SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1                            s................................................................
kle_Thhalv10006747m|PACid:20185923 l................................................................
kle_Thhalv10006754m|PACid:20185924 l................................................................
kle_Thhalv10018139m|PACid:20192001 pie..............................................................
kle_Thhalv10006748m|PACid:20187001 lrg..............................................................
kle_Thhalv10023325m|PACid:20201174 v................................................................
kle_Thhalv10023326m|PACid:20201173 v................................................................
kle_Thhalv10006635m|PACid:20185449 lk...............................................................
kle_Thhalv10012513m|PACid:20203957 lkl..............................................................
kle_Thhalv10016394m|PACid:20181239 vl...............................................................
kle_Thhalv10012728m|PACid:20205149 k................................................................
kle_Thhalv10003641m|PACid:20199612 q................................................................
kle_Thhalv10001365m|PACid:20188811 ldp..............................................................
kle_Thhalv10005857m|PACid:20190472 p................................................................
kle_Thhalv10024662m|PACid:20195558 et...............................................................
kle_Thhalv10024554m|PACid:20195557 et...............................................................
kle_Thhalv10012074m|PACid:20185111 rt...............................................................
kle_Thhalv10010019m|PACid:20188671 saep.............................................................
kle_Thhalv10029379m|PACid:20196948 s................................................................
kle_Thhalv10006123m|PACid:20190422 e................................................................
kle_Thhalv10019566m|PACid:20192106 v................................................................
kle_Thhalv10007983m|PACid:20187835 pre..............................................................
kle_Thhalv10017156m|PACid:20181075 ea...............................................................
kle_Thhalv10029161m|PACid:20197833 rkv..............................................................
kle_Thhalv10021305m|PACid:20183091 s................................................................
kle_Thhalv10028783m|PACid:20197484 .................................................................
kle_Thhalv10015675m|PACid:20205196 qkes.............................................................
kle_Thhalv10001555m|PACid:20188796 e................................................................
kle_Thhalv10008068m|PACid:20187490 ke...............................................................
kle_Thhalv10004508m|PACid:20200254 es...............................................................
kle_Thhalv10024601m|PACid:20195479 ekt..............................................................
kle_Thhalv10016329m|PACid:20180956 ekp..............................................................
kle_Thhalv10018331m|PACid:20192490 dee..............................................................
kle_Thhalv10012152m|PACid:20184762 q................................................................
kle_Thhalv10012161m|PACid:20185016 q................................................................
kle_Thhalv10012356m|PACid:20184298 l................................................................
kle_Thhalv10012377m|PACid:20184279 q................................................................
kle_Thhalv10019015m|PACid:20192089 lepgfpsfvksmlqshvtggfwlglphqfcrthlphrdem.........................
kle_Thhalv10027164m|PACid:20194005 panphffqplltgshshlsipvkffskhiegkyegktv...........................
kle_Thhalv10021527m|PACid:20183453 espvknffkvvlpstmksnmmriptrfvklqgsklsevvtlespvgfkrsiklkrigeeiwfqeg
kle_Thhalv10000111m|PACid:20208496 psyfvakvspstlrqdrlylprnfsrengldtrcgeivlmnemgrswtlnlkrknscgtayirr.
kle_Thhalv10010633m|PACid:20207509 prffkvflsetssesmripvsfnehledplprtaklhgtgggiwtvgftkr..............
kle_Thhalv10000999m|PACid:20202791 prffkvflsetasesmsipvsfsehledplpqtvklqgt..........................
kle_Thhalv10014972m|PACid:20203483 prffkfflsvttsesm.................................................
kle_Thhalv10000010m|PACid:20208455 sqnrfltltitpdslrhgrlriplqfmrenrmntpgditllgkdgakwlvslllerrgrmslgk.
kle_Thhalv10012062m|PACid:20185054 feptnpffrvvlrpsylyrgcim..........................................
kle_Thhalv10000010m|PACid:20208455 sqnrfltltitpdslrhgrlrlplqfmrensmntpgditllgkdgakwlvslllerrgrmslgk.
kle_Thhalv10005481m|PACid:20199536 f................................................................
kle_Thhalv10000010m|PACid:20208455 sqnpfvtltvthdslrncrlhlplsfmrkngldksgmitllgkdgtkwpanllrenatgrmsl..
kle_Thhalv10003110m|PACid:20196814 ll...............................................................
kle_Thhalv10025105m|PACid:20195192 panphffqpllsrfqshlkipvkffskhiegkhegkt............................
kle_Thhalv10000028m|PACid:20208357 sqkqsvtltmtpysvkkcilrlpkaftrendinkhamiillgkdgikhqtkllwdkgtgimtlgk
kle_Thhalv10009082m|PACid:20186232 esfikpfisekssesleiplgfneyfphplpntv...............................
kle_Thhalv10021075m|PACid:20182250 feptnpffrvvlrpsylyrgcim..........................................
kle_Thhalv10000579m|PACid:20208620 sdhscfvalvtasnlqddalylpkeftssngltrrcr............................
kle_Thhalv10001785m|PACid:20189016 ssssaatfsltikqshllvl.............................................
kle_Thhalv10000130m|PACid:20208871 dqscfevtvtasnlkrdvvylpktfaevnglikkseivlmneegeswkid...............
kle_Thhalv10000010m|PACid:20208455 sdhscfvalvtasnlhtda..............................................
kle_Thhalv10028696m|PACid:20196953 dtpprffkvfishfssdsmlipisyydelprllpetailqgtggcswnvamnlkeeevcfeqg..
kle_Thhalv10021075m|PACid:20182250 rpffhklifsstiqekrlrvpdkfvskfkdelsvavaltvpdghvwrvgl...............
kle_Thhalv10027418m|PACid:20195830 seksylvahvtasnl..................................................
kle_Thhalv10004496m|PACid:20199788 sqpkdleffkvflpefsareleiptafidilekpipkqvllvdeigrlwgvetkaeernrlvvfq
kle_Thhalv10015705m|PACid:20206714 gdnpgffkilrkedlsseimrmiphqfirsisdnsssfkmvlklp....................
kle_Thhalv10027164m|PACid:20194005 sssdltcfrqfvtasnlsrdtvgvpsafakrnglnkgsqeiilmneegrswpsqqktlvdyrivi
kle_Thhalv10000130m|PACid:20208871 spdhscfvaivtasnlerdtvylpkkfavsngllkkreidlvnekgksw................
kle_Thhalv10009849m|PACid:20185584 ll...............................................................
kle_Thhalv10000010m|PACid:20208455 sekrfvtftlapvdvrhcrlrlpmqfsrenginkpgkiyllgndgskwlanlllesrgrmtvgd.
kle_Thhalv10000279m|PACid:20208355 sqnrfvtltlthdsfknsrlglplpfmrengmnqpgtiallgkdgt...................
kle_Thhalv10027291m|PACid:20195068 flvamkrshvltkcfltipikwsaknmshepqevvmqm...........................
kle_Thhalv10000028m|PACid:20208357 qdqflsftitpysvekcilplprkftrenginkprmitllgkdgikqqtkl..............
kle_Thhalv10029137m|PACid:20197359 sqkqfvtititpdnlrknrlrfpkqfvkensmnkpgmiyllrkdgtkwmvnlvqerdgrms....
kle_Thhalv10028050m|PACid:20189955 pscfvakispatlrydslrlpvkfwrenglnrrcgeivlmnekgtswtlnlkqkrsscgtmfirr
kle_Thhalv10025105m|PACid:20195192 sssdltcfsqivtasnlsravvgvpidfarrngldkgrqkivlmnkkgmswksevktstagqvfi
kle_Thhalv10009500m|PACid:20186111 ptkphffqpllpgfhshlnmpvsffskhvegrhnqnktaklrsdasektwsvkmdglkft.....
kle_Thhalv10024778m|PACid:20195017 ip...............................................................
kle_Thhalv10028240m|PACid:20189403 nphffqpmlpgfnthlsipvafytkhlqgreegnevelrv.........................
kle_Thhalv10028240m|PACid:20189403 sdnysfvvpvtvcnlrddrlflpvklsksnilnescq............................
kle_Thhalv10022336m|PACid:20182221 fsptnphffqpllpgfhshlnipmaffskhlegttnldnavvkl.....................
kle_Thhalv10024481m|PACid:20195016 ip...............................................................
kle_Thhalv10028050m|PACid:20189955 hsrfvanvapstlsddalnipmsfaranglgtrcgeivlmnekgrswnlalkqkkcgkiyirg..
kle_Thhalv10011760m|PACid:20184627 ldrfmkiilhstikekmmkiparfvrlgpkltdtvtietpagfkrsirikrvgdevwfeng....
kle_Thhalv10015617m|PACid:20203507 rkklsffkifqsadlssecmraipynfmqrvsekdfsykmviraqwgsswk..............
kle_Thhalv10024526m|PACid:20195208 p................................................................
kle_Thhalv10026818m|PACid:20193545 sptnphffqpllpgfdtnftipvaffskhiegkndlktaklrs......................
kle_Thhalv10000010m|PACid:20208455 iqnrivmltltpedvrdcklhlpsqfmrtngitkpgkitmlgrsgmkwfayllsndgavalgng.
kle_Thhalv10000515m|PACid:20208843 scfvanvthaslrydslslpmsfaranglntrcgeivlmndkgrswtlalkqkkcgttyirr...
kle_Thhalv10026818m|PACid:20193545 ycfvaevtasniksdklrlpmeatssnalnrgchkmivv..........................
kle_Thhalv10000028m|PACid:20208357 ssldnscfvanvtasnlctdtlylpqhftssngitikcrkivlidggerswaldlmldetsdtfy
kle_Thhalv10000515m|PACid:20208843 sqnrfvtltlrpwvvknsilflpmpftrmngitektk............................
kle_Thhalv10000130m|PACid:20208871 ikphffqpllpgftnhldipvafflkhlegsnkgktaklrsdaseitwkvkidgrrls.......
kle_Thhalv10014229m|PACid:20204077 pypdfgftfnsqdlslsqrlvipsdyrmyypnplpqtavlrkpegnfwnvkwtisqegtisfed.
kle_Thhalv10000111m|PACid:20208496 sqnrfvtltlkpfnltkyvmllpipftrmhgineetkmslv........................
kle_Thhalv10000111m|PACid:20208496 nkhffkpllpgfhshltipvafflkyikgtneqkkttaklr........................
kle_Thhalv10014143m|PACid:20206480 gdnpgffkvlrkedlsteimraiphdfirsisnkefsfkmvlklpwgsswpikisrnerfyymek
kle_Thhalv10000097m|PACid:20208741 sddscfvamvtpsslrtdklylpqyvtnssgitrkcrkivltdgeers.................
