfnvkiydrsac............................................
cwb_MDP0000125949|PACid:22671191 ----------nnikglmdvvifrt...........................................
cwb_MDP0000200376|PACid:22644424 ----------vtpfkfk..................................................
cwb_MDP0000263654|PACid:22620434 ----------vrplkfk..................................................
cwb_MDP0000197534|PACid:22639927 ----------glvekqdfvtlwvfrnadngslcf.................................
cwb_MDP0000199365|PACid:22642971 ----------fvvrrglkendqiglyldwdwktskyifrfsvlq.......................
cwb_MDP0000314836|PACid:22664815 ----------slgekkldkalikscqgswdvqvrrtcdgvfcfkqgwkevvknhslevgeflvfehk
cwb_MDP0000179251|PACid:22658518 ----------slgekkldkalikscqgswdvqvrrtcdgvfcfkqgwkevvknhslevgeflvfehk
cwb_MDP0000490521|PACid:22639541 ----------efvvrrglkendeiglyldwdwktskyifrfsvlq......................
cwb_MDP0000825602|PACid:22674856 ----------tklafrvq.................................................
cwb_MDP0000271785|PACid:22638372 ----------lgrmvfhvnvyeplgcekaf.....................................
cwb_MDP0000393956|PACid:22650070 ----------pefmvrrglkendeiglyldwdwktskcifrfsv.......................
cwb_MDP0000292968|PACid:22636752 ----------vekidfvtvwvfrnv..........................................
cwb_MDP0000266051|PACid:22641431 ----------fskfysldyafwlvfgyegnsrfhvfifdrsc.........................
cwb_MDP0000236750|PACid:22623596 ----------fhvrifsrs................................................
cwb_MDP0000237846|PACid:22646691 ----------tklafrv..................................................
cwb_MDP0000257606|PACid:22645914 ----------innikglmdvvifh...........................................
cwb_MDP0000316701|PACid:22677141 ----------vlkvhifrr................................................
cwb_MDP0000685403|PACid:22642568 ----------efvvrrglkendeiglyldwdwktskyifrfsvlq......................
cwb_MDP0000166580|PACid:22637283 ----------kymi.....................................................
cwb_MDP0000257606|PACid:22645914 ----------vfevvifrat...............................................
cwb_MDP0000271785|PACid:22638372 ----------kfvlk....................................................
cwb_MDP0000251244|PACid:22665628 ----------tlkvr....................................................
cwb_MDP0000125949|PACid:22671191 ----------lrvsggrtwpvklhqysktvlkfqsgwmtfvqdngleigdsf...............
cwb_MDP0000204389|PACid:22666456 ----------pmvfktwmskinvltggwnsfrqdrglvekidfvtvwvfrn................
cwb_MDP0000289385|PACid:22645688 ----------pmvfktwmskinvltggwnsfrqdrglvekidfvtvwvfrn................
cwb_MDP0000252726|PACid:22647790 ----------rvhifkk..................................................
cwb_MDP0000314836|PACid:22664815 ----------ekieaawsrrtylkskgwiefykanklkdadvcifeliqvpksrskpvimnvkifr.
cwb_MDP0000274788|PACid:22660795 ----------nnsrmyvlegvtpciqsmqllagdi................................
cwb_MDP0000652415|PACid:22653420 ----------tngvdyemelgtwnsgtrvlagegwknfrkahglmayrdfltlwmfrnadttklcmf
cwb_MDP0000266051|PACid:22641431 ----------fevvffra.................................................
cwb_MDP0000236750|PACid:22623596 ----------wlrrgwlkfarfyflelgclllftykgvyshfqvrifrrn.................
cwb_MDP0000236750|PACid:22623596 ----------vlkviqfg.................................................
cwb_MDP0000152089|PACid:22663193 ----------edkkmfiycr...............................................
cwb_MDP0000291592|PACid:22681744 ----------rsemkihffr...............................................
cwb_MDP0000252727|PACid:22647791 ----------lkgpsgkrwiveleerenglffyaagwqdfvkdhllqvgdfl...............