kle_Thhalv10028050m|PACid:20189955 nkhffkpilpgfhshltipvaffskyiqgtneqkmttaklr........................
kle_Thhalv10000111m|PACid:20208496 sldpscfvahvthaslrydslnlpmsfaranglntrcgeivlmndkgrswtlalkqkkcgstyir
kle_Thhalv10000515m|PACid:20208843 rhffqpllpdfhshltipvaffskyikgknehkttaklrs.........................
kle_Thhalv10016263m|PACid:20180001 vp...............................................................
kle_Thhalv10000097m|PACid:20208741 prykrfvtftlppdydrirrlclprsflrenginktgeiyllgkdg...................
kle_Thhalv10000279m|PACid:20208355 nqnrfvtltltndslkssrlylplqflkengmdkpgmvtllgndgt...................
kle_Thhalv10024893m|PACid:20192994 dpcfitahvtpyslikdrldlsrnftvasfdednkpceidlanekgrkwtlllrrnistgvfyir
kle_Thhalv10015705m|PACid:20206714 vpefnltikkshlly..................................................
kle_Thhalv10022138m|PACid:20181474 kdlsffkifqsadlssecmraipynfmkglsnkdfsykmviraqwgsswevev............
kle_Thhalv10026818m|PACid:20193545 ssrqnrfvtiilthynmrhsklilpinfvking................................
kle_Thhalv10028330m|PACid:20189517 scyvanispatlrydslrlpvkisrengldtrcgeivlmnekgtswklnlkqkrscesgtmyirr
kle_Thhalv10015617m|PACid:20203507 ngvpkfkitirksylkfl...............................................
kle_Thhalv10000010m|PACid:20208455 nrfvtltlpqcslrdsrifiplpflrendldkprlitllgkdgtkq...................
kle_Thhalv10024698m|PACid:20195209 q................................................................
kle_Thhalv10014488m|PACid:20206065 clpkffkvylagisgddmevpvsfnrclpkclpnnvtiksiygkiwkmalrkcge..........
kle_Thhalv10029136m|PACid:20197544 lifektlfktdvnpgesrlsmpsneliqkdfltavefrvieedinndkkmgigailvdqrdvkwg
kle_Thhalv10022336m|PACid:20182221 sdhscflarvtasnlskdllflpmdfarsnglmnrhcetillnedgkpwtlflk...........
kle_Thhalv10029471m|PACid:20197403 lifektlfktdvnpgesrlsmpfnelirkdfltpvelriieedinsdkkmgigailvdqrnvkwg
kle_Thhalv10027563m|PACid:20194119 ffqastttsyltslniplkffskhiqgrnerntaevrsdac........................
kle_Thhalv10000028m|PACid:20208357 iqnrtltltltpedvracilhlpsqfmkanginklgeitilgenkvewsayll............
kle_Thhalv10027563m|PACid:20194119 dqscfvarflprkfvrpdglkkssnkis.....................................
kle_Thhalv10022043m|PACid:20183918 pw...............................................................
kle_Thhalv10022138m|PACid:20181474 ngvpeftitirksylkfl...............................................
kle_Thhalv10024893m|PACid:20192994 tflkikltpnrfksgqlyissvfvnesginnageitllnkdgrkwssylhm..............
kle_Thhalv10029137m|PACid:20197359 fvtltlipddvracklhlpsqfmkanginrlgkitllgenkmewpa...................
kle_Thhalv10000028m|PACid:20208357 spcrkrfvtftlppdydrirrltlp........................................
kle_Thhalv10000130m|PACid:20208871 tsqnrfvtltftpanrlnfplqftkengikkagritmldryg.......................
kle_Thhalv10009500m|PACid:20186111 sslhhscyylpqgftrlnginkpgkitllgedgvkkv............................
kle_Thhalv10028240m|PACid:20189403 tsfvvpvtasnlrld..................................................
kle_Thhalv10012266m|PACid:20184241 m................................................................
kle_Thhalv10029137m|PACid:20197359 spchkrlvtftlpsdyvkissltlpkpflrenginkpekkiyllgkdgtkw..............
kle_Thhalv10025105m|PACid:20195192 flprkfvrpdglnksskkisl............................................
kle_Thhalv10029259m|PACid:20197343 lifertlfktdvnpgesrlsmpfneliqkdfltpvefgiieedinsdkkmgigailidqqnvkwg
kle_Thhalv10023054m|PACid:20202135 raipydfmrsvsehelsgkmkiraqwgsswdigisknprfyfmeks...................
kle_Thhalv10000028m|PACid:20208357 qtlpaqfarenslnkpgmidllgkdgkkwmvnlvqdgdgrmnl......................
kle_Thhalv10028330m|PACid:20189517 nkhffkpilpgfhshlvlsvflydsciaffskyiqgtneqkmttaklrs................
kle_Thhalv10027046m|PACid:20194382 hnpsfflasladqnsipripdaffhahlehkkelvklkltsdafertwev...............
kle_Thhalv10000097m|PACid:20208741 hpqffhtlvpgfnthltipleffskyiegktsvekttaelk........................
kle_Thhalv10009500m|PACid:20186111 sssdhshfeakvsasslemdrlylprifarsngldkmsgekilllneegrswnln..........
kle_Thhalv10028050m|PACid:20189955 sqnlfltltlkpynltksnlylpvtftkfhgine...............................
kle_Thhalv10027046m|PACid:20194382 tpsnlrqdrvsltkrfsrtnalnkrwcvidlmnqrgkswalglrhnkvtg...............
kle_Thhalv10027563m|PACid:20194119 srfvtlsvtpasikhrrlylpksftrnngmenaegk.............................
kle_Thhalv10027046m|PACid:20194382 esasltvtlkpymlksrqlrlssdfsrkngikkegeitlvdkngvkwpsyvvc............
kle_Thhalv10000010m|PACid:20208455 ekhlatftlapvnvrncrlrlpmqftrenginkpgkiyll.........................
kle_Thhalv10001785m|PACid:20189016 rkktsffkiladedlsseamrfnpqkfwrgsvckniphkvilkvvwgrs................
kle_Thhalv10028136m|PACid:20189592 srfltvtlkpymltykqirvrrrfaiengmkeagkitlvdkhgdqgfyisk..............
kle_Thhalv10014143m|PACid:20206480 vpkftltikksylkflavrkkfadmhmpkettmfkihhskekrs.....................
kle_Thhalv10028002m|PACid:20189500 lcylpknisrsniltgrfdeii...........................................
kle_Thhalv10009348m|PACid:20188047 pvlliektldendvdpsqnrllipfkilkrhdf................................
kle_Thhalv10004496m|PACid:20199788 ykpknphfvrnitsgslrqmeipttflksngidmekdielcdeng....................
kle_Thhalv10027164m|PACid:20194005 hlpvsftranglikpekvilvdknraews....................................
kle_Thhalv10028286m|PACid:20189501 trwvikktltrsdvaksqtrllipmqsvnehirrylmndeirmiedddsggfivn..........
kle_Thhalv10000097m|PACid:20208741 nrfaeltltpedvracklvssssnlhlprqfmkangigklgkitmlgkegtkcsafllsrdgfva
kle_Thhalv10019518m|PACid:20192323 prv..............................................................
kle_Thhalv10012253m|PACid:20184169 pnm..............................................................
kle_Thhalv10027418m|PACid:20195830 stkkpifvidlseqssnpmipdsfiskhfngkfqstklkltsdasdrawevgldgqrf.......
kle_Thhalv10004752m|PACid:20199853 ntskpsfcksltlgeswksksmriipeefvtstpgafehrvvfsvrwgnswql............
kle_Thhalv10021356m|PACid:20183715 qskpsfskslslgqnwksksmrmipeefvrsikhrlvfsvhwgnswqlwlqgdkkglfmvkedwd
kle_Thhalv10025105m|PACid:20195192 sesrfvtlnvtpgtfkhcriylpksftrnngmenaqgk...........................
kle_Thhalv10029469m|PACid:20197619 lifektlfnedvdstenylsmpsrklihkdflkpfelrivkkdinnddykfgiegilfdernvk.
kle_Thhalv10000579m|PACid:20208620 qhlpsqfmrdngidklgkitllgkegmtcsayllskdgfvalgid....................
kle_Thhalv10009706m|PACid:20185609 prlifekkltktnirpdqsrllmpfkslirndflrpgigailvdqrnvkvg..............
kle_Thhalv10022244m|PACid:20182095 rwvik............................................................
kle_Thhalv10014488m|PACid:20206065 ddpnnpffpvtlnpnrrsqlriprkvi......................................
kle_Thhalv10028330m|PACid:20189517 sqnrlltltlkpynltks...............................................
kle_Thhalv10022780m|PACid:20202142 sssssaeftvfikgshlkilkisvsasrnllpkerttfkihhpdmkkswnvvy............
kle_Thhalv10009730m|PACid:20186320 prlifekkltktnirpdqsrllmpfkslirndflrpgigailvdqrnvkvg..............
kle_Thhalv10025812m|PACid:20193747 kqdevyfeq........................................................
kle_Thhalv10026054m|PACid:20194502 kqdevyfeqg.......................................................
kle_Thhalv10028136m|PACid:20189592 dasdrtwevklingqrfshgwedfsnah.....................................
kle_Thhalv10010633m|PACid:20207509 pwfktnlknrtyellipaklareyrlkfgesityi..............................
kle_Thhalv10000579m|PACid:20208620 sflnlplqfirdngldkpgmvtllgkdgtr...................................
kle_Thhalv10009984m|PACid:20186046 dpkkiiekeltktdmspghnrlsmp........................................
kle_Thhalv10024893m|PACid:20192994 eflrhytkvllrs....................................................
kle_Thhalv10021356m|PACid:20183715 vnpqnpffkktltktnhilyvsswviekyglefaphnse..........................
kle_Thhalv10000608m|PACid:20208283 t................................................................
kle_Thhalv10017517m|PACid:20181248 ikkqmsesdvkvgqnrlmlgkekv.........................................
kle_Thhalv10022780m|PACid:20202142 knesffkvlqgadiysenmnvsgkfesfwfivkmglrklnlsvqrvlkkeqflmifmrsvseh..
kle_Thhalv10012233m|PACid:20184972 dpkliitkplfqsdldkgknrlqmpinqlvntnfltdeetriihkkylsstrktrkttglsvvlv
kle_Thhalv10000028m|PACid:20208357 mipvdffsmyvegkrsvekttaelks.......................................
kle_Thhalv10009508m|PACid:20187652 rlilekkltatdirpdqsrllmpfnqlsrndflspvelatieeddddveddmkdqdgkkvvrkkg
kle_Thhalv10004752m|PACid:20199853 vnpkspyfvktltkkidvly.............................................
kle_Thhalv10024065m|PACid:20200950 irktglivvlvdplskrhvvdlrkwkisgnlvyvis.............................
kle_Thhalv10023005m|PACid:20202014 l................................................................
kle_Thhalv10000676m|PACid:20208372 twt..............................................................
kle_Thhalv10000999m|PACid:20202791 msmtnpyfttglknriyellipaevvkdmgfrfgesikyvdeegt....................
kle_Thhalv10023054m|PACid:20202135 ftpirvsvsrnlmpkqrttfkihhpdmkkswnv................................
kle_Thhalv10017938m|PACid:20179876 tltktdvdkgqshlsipmssllthdfltsdekeetqnrikgdregglseqvidprlkvlelklrr
kle_Thhalv10027418m|PACid:20195830 qnriftlalkpymlrtgqlrlpaslsrgngineageitvvnklgvewklhlv.............
kle_Thhalv10029268m|PACid:20197469 nkpwsipik........................................................
kle_Thhalv10029127m|PACid:20197407 nili.............................................................
kle_Thhalv10003384m|PACid:20208196 rkqlnvsdvkvgqirlllgkkhvkkmmlqvignskiiiglggievslyrprshvfkmlfkmwggg
kle_Thhalv10000528m|PACid:20208661 miis.............................................................
kle_Thhalv10016118m|PACid:20206561 ffntrlkkriydllipanvvnendhelrf....................................
kle_Thhalv10000689m|PACid:20208748 miilkklsksdlig...................................................
kle_Thhalv10026054m|PACid:20194502 niyfetgvkkriyellihaqlvkdyslk.....................................
kle_Thhalv10005614m|PACid:20199273 dpw..............................................................
kle_Thhalv10000541m|PACid:20208467 miiskklskrdldgn..................................................
kle_Thhalv10028696m|PACid:20196953 kyellvhaqlvkdyclrfqeyisyidpkgkleaktar............................
kle_Thhalv10017854m|PACid:20180436 esrrgihwvvddrr...................................................
kle_Thhalv10025812m|PACid:20193747 nvyfetgvkkrrfellvhaqlvkdyslkfekniyfidnhnag.......................
kle_Thhalv10019801m|PACid:20191643 ik...............................................................
kle_Thhalv10022269m|PACid:20183256 lliektldendvdpsqnr...............................................
kle_Thhalv10000711m|PACid:20208463 miiskklsksdldgnvklskkqvisvlrkmkgvtqetlqngievkvlntaeadpnt.........


                                                         10        20        30        40           
                                                          |         |         |         |           
d1na6a1                            ..............-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGIVE.KL.FP
kle_Thhalv10006747m|PACid:20185923 ..............---PAELGVPSRQPTNYFCKTLTASDTSTHG----GFSVPRRAAE.KV.FP
kle_Thhalv10006754m|PACid:20185924 ..............---PAELGVPSRQPTNYFCKTLTASDTSTHG----GFSVPRRAAE.KV.FP
kle_Thhalv10018139m|PACid:20192001 ..............------LGIPSKQPSNYFCKTLTASDTSTHG----GFSVPRRAAE.KV.FP
kle_Thhalv10006748m|PACid:20187001 ..............----------SKHPTEFFCKTLTASDTSTHG----GFSVPRRAAE.KL.FP
kle_Thhalv10023325m|PACid:20201174 ..............-------QEPEKCTVHSFCKTLTASDTSTHG----GFSVLRRHAD.DC.LP
kle_Thhalv10023326m|PACid:20201173 ..............-------QEPEKCTVHSFCKTLTASDTSTHG----GFSVLRRHAD.DC.LP
kle_Thhalv10006635m|PACid:20185449 ..............---------LNRQPTEFFCKTLTASDTSTHG----GFSVPRRAAE.KI.FP
kle_Thhalv10012513m|PACid:20203957 ..............----------NRQPNEFFCKTLTASDTSTHG----GFSVPRRAAE.KI.FP
kle_Thhalv10016394m|PACid:20181239 ..............---------KRSNTPHMFCKTLTASDTSTHG----GFSVPRRAAE.DC.FP
kle_Thhalv10012728m|PACid:20205149 ..............------------RTPHMFCKTLTASDTSTHG----GFSVPRRAAE.DC.FA
kle_Thhalv10003641m|PACid:20199612 ..............--------------VHSFCKTLTASDTSTHG----GFSVLRRHAD.EC.LP
kle_Thhalv10001365m|PACid:20188811 ..............-----PLVEPAKQSVDSFVKILTASDTSTHG----GFSVLRKHAT.EC.LP
kle_Thhalv10005857m|PACid:20190472 ..............------LVEPTKQMFHSFVKILTASDTSTHG----GFSVLRKHAT.EC.LP
kle_Thhalv10024662m|PACid:20195558 ..............----------QRPKVHSFSKVLTASDTSTHG----GFSVLRKHAT.EC.LP
kle_Thhalv10024554m|PACid:20195557 ..............----------QRPKVHSFSKVLTASDTSTHG----GFSVLRKHAT.EC.LP
kle_Thhalv10012074m|PACid:20185111 ..............--------------PHMFCKTLTASDTSTHR----GFSVPRRAAE.DC.FA
kle_Thhalv10010019m|PACid:20188671 ..............----------------LFEKAVTPSDVGKLN----RLVIPKHHAE.KH.FP
kle_Thhalv10029379m|PACid:20196948 ..............----------------SFIKVLTASDTSTHG----GLSVIKRHAV.EC.LP
kle_Thhalv10006123m|PACid:20190422 ..............---------------HMFDKVVTPSDVGKLN----RLVIPKQHAE.RY.FP
kle_Thhalv10019566m|PACid:20192106 ..............----------------LFEKAVTPSDVGKLN----RLVIPKQHAE.KH.FP
kle_Thhalv10007983m|PACid:20187835 ..............---------------VLFEKTVTPSDVGKLN----RLVIPKQHAE.KH.FP
kle_Thhalv10017156m|PACid:20181075 ..............----------------LFEKPLTPSDVGKLN----RLVIPKQHAE.RY.FP
kle_Thhalv10029161m|PACid:20197833 ..............---------------SSFIKVLTASDTSTHG----GLSVIKRHAV.EC.LP
kle_Thhalv10021305m|PACid:20183091 ..............----------------LFEKSLTPSDVGKLN----RLVIPKQHAE.KY.FP
kle_Thhalv10028783m|PACid:20197484 ..............---------------HMFDKVLTPSDVGKLN----RLVIPKQHAE.NY.FP
kle_Thhalv10015675m|PACid:20205196 ..............----------------LFEKSLTPSDVGKLN----RLVIPKQHAE.KY.FP
kle_Thhalv10001555m|PACid:20188796 ..............---------------HMFDKVVTPSDVGKLN----RLVIPKQHAE.RY.FP
kle_Thhalv10008068m|PACid:20187490 ..............---------------HMFDKVVTPSDVGKLN----RLVIPKQHAE.RY.FP
kle_Thhalv10004508m|PACid:20200254 ..............----------------LFEKAVTPSDVGKLN----RLVIPKHQAE.KH.FP
kle_Thhalv10024601m|PACid:20195479 ..............---------------PSFAKTLTQSDANNGG----GFSVPRYCAE.TI.FP
kle_Thhalv10016329m|PACid:20180956 ..............---------------ASFAKTLTQSDANNGG----GFSVPRYCAE.TI.FP
kle_Thhalv10018331m|PACid:20192490 ..............------------NKVVTFAKILTPSDANNGG----GFSVPRYCAD.SV.FP
kle_Thhalv10012152m|PACid:20184762 ..............----------------LFQKKLTPSDVGKLN----RLVIPKKCAV.KY.LP
kle_Thhalv10012161m|PACid:20185016 ..............----------------LFQKKLTPSDVGKLN----RLVIPKKYAV.KH.LP
kle_Thhalv10012356m|PACid:20184298 ..............----------------LFQKQLTPSDVGKLN----RLVIPKKYAV.KH.LP
kle_Thhalv10012377m|PACid:20184279 ..............----------------LFTKKLTPSDVGKLN----RLVIPKKYAV.KH.LP
kle_Thhalv10019015m|PACid:20192089 ..............---------------------------------------------.--.--
kle_Thhalv10027164m|PACid:20194005 ..............---------------------------------------------.--.--
kle_Thhalv10021527m|PACid:20183453 .............w---------------------------------------------.--.--
kle_Thhalv10000111m|PACid:20208496 ..............---------------------------------------------.--.--
kle_Thhalv10010633m|PACid:20207509 ..............---------------------------------------------.--.--
kle_Thhalv10000999m|PACid:20202791 ..............---------------------------------------------.--.--
kle_Thhalv10014972m|PACid:20203483 ..............-------------------------------------SIPTTFTE.HL.KD
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10012062m|PACid:20185054 ..............-------------------------------------YLPSGFAE.KY.LS
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10005481m|PACid:20199536 ..............----------------LFQKELKNSDVSSLR----RMILPKKAAE.AH.LP
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10003110m|PACid:20196814 ..............------------------QKVLKQSDVGNLG----RIVLPKKEAE.TH.LP
kle_Thhalv10025105m|PACid:20195192 ..............---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ...........gwm---------------------------------------------.--.--
kle_Thhalv10009082m|PACid:20186232 ..............---------------------------------------------.--.--
kle_Thhalv10021075m|PACid:20182250 ..............-------------------------------------YLPSGFAE.KY.LS
kle_Thhalv10000579m|PACid:20208620 ..............---------------------------------------------.--.--
kle_Thhalv10001785m|PACid:20189016 ..............-------------------------------------IIPNDFAK.MH.MP
kle_Thhalv10000130m|PACid:20208871 ..............---------------------------------------------.--.--
kle_Thhalv10000010m|PACid:20208455 ..............------------------------------------LYLPKDFTS.S-.--
kle_Thhalv10028696m|PACid:20196953 ..............---------------------------------------------.--.--
kle_Thhalv10021075m|PACid:20182250 ..............---------------------------------------------.--.--
kle_Thhalv10027418m|PACid:20195830 ..............---------------------------------------------.--.--
kle_Thhalv10004496m|PACid:20199788 .............k---------------------------------------------.--.--
kle_Thhalv10015705m|PACid:20206714 ..............---------------------------------------------.--.--
kle_Thhalv10027164m|PACid:20194005 ............vr---------------------------------------------.--.--
kle_Thhalv10000130m|PACid:20208871 ..............---------------------------------------------.--.--
kle_Thhalv10009849m|PACid:20185584 ..............------------------VKHLKNSDVGSLG----RIVLPKREAE.GN.LP
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10000279m|PACid:20208355 ..............---------------------------------------------.--.--