cwb_MDP0000179251|PACid:22658518 ----------tylkskgwiefykanklkdadvcifeliqvpksrskpvimnvkifr...........
cwb_MDP0000268649|PACid:22647350 ----------nnsrmyvlentgty...........................................
cwb_MDP0000160647|PACid:22627261 ----------srmyvf...................................................
cwb_MDP0000240942|PACid:22638874 ----------trfkiyivkv...............................................
cwb_MDP0000176581|PACid:22669985 ----------lwlpxkfcklrpikescevilqvsxgrtwtvdxryeegkatfrrgwm..........
cwb_MDP0000176581|PACid:22669985 ----------vffrs....................................................
cwb_MDP0000627043|PACid:22674813 ----------svimr....................................................
cwb_MDP0000309874|PACid:22623281 ----------feegweefakcnglkeadnavfehkgdmafnmvaydsggcekeyp............
cwb_MDP0000123473|PACid:22645384 ----------svimr....................................................
cwb_MDP0000124774|PACid:22657498 ----------ggwmaf...................................................
cwb_MDP0000187657|PACid:22625109 ----------rmrwgkcggldiaigvvvrasyvlskgwirfvkekklkvgdvv..............
cwb_MDP0000258854|PACid:22678384 ----------fvvrrglkendeiglyldwdwktskyifrfsvlqr......................
cwb_MDP0000143319|PACid:22673778 ----------skfhvcifd................................................
cwb_MDP0000309874|PACid:22623281 ----------krmsr....................................................
cwb_MDP0000123668|PACid:22668503 ----------g........................................................
cwb_MDP0000573054|PACid:22624774 ----------pfkfevyivrsn.............................................
cwb_MDP0000794899|PACid:22625108 ----------hlxvgfgkgvllkfedevgkekklkvgdvvkfersvgedkkmfiycr..........
cwb_MDP0000291591|PACid:22681743 ----------elvnekrsemkihffra........................................
cwb_MDP0000201845|PACid:22662296 ----------kvyiirsn.................................................
cwb_MDP0000266051|PACid:22641431 ----------ikgielafev...............................................
cwb_MDP0000215770|PACid:22651835 ----------cvgir....................................................
cwb_MDP0000912733|PACid:22637933 ----------cvgir....................................................
cwb_MDP0000257606|PACid:22645914 ----------ktvlkfqsgwmtfvqdngleigdsf................................
cwb_MDP0000242456|PACid:22650200 ----------lqihiyrv.................................................
cwb_MDP0000128295|PACid:22625136 ----------drtg.....................................................
cwb_MDP0000143918|PACid:22630013 ----------ttkplfdvvi...............................................
cwb_MDP0000225889|PACid:22683127 ----------gweafskanniqpgdtcaigiedasericsvhiir......................
cwb_MDP0000766961|PACid:22642958 ----------h........................................................
cwb_MDP0000795789|PACid:22682846 ----------npiyvlrtqwgdvarknklkaadlvqvwsfrvnralh....................
cwb_MDP0000540442|PACid:22682667 ----------vgrfrgavldei.............................................
cwb_MDP0000260382|PACid:22663192 ----------vhlrvgfgkgvllkfedeekklkvgdvvkfersvgedkkmfiycr............
cwb_MDP0000233653|PACid:22674667 ----------ka.......................................................
cwb_MDP0000777125|PACid:22671632 ----------ktnsklvllf...............................................
cwb_MDP0000280317|PACid:22657374 ----------vwsfrangnq...............................................
cwb_MDP0000247573|PACid:22627980 ----------lktnskpvlff..............................................
cwb_MDP0000566907|PACid:22652228 ----------gavaqrnklkpgqlvqvwsfrvnga................................
cwb_MDP0000212063|PACid:22630334 ----------lepdkvslglwtmssksqktyvlkstwfgiverhslgvgdvvqvwsfratnpk....
cwb_MDP0000143207|PACid:22656792 ----------skleqvpislglwkmssnskteesddpkrtyvlksqwnhivkkhglgkgdvvqvwsf
cwb_MDP0000233293|PACid:22671029 ----------idsglkerklwlakwfthtqssfsyvlgrgwrtilkdeevglnendviqvwsfr...