kle_Thhalv10027291m|PACid:20195068 ..............---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ..............---------------------------------------------.--.--
kle_Thhalv10029137m|PACid:20197359 ..............---------------------------------------------.--.--
kle_Thhalv10028050m|PACid:20189955 ..............---------------------------------------------.--.--
kle_Thhalv10025105m|PACid:20195192 ............cr---------------------------------------------.--.--
kle_Thhalv10009500m|PACid:20186111 ..............---------------------------------------------.--.--
kle_Thhalv10024778m|PACid:20195017 ..............----------------LFEKVLSASDAGRIG----RLVLPKACAE.AY.FP
kle_Thhalv10028240m|PACid:20189403 ..............---------------------------------------------.--.--
kle_Thhalv10028240m|PACid:20189403 ..............---------------------------------------------.--.--
kle_Thhalv10022336m|PACid:20182221 ..............---------------------------------------------.--.--
kle_Thhalv10024481m|PACid:20195016 ..............----------------LFEKVLSASDAGRIG----RLVLPKACAE.AY.FP
kle_Thhalv10028050m|PACid:20189955 ..............---------------------------------------------.--.--
kle_Thhalv10011760m|PACid:20184627 ..............---------------------------------------------.--.--
kle_Thhalv10015617m|PACid:20203507 ..............---------------------------------------------.--.--
kle_Thhalv10024526m|PACid:20195208 ..............----------------LFEKMLSASDTGRVG----RLVLPKKYAE.AF.LP
kle_Thhalv10026818m|PACid:20193545 ..............---------------------------------------------.--.--
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10000515m|PACid:20208843 ..............---------------------------------------------.--.--
kle_Thhalv10026818m|PACid:20193545 ..............---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ...........isr---------------------------------------------.--.--
kle_Thhalv10000515m|PACid:20208843 ..............---------------------------------------------.--.--
kle_Thhalv10000130m|PACid:20208871 ..............---------------------------------------------.--.--
kle_Thhalv10014229m|PACid:20204077 ..............---------------------------------------------.--.--
kle_Thhalv10000111m|PACid:20208496 ..............---------------------------------------------.--.--
kle_Thhalv10000111m|PACid:20208496 ..............---------------------------------------------.--.--
kle_Thhalv10014143m|PACid:20206480 ............sg-----------------WDKFLSDNDLG-----------------.--.--
kle_Thhalv10000097m|PACid:20208741 ..............---------------------------------------------.--.--
kle_Thhalv10028050m|PACid:20189955 ..............---------------------------------------------.--.--
kle_Thhalv10000111m|PACid:20208496 .............r---------------------------------------------.--.--
kle_Thhalv10000515m|PACid:20208843 ..............---------------------------------------------.--.--
kle_Thhalv10016263m|PACid:20180001 ..............----------------LFEKTLSASDAGRIG----RLVLPKACAE.AY.FP
kle_Thhalv10000097m|PACid:20208741 ..............---------------------------------------------.--.--
kle_Thhalv10000279m|PACid:20208355 ..............---------------------------------------------.--.--
kle_Thhalv10024893m|PACid:20192994 .............r---------------------------------------------.--.--
kle_Thhalv10015705m|PACid:20206714 ..............------------------------------------FAIPKNFVD.MH.MP
kle_Thhalv10022138m|PACid:20181474 ..............----------S----------------------------------.--.--
kle_Thhalv10026818m|PACid:20193545 ..............---------------------------------------------.--.--
kle_Thhalv10028330m|PACid:20189517 ..............---------------------------------------------.--.--
kle_Thhalv10015617m|PACid:20203507 ..............-------------------------------------AIPKRFVE.GH.IP
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10024698m|PACid:20195209 ..............--------------------MLSASDTGRVG----RLVLPKKYAE.AF.LP
kle_Thhalv10014488m|PACid:20206065 ..............---------------------------------------------.--.--
kle_Thhalv10029136m|PACid:20197544 ......vmlkrwem---------------------------------------------.--.--
kle_Thhalv10022336m|PACid:20182221 ..............---------------------------------------------.--.--
kle_Thhalv10029471m|PACid:20197403 vmlkrwemkkdsgr---------------------------------------------.--.--
kle_Thhalv10027563m|PACid:20194119 ..............---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ..............---------------------------------------------.--.--
kle_Thhalv10027563m|PACid:20194119 ..............---------------------------------------------.--.--
kle_Thhalv10022043m|PACid:20183918 ..............----------------VIKKTLYDSDVSQQG----RLNLPRQDFE.DFiIP
kle_Thhalv10022138m|PACid:20181474 ..............-------------------------------------SIPKRFGE.EH.IP
kle_Thhalv10024893m|PACid:20192994 ..............---------T-----------------------------------.--.--
kle_Thhalv10029137m|PACid:20197359 ..............---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ..............---------------------------------------------.--.--
kle_Thhalv10000130m|PACid:20208871 ..............---------------------------------------------.--.--
kle_Thhalv10009500m|PACid:20186111 ..............---------------------------------------------.--.--
kle_Thhalv10028240m|PACid:20189403 ..............-----------------------------------GFHLPKSFTT.SSgLS
kle_Thhalv10012266m|PACid:20184241 ..............--------------------------------------IPNTYAV.KH.LP
kle_Thhalv10029137m|PACid:20197359 ..............---------------------------------------------.--.--
kle_Thhalv10025105m|PACid:20195192 ..............---------------------------------------------.--.--
kle_Thhalv10029259m|PACid:20197343 vmlkrwemkkdsgr---------------------------------------------.--.--
kle_Thhalv10023054m|PACid:20202135 ..............---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ..............---------------------------------------------.--.--
kle_Thhalv10028330m|PACid:20189517 ..............---------------------------------------------.--.--
kle_Thhalv10027046m|PACid:20194382 ..............---------------------------------------------.--.--
kle_Thhalv10000097m|PACid:20208741 ..............---------------------------------------------.--.--
kle_Thhalv10009500m|PACid:20186111 ..............---------------------------------------------.--.--
kle_Thhalv10028050m|PACid:20189955 ..............---------------------------------------------.--.--
kle_Thhalv10027046m|PACid:20194382 ..............---------------------------------------------.--.--
kle_Thhalv10027563m|PACid:20194119 ..............---------------------------------------------.--.--
kle_Thhalv10027046m|PACid:20194382 ..............---------------------------------------------.--.--
kle_Thhalv10000010m|PACid:20208455 ..............---------------------------------------------.--.--
kle_Thhalv10001785m|PACid:20189016 ..............---------------------------------------------.--.--
kle_Thhalv10028136m|PACid:20189592 ..............-----------------------------------------G---.--.--
kle_Thhalv10014143m|PACid:20206480 ..............---------------------------------------------.--.--
kle_Thhalv10028002m|PACid:20189500 ..............---------------------------------------------.--.--
kle_Thhalv10009348m|PACid:20188047 ..............---------------------------L-----------------.--.--
kle_Thhalv10004496m|PACid:20199788 ..............---------------------------------------------.--.--
kle_Thhalv10027164m|PACid:20194005 ..............---------------------------------------------.--.--
kle_Thhalv10028286m|PACid:20189501 ..............---------------------------------------------.--.--
kle_Thhalv10000097m|PACid:20208741 ..........lgid---------------------------------------------.--.--
kle_Thhalv10019518m|PACid:20192323 ..............-----------------IKKTLSDTDVSQQG----KLNLPRQDFE.NFiIP
kle_Thhalv10012253m|PACid:20184169 ..............----------------LIVKKITNTDVSCKN----GLSLSKPKMD.YI.LR
kle_Thhalv10027418m|PACid:20195830 ..............---------------------------------------------.--.--
kle_Thhalv10004752m|PACid:20199853 ..............---------------------------------------------.--.--
kle_Thhalv10021356m|PACid:20183715 ............ef---------------------------------------------.--.--
kle_Thhalv10025105m|PACid:20195192 ..............---------------------------------------------.--.--
kle_Thhalv10029469m|PACid:20197619 ..............---------------------------------------------.--.--
kle_Thhalv10000579m|PACid:20208620 ..............---------------------------------------------.--.--
kle_Thhalv10009706m|PACid:20185609 ..............---------------------------------------------.--.--
kle_Thhalv10022244m|PACid:20182095 ..............-------------------KTLTRSDVAKS---------------.--.--
kle_Thhalv10014488m|PACid:20206065 ..............---------------------------------------------.--.--
kle_Thhalv10028330m|PACid:20189517 ..............---------------------------------------------.--.--
kle_Thhalv10022780m|PACid:20202142 ..............---------------------------------------------.--.--
kle_Thhalv10009730m|PACid:20186320 ..............---------------------------------------------.--.--