cwb_MDP0000305249|PACid:22629814 ----------idsglkerklwlakwfthtqssfsyvlgrgwrtilkdeevglnendviqvwsfr...
cwb_MDP0000126738|PACid:22651879 ----------vrp......................................................
cwb_MDP0000236750|PACid:22623596 ----------cesgerkvtlkisdmrswsvkciiqnh..............................
cwb_MDP0000161022|PACid:22675604 ----------rfhvfifdrsctevdyp........................................
cwb_MDP0000382202|PACid:22682839 ----------ekngsiiyvlrtqwgavakrnklkpgqlvqvwsfrvngalyl...............


                                                   
                                                   
d1na6a1                          ..................
cwb_MDP0000153538|PACid:22660264 ..................
cwb_MDP0000268306|PACid:22630740 ..................
cwb_MDP0000319957|PACid:22645199 ..................
cwb_MDP0000232417|PACid:22660261 ..................
cwb_MDP0000211459|PACid:22629500 ..................
cwb_MDP0000143749|PACid:22644960 ..................
cwb_MDP0000412781|PACid:22651617 ..................
cwb_MDP0000876321|PACid:22663258 ..................
cwb_MDP0000225980|PACid:22683343 ..................
cwb_MDP0000185253|PACid:22621202 ..................
cwb_MDP0000929655|PACid:22661337 ..................
cwb_MDP0000886637|PACid:22641953 ..................
cwb_MDP0000179650|PACid:22675203 ..................
cwb_MDP0000173151|PACid:22632672 ..................
cwb_MDP0000294251|PACid:22639202 ..................
cwb_MDP0000134824|PACid:22673229 ..................
cwb_MDP0000194603|PACid:22651584 ..................
cwb_MDP0000258032|PACid:22620805 ..................
cwb_MDP0000139073|PACid:22644421 ..................
cwb_MDP0000310875|PACid:22641004 ..................
cwb_MDP0000550049|PACid:22646916 ..................
cwb_MDP0000123466|PACid:22652651 ..................
cwb_MDP0000138853|PACid:22674896 ..................
cwb_MDP0000229742|PACid:22674723 ..................
cwb_MDP0000214352|PACid:22681236 ..................
cwb_MDP0000138860|PACid:22643076 ..................
cwb_MDP0000256621|PACid:22648903 ..................
cwb_MDP0000939633|PACid:22667205 ..................
cwb_MDP0000138163|PACid:22622470 ..................
cwb_MDP0000288808|PACid:22628543 ..................
cwb_MDP0000221322|PACid:22644524 ..................
cwb_MDP0000131481|PACid:22630798 ..................
cwb_MDP0000247623|PACid:22644692 ..................
cwb_MDP0000232116|PACid:22646641 ..................
cwb_MDP0000945267|PACid:22621253 ..................
cwb_MDP0000750392|PACid:22633787 ..................
cwb_MDP0000128924|PACid:22664801 ..................
cwb_MDP0000223137|PACid:22662915 ..................
cwb_MDP0000485280|PACid:22659457 ..................
cwb_MDP0000153589|PACid:22644982 ..................
cwb_MDP0000321569|PACid:22635836 ..................
cwb_MDP0000207722|PACid:22671640 ..................
cwb_MDP0000162363|PACid:22677783 ..................
cwb_MDP0000534780|PACid:22663807 ..................
cwb_MDP0000526584|PACid:22649377 ..................
cwb_MDP0000259062|PACid:22632961 ..................
cwb_MDP0000555456|PACid:22659471 ..................
cwb_MDP0000165802|PACid:22635978 ..................
cwb_MDP0000291591|PACid:22681743 kiynptgc..........
cwb_MDP0000238744|PACid:22674921 ..................
cwb_MDP0000314333|PACid:22663787 ..................
cwb_MDP0000161022|PACid:22675604 ..................
cwb_MDP0000123407|PACid:22657458 ..................
cwb_MDP0000226894|PACid:22677142 ..................
cwb_MDP0000124774|PACid:22657498 ..................
cwb_MDP0000309680|PACid:22638461 ..................
cwb_MDP0000258417|PACid:22673144 ..................
cwb_MDP0000227080|PACid:22645787 ..................
cwb_MDP0000123407|PACid:22657458 ..................
cwb_MDP0000238744|PACid:22674921 ..................
cwb_MDP0000316701|PACid:22677141 ..................
cwb_MDP0000549056|PACid:22637942 ..................
cwb_MDP0000192438|PACid:22632653 ..................
cwb_MDP0000312598|PACid:22676419 ..................
cwb_MDP0000236750|PACid:22623596 ..................
cwb_MDP0000555456|PACid:22659471 ..................
cwb_MDP0000249417|PACid:22680044 ..................
cwb_MDP0000123407|PACid:22657458 ..................
cwb_MDP0000316701|PACid:22677141 ..................
cwb_MDP0000155544|PACid:22633491 ..................
cwb_MDP0000146397|PACid:22625573 ..................
cwb_MDP0000236656|PACid:22666211 ..................
cwb_MDP0000236750|PACid:22623596 ..................
cwb_MDP0000819543|PACid:22662298 ..................
cwb_MDP0000185981|PACid:22654058 ..................
cwb_MDP0000298218|PACid:22631518 ..................
cwb_MDP0000241245|PACid:22642523 ..................
cwb_MDP0000267885|PACid:22661160 ..................
cwb_MDP0000515096|PACid:22639161 ..................
cwb_MDP0000127640|PACid:22634716 ..................
cwb_MDP0000229344|PACid:22665895 ..................
cwb_MDP0000176581|PACid:22669985 ..................
cwb_MDP0000192438|PACid:22632653 ..................
cwb_MDP0000298218|PACid:22631518 ..................
cwb_MDP0000320006|PACid:22667113 ..................
cwb_MDP0000161022|PACid:22675604 ..................
cwb_MDP0000309784|PACid:22654675 ..................
cwb_MDP0000189426|PACid:22643793 ..................
cwb_MDP0000304769|PACid:22644689 ..................
cwb_MDP0000309784|PACid:22654675 ..................
cwb_MDP0000126738|PACid:22651879 ilers.............
cwb_MDP0000302532|PACid:22624442 ..................
cwb_MDP0000212684|PACid:22647103 ..................
cwb_MDP0000214729|PACid:22665914 ..................
cwb_MDP0000125949|PACid:22671191 ..................
cwb_MDP0000237202|PACid:22655382 ..................
cwb_MDP0000212684|PACid:22647103 fnvkiydrsac.......
cwb_MDP0000214729|PACid:22665914 fnvkiydrsac.......
cwb_MDP0000283274|PACid:22663974 ..................
cwb_MDP0000227080|PACid:22645787 ..................
cwb_MDP0000242456|PACid:22650200 ..................
cwb_MDP0000241386|PACid:22625419 ..................
cwb_MDP0000302532|PACid:22624442 ..................
cwb_MDP0000125949|PACid:22671191 ..................
cwb_MDP0000291592|PACid:22681744 ..................
cwb_MDP0000189426|PACid:22643793 ..................
cwb_MDP0000312598|PACid:22676419 ..................
cwb_MDP0000252727|PACid:22647791 ..................
cwb_MDP0000252726|PACid:22647790 ..................
cwb_MDP0000125949|PACid:22671191 ..................
cwb_MDP0000200376|PACid:22644424 ..................
cwb_MDP0000263654|PACid:22620434 ..................
cwb_MDP0000197534|PACid:22639927 ..................
cwb_MDP0000199365|PACid:22642971 ..................
cwb_MDP0000314836|PACid:22664815 gnmvfnvkvyeplgcxkx
cwb_MDP0000179251|PACid:22658518 gnmvfnvkvyeplgcxkx
cwb_MDP0000490521|PACid:22639541 ..................
cwb_MDP0000825602|PACid:22674856 ..................
cwb_MDP0000271785|PACid:22638372 ..................
cwb_MDP0000393956|PACid:22650070 ..................