kle_Thhalv10025812m|PACid:20193747 ..............---------------------------------------------.--.--
kle_Thhalv10026054m|PACid:20194502 ..............---------------------------------------------.--.--
kle_Thhalv10028136m|PACid:20189592 ..............---------------------------------------------.--.--
kle_Thhalv10010633m|PACid:20207509 ..............---------------------------------------------.--.--
kle_Thhalv10000579m|PACid:20208620 ..............---------------------------------------------.--.--
kle_Thhalv10009984m|PACid:20186046 ..............---------------------------------------------.--.FS
kle_Thhalv10024893m|PACid:20192994 ..............---------------------------------------------.--.--
kle_Thhalv10021356m|PACid:20183715 ..............----------------M----------------------------.--.--
kle_Thhalv10000608m|PACid:20208283 ..............-----------------------NSDINKHC----RMLIPKNQML.SV.LR
kle_Thhalv10017517m|PACid:20181248 ..............-------------------------------------------KK.WL.FP
kle_Thhalv10022780m|PACid:20202142 ..............---------------------------------------------.--.--
kle_Thhalv10012233m|PACid:20184972 dplskrhvvdfrkw---------------------------------------------.--.--
kle_Thhalv10000028m|PACid:20208357 ..............---------------------------------------------.--.--
kle_Thhalv10009508m|PACid:20187652 igailvdqrnvevg---------------------------------------------.--.--
kle_Thhalv10004752m|PACid:20199853 ..............---------------------------------------------.--.--
kle_Thhalv10024065m|PACid:20200950 ..............---------------------------------------------.--.--
kle_Thhalv10023005m|PACid:20202014 ..............----------------MIEKTLTDTDICWKG----RLRLPKLIIN.NI.VK
kle_Thhalv10000676m|PACid:20208372 ..............-----------------ITKTLTQSDINGSS----RLLIPD----.--.--
kle_Thhalv10000999m|PACid:20202791 ..............---------------------------------------------.--.--
kle_Thhalv10023054m|PACid:20202135 ..............------------------------------------VYVPRHEAG.GL.FS
kle_Thhalv10017938m|PACid:20179876 tdmkkkkktkkgrt---------------------------------------------.--.--
kle_Thhalv10027418m|PACid:20195830 ..............---------------------------------------------.--.--
kle_Thhalv10029268m|PACid:20197469 ..............---------------------LTASDTNSDG--GGTITFPKTLLE.TQ.LF
kle_Thhalv10029127m|PACid:20197407 ..............--------------------TLKESDTGSSN----TITMSKELVEaNL.FP
kle_Thhalv10003384m|PACid:20208196 ............tp---------------------------------------------.--.--
kle_Thhalv10000528m|PACid:20208661 ..............-------------------KKLSKSDLD--G----NVKLPKKQVM.SV.LR
kle_Thhalv10016118m|PACid:20206561 ..............---------------------------------------------.--.--
kle_Thhalv10000689m|PACid:20208748 ..............-----------------------------------NVKLPKKQVM.SV.FK
kle_Thhalv10026054m|PACid:20194502 ..............---------------------------------------------.--.--
kle_Thhalv10005614m|PACid:20199273 ..............----------------VIKKMLSDIDVSQQG----KLNLPRQDFE.NFiIP
kle_Thhalv10000541m|PACid:20208467 ..............------------------------------------VKLPKIQVM.SV.FK
kle_Thhalv10028696m|PACid:20196953 ..............---------------------------------------------.--.--
kle_Thhalv10017854m|PACid:20180436 ..............---------------------------------------------.--.--
kle_Thhalv10025812m|PACid:20193747 ..............---------------------------------------------.--.--
kle_Thhalv10019801m|PACid:20191643 ..............-------------------KTLCDTDVSQQG----RLNLPRQDFE.DLiIP
kle_Thhalv10022269m|PACid:20183256 ..............--------------L------------------------------.--.--
kle_Thhalv10000711m|PACid:20208463 ..............---------------------------------------------.--.--


                                              50                         60        70           80  
                                               |                          |         |            |  
d1na6a1                            ............SINH.......TRELNP..........SVFLTAHVSSH.D.C.PDSEARAIYY
kle_Thhalv10006747m|PACid:20185923 ............PL-D.......YSQQPP..........AQELMAR--DL.H.D.NEWKFRHIFR
kle_Thhalv10006754m|PACid:20185924 ............PL-D.......YSQQPP..........AQELMAR--DL.H.D.NEWKFRHIFR
kle_Thhalv10018139m|PACid:20192001 ............PL-D.......YTQQPP..........AQELIAR--DL.H.D.NEWKFRHIFR
kle_Thhalv10006748m|PACid:20187001 ............PL-D.......YTAQPP..........TQELVVR--DL.H.E.NTWTFRHIYR
kle_Thhalv10023325m|PACid:20201174 ............PL-D.......MSQQPP..........WQELVAT--DL.H.N.NEWHFRHIFR
kle_Thhalv10023326m|PACid:20201173 ............PL-D.......MSQQPP..........WQELVAT--DL.H.N.NEWHFRHIFR
kle_Thhalv10006635m|PACid:20185449 ............PL-D.......FSMQPP..........AQEIVAK--DL.H.D.TTWTFRHIYR
kle_Thhalv10012513m|PACid:20203957 ............AL-D.......FSMQPP..........CQELVAK--DI.H.D.NTWTFRHIYR
kle_Thhalv10016394m|PACid:20181239 ............PL-D.......YSQPRP..........SQELLAR--DL.H.G.LEWRFRHIYR
kle_Thhalv10012728m|PACid:20205149 ............PL-D.......YKQQRP..........SQELIAK--DL.H.G.VEWKFRHIYR
kle_Thhalv10003641m|PACid:20199612 ............PL-D.......MSRQPP..........TQELVAK--DL.H.A.NEWRFRHIFR
kle_Thhalv10001365m|PACid:20188811 ............SL-D.......MRQPTP..........TQELVAR--DL.H.G.YEWRFKHIFR
kle_Thhalv10005857m|PACid:20190472 ............AL-D.......MTQATP..........TQDLVTR--DL.H.G.VEWRFKHIFR
kle_Thhalv10024662m|PACid:20195558 ............PL-D.......MTQQTP..........TQELVAE--DV.H.G.YQWKFKHIFR
kle_Thhalv10024554m|PACid:20195557 ............PL-D.......MTQQTP..........TQELVAE--DV.H.G.YQWKFKHIFR
kle_Thhalv10012074m|PACid:20185111 ............PLLY.......LD----..........--HLIAK--DL.H.G.VEWKFRHIYR
kle_Thhalv10010019m|PACid:20188671 ............LP-S.......SNVSVK..........GVLLNFE--DV.T.G.KVWRFRYSYW
kle_Thhalv10029379m|PACid:20196948 ............PL-D.......MSQPTP..........SQEIVAK--DL.H.G.CEWKFKHIFR
kle_Thhalv10006123m|PACid:20190422 ............LDNSs......TNDNNK..........GLLLNFE--DR.T.G.NSWRFRYSYW
kle_Thhalv10019566m|PACid:20192106 ............LPSP.......-LGPLPlv........TKGVLINFEDV.N.G.KVWRFRYSYW
kle_Thhalv10007983m|PACid:20187835 ............LPAMttata..TTNPSP..........TKGVLINLEDR.A.G.KVWRFRYSYW
kle_Thhalv10017156m|PACid:20181075 ............LA-A.......AAADAV..........EKGLLLCFEDE.E.G.KPWRFRYSYW
kle_Thhalv10029161m|PACid:20197833 ............PL-D.......MSQPTP..........SQEIVAK--DL.H.G.CEWRFKHVFR
kle_Thhalv10021305m|PACid:20183091 ............LNNGgggddvaAETTEK..........GMLLSFE--DE.S.G.KCWKFRYSYW
kle_Thhalv10028783m|PACid:20197484 ............LANN.......QNGT--..........--VLDFE--DR.N.G.KTWRFRYSYW
kle_Thhalv10015675m|PACid:20205196 lnavivsssggaDTSS.......STSTEK..........GMLLSFE--DE.S.G.KCWRFRYSYW
kle_Thhalv10001555m|PACid:20188796 ............L--D.......SSSNEK..........GLLLNFE--DL.T.G.KSWRFRYSYW
kle_Thhalv10008068m|PACid:20187490 ............L--D.......SSNNQN..........GTLLNFQ--DR.N.G.KMWRFRYSYW
kle_Thhalv10004508m|PACid:20200254 ............LPLA.......GDVSVK..........GTLLNFE--DV.N.G.KVWRFRYSYW
kle_Thhalv10024601m|PACid:20195479 ............RL-D.......YNAEPP..........VQTILAK--DV.H.G.DVWKFRHIYR
kle_Thhalv10016329m|PACid:20180956 ............RL-D.......YTAEPP..........VQTVIAK--DI.H.G.ETWKFRHIYR
kle_Thhalv10018331m|PACid:20192490 ............SL-D.......FQADPP..........VQKLFIT--DI.H.G.VLWDFRHIYR
kle_Thhalv10012152m|PACid:20184762 ............FLSV.......VQNEREegeiae....DVEVVFY--DR.G.M.RPWKFRYCYW
kle_Thhalv10012161m|PACid:20185016 ............YI-S.......IDQKDReegei.....SEEVEVVFYDT.G.K.RQWKFRYCYW
kle_Thhalv10012356m|PACid:20184298 ............FISD.......DQNEREegevggsvd.DVEVVFY--DK.A.M.RQWKFRYCYW
kle_Thhalv10012377m|PACid:20184279 ............PL-S.......VDQNEReegevggsvdDVEVVFY--DK.A.K.TQWKFKYCYM
kle_Thhalv10019015m|PACid:20192089 ............----.......------..........---ITLV--DE.N.D.EEFLAKYLAE
kle_Thhalv10027164m|PACid:20194005 ............----.......------..........----TLR-SDA.S.E.KTWKVK--ME
kle_Thhalv10021527m|PACid:20183453 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000111m|PACid:20208496 ............----.......------..........-----------.-.-.----------
kle_Thhalv10010633m|PACid:20207509 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000999m|PACid:20202791 ............----.......------..........---------GG.G.I.WTVSFKKI--
kle_Thhalv10014972m|PACid:20203483 ............PLPK.......------..........----TAKLQGT.G.G.GTWTVNF---
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.----------
kle_Thhalv10012062m|PACid:20185054 ............GIS-.......------..........-GFIKL---QL.G.E.KQWPVRCLYK
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.----------
kle_Thhalv10005481m|PACid:20199536 ............ALES.......KE----..........--GIPIRMEDL.D.GlHVWTFKYRFW
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.----------
kle_Thhalv10003110m|PACid:20196814 ............EL--.......--EARD..........GISLAME--DI.GtS.RVWNMRYRFW
kle_Thhalv10025105m|PACid:20195192 ............----.......------..........-VTL---TSDS.S.K.RTWKVK----
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........-----------.-.-.----------
kle_Thhalv10009082m|PACid:20186232 ............----.......------..........------ELLDY.C.G.RSWTIRMKRI
kle_Thhalv10021075m|PACid:20182250 ............GI--.......------..........SGFIKVQ---L.A.E.KQWPVRCLYK
kle_Thhalv10000579m|PACid:20208620 ............----.......------..........--KIVLT--DG.G.E.RSWTLDLRFN
kle_Thhalv10001785m|PACid:20189016 ............K---.......-----K..........TAKLIIH--DP.K.G.KSW--KVVYF
kle_Thhalv10000130m|PACid:20208871 ............----.......------..........-----------.-.-.----LRHEDY
kle_Thhalv10000010m|PACid:20208455 ............----.......NVLKRE..........CRKIVLT--DG.G.E.RSWALDLRFN
kle_Thhalv10028696m|PACid:20196953 ............----.......------..........-----------.-.-.----------
kle_Thhalv10021075m|PACid:20182250 ............----.......------..........-----------.-.-.-----R----
kle_Thhalv10027418m|PACid:20195830 ............----.......------..........-----------.-.-.----------
kle_Thhalv10004496m|PACid:20199788 ............----.......------..........-----------.-.-.----------
kle_Thhalv10015705m|PACid:20206714 ............----.......------..........-----------.-.-.----------
kle_Thhalv10027164m|PACid:20194005 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000130m|PACid:20208871 ............----.......------..........-----------.-.-.-RIDLRHVAY
kle_Thhalv10009849m|PACid:20185584 ............ELSD.......KE----..........GIMVEMR--DVdS.V.QSWSFKYKFW
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000279m|PACid:20208355 ............----.......------..........-----------.-.-.----------
kle_Thhalv10027291m|PACid:20195068 ............----.......------..........-----------.N.Q.RKWHMKFSSY
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........-----------.-.-.----------
kle_Thhalv10029137m|PACid:20197359 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028050m|PACid:20189955 ............----.......------..........-----------.-.-.----------
kle_Thhalv10025105m|PACid:20195192 ............----.......------..........-----------.-.-.----------
kle_Thhalv10009500m|PACid:20186111 ............----.......------..........-----------.-.-.----------
kle_Thhalv10024778m|PACid:20195017 ............PISQ.......PEG---..........---LPLKIQDI.K.G.KEWVFQFRFW
kle_Thhalv10028240m|PACid:20189403 ............----.......------..........---------DV.T.E.ITWKVKI---
kle_Thhalv10028240m|PACid:20189403 ............----.......------..........--EISLM--NK.Q.G.RTWTLSLKYR
kle_Thhalv10022336m|PACid:20182221 ............----.......------..........-------RSDA.S.D.ITWEVKM---
kle_Thhalv10024481m|PACid:20195016 ............PISQ.......PEG---..........---LPLKIQDI.K.G.KEWVFQFRFW
kle_Thhalv10028050m|PACid:20189955 ............----.......------..........-----------.-.-.----------
kle_Thhalv10011760m|PACid:20184627 ............----.......------..........-----------.-.-.----------
kle_Thhalv10015617m|PACid:20203507 ............----.......------..........-----------.-.-.VEISKNPRFY
kle_Thhalv10024526m|PACid:20195208 ............RLSN.......TEGVP-..........---LKVQ--DS.M.G.KVWTFQFRFW
kle_Thhalv10026818m|PACid:20193545 ............----.......------..........---------DA.S.E.ITWEVK--L-
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000515m|PACid:20208843 ............----.......------..........-----------.-.-.----------
kle_Thhalv10026818m|PACid:20193545 ............----.......------..........---------NE.E.G.KSWTLSLRFR
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000515m|PACid:20208843 ............----.......------..........-----MTLLDK.N.D.VKWPTGLRSG
kle_Thhalv10000130m|PACid:20208871 ............----.......------..........-----------.-.-.----------
kle_Thhalv10014229m|PACid:20204077 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000111m|PACid:20208496 ............----.......------..........---------DK.H.G.VRWST-----
kle_Thhalv10000111m|PACid:20208496 ............----.......------..........--------SDA.S.D.ITWEVKI---
kle_Thhalv10014143m|PACid:20206480 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000097m|PACid:20208741 ............----.......------..........-----------.-.-.--W-------
kle_Thhalv10028050m|PACid:20189955 ............----.......------..........--------SDV.S.K.TAWKVKIEED
kle_Thhalv10000111m|PACid:20208496 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000515m|PACid:20208843 ............----.......------..........---------DA.S.E.ITWRVK----
kle_Thhalv10016263m|PACid:20180001 ............PI-S.......QS----..........-EGIPLKIQDV.R.G.KEWTFQFRFW
kle_Thhalv10000097m|PACid:20208741 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000279m|PACid:20208355 ............----.......------..........-----------.-.-.----------
kle_Thhalv10024893m|PACid:20192994 ............----.......------..........-----------.-.-.----------
kle_Thhalv10015705m|PACid:20206714 ............KK--.......------..........TKLFKIH--P-.-.-.----------
kle_Thhalv10022138m|PACid:20181474 ............----.......------..........-----------.-.-.----------
kle_Thhalv10026818m|PACid:20193545 ............----.......---INK..........HEEIILK--DK.H.G.VKR-------
kle_Thhalv10028330m|PACid:20189517 ............----.......------..........-----------.-.-.----------
kle_Thhalv10015617m|PACid:20203507 ............NK--.......------..........STIFTIHHW-K.G.N.CSWEVLCL--
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.-VADLR----
kle_Thhalv10024698m|PACid:20195209 ............RLSN.......TEGVP-..........---LKVQ--DS.M.G.KVWTFQFRFW
kle_Thhalv10014488m|PACid:20206065 ............----.......------..........-----------.-.-.----------
kle_Thhalv10029136m|PACid:20197544 ............----.......------..........-----------.-.-.----------
kle_Thhalv10022336m|PACid:20182221 ............----.......------..........-----------.-.-.--------Y-
kle_Thhalv10029471m|PACid:20197403 ............----.......------..........-----------.-.-.----------
kle_Thhalv10027563m|PACid:20194119 ............----.......------..........-----------.-.K.NTWKVK----
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........-----------.-.-.----------
kle_Thhalv10027563m|PACid:20194119 ............----.......------..........-------LINE.G.A.RTWTLILKFR
kle_Thhalv10022043m|PACid:20183918 ............EMAGdl.....VQNLGN..........GVKVKALVVDE.E.E.HIVTFKRKS-
kle_Thhalv10022138m|PACid:20181474 ............NE--.......------..........-----------.-.-.----------
kle_Thhalv10024893m|PACid:20192994 ............----.......------..........-----------.-.-.----------
kle_Thhalv10029137m|PACid:20197359 ............----.......------..........-Y---------.-.-.----------
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000130m|PACid:20208871 ............----.......------..........-----------.-.-.----------
kle_Thhalv10009500m|PACid:20186111 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028240m|PACid:20189403 ............TL--.......------..........CQEIILM--DE.K.G.RSSTLEMTYH
kle_Thhalv10012266m|PACid:20184241 ............YI-S.......IDQNDReegeiaed..VEEVVVY--DK.A.M.TQWKFKYCYL
kle_Thhalv10029137m|PACid:20197359 ............----.......------..........-----------.-.-.---P------
kle_Thhalv10025105m|PACid:20195192 ............----.......------..........--------INE.D.A.RIWTLILKFR
kle_Thhalv10029259m|PACid:20197343 ............----.......------..........-----------.-.-.----------
kle_Thhalv10023054m|PACid:20202135 ............----.......------..........-----------.-.G.----------
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028330m|PACid:20189517 ............----.......------..........---------DV.S.K.IAWKVKIEED
kle_Thhalv10027046m|PACid:20194382 ............----.......------..........-----------.-.-.-----K----
kle_Thhalv10000097m|PACid:20208741 ............----.......------..........--------SDS.S.D.ITWKVK--MT
kle_Thhalv10009500m|PACid:20186111 ............----.......------..........-----------.-.-.------L---
kle_Thhalv10028050m|PACid:20189955 ............----.......------..........--ETKMHLLDK.H.G.VKW-----YT
kle_Thhalv10027046m|PACid:20194382 ............----.......------..........-----------.-.-.----------
kle_Thhalv10027563m|PACid:20194119 ............----.......------..........-----VLLLDK.H.G.VEWPVNLVLS
kle_Thhalv10027046m|PACid:20194382 ............----.......------..........-----------.-.-.---------V
kle_Thhalv10000010m|PACid:20208455 ............----.......------..........-----------.-.-.----------
kle_Thhalv10001785m|PACid:20189016 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028136m|PACid:20189592 ............----.......------..........-----------.-.-.----------
kle_Thhalv10014143m|PACid:20206480 ............----.......------..........-----------.-.-.--W-------
kle_Thhalv10028002m|PACid:20189500 ............----.......------..........-------LMDK.H.G.RKWTSGLYC-
kle_Thhalv10009348m|PACid:20188047 ............----.......------..........-----------.-.-.----------
kle_Thhalv10004496m|PACid:20199788 ............----.......------..........-----------.-.-.K---------
kle_Thhalv10027164m|PACid:20194005 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028286m|PACid:20189501 ............----.......------..........-----VYDTDT.H.S.THWLCL----
kle_Thhalv10000097m|PACid:20208741 ............----.......------..........-----------.-.-.----------
kle_Thhalv10019518m|PACid:20192323 ............----.......------..........-----------.-.-.----------