cwb_MDP0000292968|PACid:22636752 ..................
cwb_MDP0000266051|PACid:22641431 ..................
cwb_MDP0000236750|PACid:22623596 ..................
cwb_MDP0000237846|PACid:22646691 ..................
cwb_MDP0000257606|PACid:22645914 ..................
cwb_MDP0000316701|PACid:22677141 ..................
cwb_MDP0000685403|PACid:22642568 ..................
cwb_MDP0000166580|PACid:22637283 ..................
cwb_MDP0000257606|PACid:22645914 ..................
cwb_MDP0000271785|PACid:22638372 ..................
cwb_MDP0000251244|PACid:22665628 ..................
cwb_MDP0000125949|PACid:22671191 ..................
cwb_MDP0000204389|PACid:22666456 ..................
cwb_MDP0000289385|PACid:22645688 ..................
cwb_MDP0000252726|PACid:22647790 ..................
cwb_MDP0000314836|PACid:22664815 ..................
cwb_MDP0000274788|PACid:22660795 ..................
cwb_MDP0000652415|PACid:22653420 ..................
cwb_MDP0000266051|PACid:22641431 ..................
cwb_MDP0000236750|PACid:22623596 ..................
cwb_MDP0000236750|PACid:22623596 ..................
cwb_MDP0000152089|PACid:22663193 ..................
cwb_MDP0000291592|PACid:22681744 ..................
cwb_MDP0000252727|PACid:22647791 ..................
cwb_MDP0000179251|PACid:22658518 ..................
cwb_MDP0000268649|PACid:22647350 ..................
cwb_MDP0000160647|PACid:22627261 ..................
cwb_MDP0000240942|PACid:22638874 ..................
cwb_MDP0000176581|PACid:22669985 ..................
cwb_MDP0000176581|PACid:22669985 ..................
cwb_MDP0000627043|PACid:22674813 ..................
cwb_MDP0000309874|PACid:22623281 ..................
cwb_MDP0000123473|PACid:22645384 ..................
cwb_MDP0000124774|PACid:22657498 ..................
cwb_MDP0000187657|PACid:22625109 ..................
cwb_MDP0000258854|PACid:22678384 ..................
cwb_MDP0000143319|PACid:22673778 ..................
cwb_MDP0000309874|PACid:22623281 ..................
cwb_MDP0000123668|PACid:22668503 ..................
cwb_MDP0000573054|PACid:22624774 ..................
cwb_MDP0000794899|PACid:22625108 ..................
cwb_MDP0000291591|PACid:22681743 ..................
cwb_MDP0000201845|PACid:22662296 ..................
cwb_MDP0000266051|PACid:22641431 ..................
cwb_MDP0000215770|PACid:22651835 ..................
cwb_MDP0000912733|PACid:22637933 ..................
cwb_MDP0000257606|PACid:22645914 ..................
cwb_MDP0000242456|PACid:22650200 ..................
cwb_MDP0000128295|PACid:22625136 ..................
cwb_MDP0000143918|PACid:22630013 ..................
cwb_MDP0000225889|PACid:22683127 ..................
cwb_MDP0000766961|PACid:22642958 ..................
cwb_MDP0000795789|PACid:22682846 ..................
cwb_MDP0000540442|PACid:22682667 ..................
cwb_MDP0000260382|PACid:22663192 ..................
cwb_MDP0000233653|PACid:22674667 ..................
cwb_MDP0000777125|PACid:22671632 ..................
cwb_MDP0000280317|PACid:22657374 ..................
cwb_MDP0000247573|PACid:22627980 ..................
cwb_MDP0000566907|PACid:22652228 ..................
cwb_MDP0000212063|PACid:22630334 ..................
cwb_MDP0000143207|PACid:22656792 ..................
cwb_MDP0000233293|PACid:22671029 ..................
cwb_MDP0000305249|PACid:22629814 ..................
cwb_MDP0000126738|PACid:22651879 ..................
cwb_MDP0000236750|PACid:22623596 ..................
cwb_MDP0000161022|PACid:22675604 ..................
cwb_MDP0000382202|PACid:22682839 ..................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]