kle_Thhalv10012253m|PACid:20184169 ............KM--.......-GISVP..........ENGLQVEIQDN.D.K.SYWVTL----
kle_Thhalv10027418m|PACid:20195830 ............----.......------..........-----------.-.-.----------
kle_Thhalv10004752m|PACid:20199853 ............----.......------..........-----------.-.-.----------
kle_Thhalv10021356m|PACid:20183715 ............--VD.......DNLLGP..........DD---------.-.-.----------
kle_Thhalv10025105m|PACid:20195192 ............----.......------..........----NVTLLDN.H.R.VEWPVNLVML
kle_Thhalv10029469m|PACid:20197619 ............----.......------..........-----------.-.-.--W-------
kle_Thhalv10000579m|PACid:20208620 ............----.......------..........-----------.-.-.----------
kle_Thhalv10009706m|PACid:20185609 ............----.......------..........-----------.-.-.----------
kle_Thhalv10022244m|PACid:20182095 ............----.......------..........-----------.-.-.----------
kle_Thhalv10014488m|PACid:20206065 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028330m|PACid:20189517 ............----.......------..........NLETKMHLLDK.N.G.VKW-----YT
kle_Thhalv10022780m|PACid:20202142 ............----.......------..........-----------.-.-.---------I
kle_Thhalv10009730m|PACid:20186320 ............----.......------..........-----------.-.-.----------
kle_Thhalv10025812m|PACid:20193747 ............----.......------..........-----------.-.-.----------
kle_Thhalv10026054m|PACid:20194502 ............----.......------..........-----------.-.-.----------
kle_Thhalv10028136m|PACid:20189592 ............----.......------..........-----------.-.-.----------
kle_Thhalv10010633m|PACid:20207509 ............----.......------..........---------DE.E.G.TMVGIRVRWS
kle_Thhalv10000579m|PACid:20208620 ............----.......------..........-----------.-.-.--W-------
kle_Thhalv10009984m|PACid:20186046 ............KIVD.......LEFLNP..........EE---------.-.-.----------
kle_Thhalv10024893m|PACid:20192994 ............----.......------..........---------DA.S.D.RIWEVK--LN
kle_Thhalv10021356m|PACid:20183715 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000608m|PACid:20208283 ............KMIN.......VTKESL..........RNGIEVEVLDI.V.K.NITYFFALRY
kle_Thhalv10017517m|PACid:20181248 ............RLKK.......TEIPSG..........TRWLDVSVYGP.D.G.NAREMKF---
kle_Thhalv10022780m|PACid:20202142 ............----.......------..........-----------.-.-.----------
kle_Thhalv10012233m|PACid:20184972 ............----.......------..........-----------.-.-.---K------
kle_Thhalv10000028m|PACid:20208357 ............----.......------..........---------DS.S.D.ITWRAK--MT
kle_Thhalv10009508m|PACid:20187652 ............----.......------..........---L-------.-.-.----------
kle_Thhalv10004752m|PACid:20199853 ............----.......------..........-----------.-.-.---------V
kle_Thhalv10024065m|PACid:20200950 ............----.......------..........-----------.-.-.----------
kle_Thhalv10023005m|PACid:20202014 ............K---.......MGVVIP..........QNGIQVEIQDC.D.K.SNWV-N--F-
kle_Thhalv10000676m|PACid:20208372 ............-NQK.......TIQDGD..........EVEVRAY--DH.D.T.KTEH--TIFL
kle_Thhalv10000999m|PACid:20202791 ............----.......------..........-----------.-.-.----------
kle_Thhalv10023054m|PACid:20202135 ............S---.......------..........-----------.-.-.----------
kle_Thhalv10017938m|PACid:20179876 ............----.......------..........-----------.-.-.----------
kle_Thhalv10027418m|PACid:20195830 ............----.......------..........-----------.-.-.----------
kle_Thhalv10029268m|PACid:20197469 ............PLRGaartkr.VSHDNK..........EEIVDVH--DY.Y.-.----------
kle_Thhalv10029127m|PACid:20197407 ............WWSK.......HLCAKL..........SQHKSVELVDL.F.E.YESKITTTLI
kle_Thhalv10003384m|PACid:20208196 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000528m|PACid:20208661 ............KMKG.......VTQETL..........QNGIEVKVLNT.A.E.ADP--NTNYR
kle_Thhalv10016118m|PACid:20206561 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000689m|PACid:20208748 ............KMEG.......VTDETL..........LNGIEVKVLDL.A.E.ANPDTN--YK
kle_Thhalv10026054m|PACid:20194502 ............----.......------..........-----FE----.-.-.-----KNIYY
kle_Thhalv10005614m|PACid:20199273 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000541m|PACid:20208467 ............KMKG.......VTHETL..........QNGIEVKVLDT.A.E.ADPNTN----
kle_Thhalv10028696m|PACid:20196953 ............----.......------..........-----------.-.-.--------WR
kle_Thhalv10017854m|PACid:20180436 ............----.......------..........-----------.-.-.WNMNTSFIY-
kle_Thhalv10025812m|PACid:20193747 ............----.......------..........-----------.-.-.----------
kle_Thhalv10019801m|PACid:20191643 ............DIAK.......------..........-----------.-.-.----------
kle_Thhalv10022269m|PACid:20183256 ............----.......------..........-----------.-.-.----------
kle_Thhalv10000711m|PACid:20208463 ............----.......------..........-----------.-.-.-------NYR


                                         90          100       110       120       130       140    
                                          |            |         |         |         |         |    
d1na6a1                            NSAHFGKTR..NEKRIT.RWGRGSPLQDPENTGALTLLAFKLDEQGGDCKEVNIWVCASTDEEDV
kle_Thhalv10006747m|PACid:20185923 GQ-----PK..RHLLTT.GW-SVFVSAKRLVAGDSVLFIWNDKNQL-LLGIRRANRPQT------
kle_Thhalv10006754m|PACid:20185924 GQ-----PK..RHLLTT.GW-SVFVSAKRLVAGDSVLFIWNDKNQL-LLGIRRANRPQT------
kle_Thhalv10018139m|PACid:20192001 GQ-----PK..RHLLTT.GW-SVFVSAKRLVTGDSVIFIRNERNQL-LLGIRHASRPQT------
kle_Thhalv10006748m|PACid:20187001 GQ-----PK..RHLLTT.GW-SLFVGSKRLRAGDSVLFIRDEKSQL-MVGVRRANRQQT------
kle_Thhalv10023325m|PACid:20201174 GQ-----PR..RHLLTT.GW-SVFVSSKKLVAGDAFIFLRGENEEL-RVGVRRHMRQQT------
kle_Thhalv10023326m|PACid:20201173 GQ-----PR..RHLLTT.GW-SVFVSSKKLVAGDAFIFLRGENEEL-RVGVRRHMRQQT------
kle_Thhalv10006635m|PACid:20185449 GQ-----PK..RHLLTT.GW-SVFVSTKRLFAGDSVLFVRDEKSQL-MLGIRRANRQTP------
kle_Thhalv10012513m|PACid:20203957 GQ-----PK..RHLLTT.GW-SVFVSTKRLFAGDSVLFIRDGKAQL-LLGIRRANRQQP------
kle_Thhalv10016394m|PACid:20181239 GQ-----PR..RHLLTT.GW-SAFVNKKKLVSGDAVLFLRGDDGKL-RLGVRRASQIEG------
kle_Thhalv10012728m|PACid:20205149 GQ-----PR..RHLLTT.GW-SIFVSQKNLVSGDAVLFLRDEDGEL-RLGIRRSAR---------
kle_Thhalv10003641m|PACid:20199612 GQ-----PR..RHLLQS.GW-SVFVSSKRLVAGDAFIFLRGENGEL-RVGVRRAMRQQG------
kle_Thhalv10001365m|PACid:20188811 GQ-----PR..RHLLTT.GW-STFVTSKRLVAGDAFVFLRGQTGDL-RVGVRRLARQQS------
kle_Thhalv10005857m|PACid:20190472 GQ-----PR..RHLLTT.GW-STFVSSKRLVAGDAFVFLRGENGDL-RVGVRRLARHQS------
kle_Thhalv10024662m|PACid:20195558 GQ-----PR..RHLLTT.GW-STFVTSKRLVAGDTFVFLRGENGEL-RVGVRRANRQQS------
kle_Thhalv10024554m|PACid:20195557 GQ-----PR..RHLLTT.GW-STFVTSKRLVAGDTFVFLRGENGEL-RVGVRRANRQQS------
kle_Thhalv10012074m|PACid:20185111 GQ-----PR..RHLLTT.GW-SIFVSQKNLVSGDAVLFLRDEDGEL-RLGIRRSARP--------
kle_Thhalv10010019m|PACid:20188671 NS-----SQ..SYVLTK.GW-SRFVKEKNLRAGDVVSFSRSDGQDQ-------------------
kle_Thhalv10029379m|PACid:20196948 GS-----PL..RHIFTT.GW-SGFATSKRLVTGDSFIFLRGENGES-RVGIRRAVHQQR------
kle_Thhalv10006123m|PACid:20190422 NS-----SQ..SYVMTK.GW-SRFVKDKKLDAGDIVSFQRDPGNKD-------------------
kle_Thhalv10019566m|PACid:20192106 NS-----SQ..SYVLTK.GW-SRFVKEKNLRAGDVVTFERSTGP---------------------
kle_Thhalv10007983m|PACid:20187835 NS-----SQ..SYVLTK.GW-SRFVKEKNLRAGDAVCFERSTGPD--------------------
kle_Thhalv10017156m|PACid:20181075 NS-----SQ..SYVLTK.GW-SRYVKEKHLDAGDVVLFHRHRADGRR------------------
kle_Thhalv10029161m|PACid:20197833 GS-----PL..RHIFTT.GW-SAFATSKRLVTGDSFIFLRGENGES-RVGIRRAVHQQR------
kle_Thhalv10021305m|PACid:20183091 NS-----SQ..SYVLTK.GW-SRYVKDKHLDAGDVVFFQRHRFDLH-------------------
kle_Thhalv10028783m|PACid:20197484 NS-----SQ..SYVMTK.GW-SRFVKDKNLENGDAVSFH--------------------------
kle_Thhalv10015675m|PACid:20205196 NS-----SQ..SYVLTK.GW-SRFVKDKQLDPGDVVFFQRQRSDSRR------------------
kle_Thhalv10001555m|PACid:20188796 NS-----SQ..SYVMTK.GW-SRFVKDKKLDAGDIVSFQRCI-----------------------
kle_Thhalv10008068m|PACid:20187490 NS-----SQ..SYVMTK.GW-SRFVKEKKLDAGDIVSFQR-------------------------
kle_Thhalv10004508m|PACid:20200254 NS-----SQ..SYVLTK.GW-SRFVKEKRLCAGDLISFRRSNGQD--------------------
kle_Thhalv10024601m|PACid:20195479 GT-----PR..RHLLTT.GW-SNFVNQKKLVAGDSIVFMRAENGDL-CVGIRRA-----------
kle_Thhalv10016329m|PACid:20180956 GT-----PR..RHLLTT.GW-STFVNQKKLIAGDSIVFLRSESGDL-CVGIR-------------
kle_Thhalv10018331m|PACid:20192490 GT-----PR..RHLLTT.GW-SKFVNSKKLIAGDSVVFMRKSPDAL-FIGVRRA-----------
kle_Thhalv10012152m|PACid:20184762 RS-----SQ..SFVFTR.GW-NGFVKEKNLKENDVIVFYEY------------------------
kle_Thhalv10012161m|PACid:20185016 RS-----SQ..SFVFTR.GW-NGFVKEKNLKENDVILFY--------------------------
kle_Thhalv10012356m|PACid:20184298 RS-----SQ..SFVFTR.GW-NGFVKEKNLKENDVIVFY--------------------------
kle_Thhalv10012377m|PACid:20184279 RT-----SQ..TFAFTI.GW-NRFVKEKKLKENDVIVFYQC------------------------
kle_Thhalv10019015m|PACid:20192089 KNGLSGG--..------.-W-RGFAIDHQLVDGDALVFHLINS----------------------
kle_Thhalv10027164m|PACid:20194005 GQ-------..--RLTE.GW-KEFVRAHDLRIGDFVVFRH-------------------------
kle_Thhalv10021527m|PACid:20183453 ---------..------.---SEFAEAHSISEGHFL-----------------------------
kle_Thhalv10000111m|PACid:20208496 ---------..------.GW-RSFCRANGLRAGDSITFKLIQRGGT-------------------
kle_Thhalv10010633m|PACid:20207509 -------RK..RVYFTD.GW-SKFAEDHDLKDGEFLTFVYDGYH---------------------
kle_Thhalv10000999m|PACid:20202791 -------RQ..RAYFTA.GW-SKFAEDHDLKNGEFLTFVYDGYNTF-------------------
kle_Thhalv10014972m|PACid:20203483 -----SRIR..ERAYIT.AGWSKFAEEHELKDGEYLTFVYD------------------------
kle_Thhalv10000010m|PACid:20208455 ---------..------.GW-KDFAKANGLKTGDSITL---------------------------
kle_Thhalv10012062m|PACid:20185054 AGRA-----..--KFSQ.GW-YEFTLENNIGEGDVCVFELLKTRDF-------------------
kle_Thhalv10000010m|PACid:20208455 ---------..------.GW-KDFAKANGLKTGDSITL---------------------------
kle_Thhalv10005481m|PACid:20199536 PN----NNS..RMYVLE.NT-GDFVNAHGLQLGDFIMVYQNFHSNTYVIQA--------------
kle_Thhalv10000010m|PACid:20208455 ---------..----GK.GW-KDFAIANSVKAGESFTLKSLWKD---------------------
kle_Thhalv10003110m|PACid:20196814 PN----NKS..RMYLLE.NT-GDFVKTNGLQEGDFIVIYSD------------------------
kle_Thhalv10025105m|PACid:20195192 -------ME..GHRLTD.GW-KEFVKAHDLRIGDFVVFRH-------------------------
kle_Thhalv10000028m|PACid:20208357 ---------..------.----DFAKANGLKTGNSFTLKLTWEDTTPVLS---------------
kle_Thhalv10009082m|PACid:20186232 GD-------..KVFLTV.GW-ENFVKENNLEDGKMMNFIYDCNRTF-------------------
kle_Thhalv10021075m|PACid:20182250 AGRA-----..--KFSQ.GW-YEFTLENNLGEGDVCVFELLRTRDF-------------------
kle_Thhalv10000579m|PACid:20208620 KS-----SD..TFYITR.GW-RIFCDENGKKAGSFFMFKLMKNGETPLLSF--------------
kle_Thhalv10001785m|PACid:20189016 CS-----NK..TKIFSS.GW-RILARDYGLAVGDVCTFRLIKPKE--------------------
kle_Thhalv10000130m|PACid:20208871 SGR------..-FYMSR.GW-RSFCVANGKKPGDDFTFKLVQNEETP------------------
kle_Thhalv10000010m|PACid:20208455 KS-----CD..SFYITR.GW-RSFCEENGRKEGGFFVFKLVGNSETPFLS---------------
kle_Thhalv10028696m|PACid:20196953 ---------..------.-W-PEFVKDNSLIDGDFLTFVYNGD----------------------
kle_Thhalv10021075m|PACid:20182250 ---------..------.-----------------------------------------------
kle_Thhalv10027418m|PACid:20195830 -------SR..NHICLT.N---KFARANGLNNRQCEIDLRNEEGKSWTMDLRHN-----------
kle_Thhalv10004496m|PACid:20199788 ---------..------.GW-ERFANDQSLEFGDFLVFSYDGDSRF-------------------
kle_Thhalv10015705m|PACid:20206714 ---------..------.-W---------------------------------------------
kle_Thhalv10027164m|PACid:20194005 ---------..------.GW-TSFCTANKLEAGDSC-----------------------------
kle_Thhalv10000130m|PACid:20208871 PGRFC----..---MRR.GW-RSFCIANEKKPGDSFKFKLVQNGET-------------------
kle_Thhalv10009849m|PACid:20185584 SN----NKS..RMYVLE.NT-GEFVKKNGVETGDSLTIYEDESKNLYF-----------------
kle_Thhalv10000010m|PACid:20208455 ---------..------.GW-KSFVKANGLKIGESYTLEL-------------------------
kle_Thhalv10000279m|PACid:20208355 ---------..------.-----------------------------------------------
kle_Thhalv10027291m|PACid:20195068 RS-----PD..RGGITT.GW-KKFVRDNHLCLGDVCVFEPA------------------------
kle_Thhalv10000028m|PACid:20208357 ---LFSKGK..KAALGN.GW-KSFVKANGLKIGDSFTLKLIWEETTPMLSL--------------
kle_Thhalv10029137m|PACid:20197359 ---------..---LGS.GW-RVFAEANDLKPGESFTLEAFFEDTTP------------------
kle_Thhalv10028050m|PACid:20189955 ---------..------.GW-RSFCRANGLRAGDSITFKLIQRGGN-------------------
kle_Thhalv10025105m|PACid:20195192 ---------..------.NW-RSFCTANKLEVGDSFKFQLLQNTET-------------------
kle_Thhalv10009500m|PACid:20186111 ---------..-----D.GW-EDFAVAHDLRIGDIIIFRH-------------------------
kle_Thhalv10024778m|PACid:20195017 PN----NNS..RMYVLE.GV-TPCIQSMQLQAGDTVTFSRTEPEGKLVMGYR-------------
kle_Thhalv10028240m|PACid:20189403 --------E..GRRLTK.GW-ENFTAANDLRVGDFLVFRH-------------------------
kle_Thhalv10028240m|PACid:20189403 KS------S..NQFCIT.HGWKSFCHANGQKAGCSILFKLI------------------------
kle_Thhalv10022336m|PACid:20182221 ---------..DGRRLTqGW-QNFATSHDLRVGDIVIFRHD------------------------
kle_Thhalv10024481m|PACid:20195016 PN----NNS..RMYVLE.GV-TPCIQSMQLQAGDTVTFSRTEPEGKLVMGYR-------------
kle_Thhalv10028050m|PACid:20189955 ---------..------.GW-RSFCSANGLNVGDLFTFNLFQRGK--------------------
kle_Thhalv10011760m|PACid:20184627 ---------..------.-W-SEFAKAH-------------------------------------
kle_Thhalv10015617m|PACid:20203507 YM-------..------.-----------------------------------------------
kle_Thhalv10024526m|PACid:20195208 PS----NNS..RIYVLE.GV-TPCIQSMQLQAGDTVIFSRVDPERKLIMGFR-------------
kle_Thhalv10026818m|PACid:20193545 ---------..DGRRLT.GGWKDFTTAHDLRIGDIVVFKH-------------------------
kle_Thhalv10000010m|PACid:20208455 ---------..------.-W-KGFCEANGVMVGESYILEYIPRED--------------------
kle_Thhalv10000515m|PACid:20208843 ---------..------.GW-RTFCSANGYKAGDFFTLKLI------------------------
kle_Thhalv10026818m|PACid:20193545 ES-----DT..SYYIGG.GW-TRFCRENKRKAGDSILFNLVGDGR--------------------
kle_Thhalv10000028m|PACid:20208357 ---------..------.GW-RRFCEENGKKAGGFFTF---------------------------
kle_Thhalv10000515m|PACid:20208843 -----DQGK..RIRLVK.GW-REFFKANNVKIGESVMLKLIWEGD--------------------
kle_Thhalv10000130m|PACid:20208871 ---------..-----V.GW-EDFAVAHDLRIGDIVVFRH-------------------------
kle_Thhalv10014229m|PACid:20204077 ---------..------.GW-SKFVTDNGPIHGDILLFSYDGCRNF-------------------
kle_Thhalv10000111m|PACid:20208496 ---------..------.-----------------------------------------------
kle_Thhalv10000111m|PACid:20208496 -------ED..GQKLTD.GW-KEFVLAHDLRVGDIAIFRQE------------------------
kle_Thhalv10014143m|PACid:20206480 ---------..------.-----------------------------------------------
kle_Thhalv10000097m|PACid:20208741 ---------..------.-----------------------------------------------
kle_Thhalv10028050m|PACid:20189955 GQ-------..--KLTD.GW-KQFALAHDLRTGDILIFRH-------------------------
kle_Thhalv10000111m|PACid:20208496 ---------..------.GW-RTFCSAN-------------------------------------
kle_Thhalv10000515m|PACid:20208843 -------VE..DGRRLT.DGWKEFALAHDFRIGDIVIFRQEK-----------------------
kle_Thhalv10016263m|PACid:20180001 PN----NNS..RMYVLE.GV-TPCIQSMMLLAGDTVTFSRVDPG---------------------
kle_Thhalv10000097m|PACid:20208741 ---------..------.------------------------K----------------------
kle_Thhalv10000279m|PACid:20208355 --------R..------.-----------------------------------------------
kle_Thhalv10024893m|PACid:20192994 ---------..------.GW-TNFCSSNELRQGDLCKFKLSENGER-------------------
kle_Thhalv10015705m|PACid:20206714 ---------..------.-----------------------------------------------
kle_Thhalv10022138m|PACid:20181474 ---------..------.-----------------------------------------------
kle_Thhalv10026818m|PACid:20193545 ---------..------.-----------------------------------------------
kle_Thhalv10028330m|PACid:20189517 ---------..------.GW-RSFCSANGLRAGDSITFKLIQRGGN-------------------
kle_Thhalv10015617m|PACid:20203507 ---------..------.-----------------------------------------------
kle_Thhalv10000010m|PACid:20208455 ----RDGSG..RMRLTK.GW-REFAKANGLKAGESFTLESIWKDKTPM-----------------
kle_Thhalv10024698m|PACid:20195209 PS----NNS..RIYVLE.GV-TPCIQSMQLQAGDTVIFSRVDPERKLIMGFR-------------
kle_Thhalv10014488m|PACid:20206065 ---------..KYVLVN.GW-KMIVKDEDLVGGDVLEFDFDGSQ---------------------
kle_Thhalv10029136m|PACid:20197544 ------GKRswNYALTC.GW-NEIVKANGLKQGDDISIWSFRWG---------------------
kle_Thhalv10022336m|PACid:20182221 ---------..------.-----------------------------------------------
kle_Thhalv10029471m|PACid:20197403 ------GSW..NYALTC.GW-NDIVKANGLKQGDIISVW--------------------------
kle_Thhalv10027563m|PACid:20194119 -------M-..EGRRLT.DGWKEFTIAHDLRIGDIVIFRH-------------------------
kle_Thhalv10000028m|PACid:20208357 ---------..------.-------------------------------S---------------
kle_Thhalv10027563m|PACid:20194119 ES-----SR..TFYMRS.GW-RSFCGENGLKPGDSVTFK--------------------------
kle_Thhalv10022043m|PACid:20183918 -------NG..SYILCA.GW-SAIVKANNFQTNDLIGFCWVN-----------------------
kle_Thhalv10022138m|PACid:20181474 ---------..------.-----------------------------------------------
kle_Thhalv10024893m|PACid:20192994 ---------..------.-----------------------------------------------
kle_Thhalv10029137m|PACid:20197359 ---------..------.-----------------------------------------------
kle_Thhalv10000028m|PACid:20208357 ---------..------.---KPFVMENGINKGGEIYLLGKD-----------------------
kle_Thhalv10000130m|PACid:20208871 ---------..-----T.RW-KTSLLMNKNQR---------------------------------
kle_Thhalv10009500m|PACid:20186111 ---------..------.-----V-----------------------------------------
kle_Thhalv10028240m|PACid:20189403 NS-----TK..RFHVRR.GW-RAFCCANELKTGCILRLMFF------------------------
kle_Thhalv10012266m|PACid:20184241 RS-----SQ..SFVFTR.GW-NGFVKEKNLKENDVILFY--------------------------
kle_Thhalv10029137m|PACid:20197359 ---------..------.-----------------------------------------------
kle_Thhalv10025105m|PACid:20195192 ES-----TR..TFYMRS.GW-RSFCRENGLKPGDSATFKLES-----------------------
kle_Thhalv10029259m|PACid:20197343 ------GSW..NYALTC.GW-NEIVKANGLKQGDDISIWSFRW----------------------
kle_Thhalv10023054m|PACid:20202135 ---------..------.-----------------------------------------------
kle_Thhalv10000028m|PACid:20208357 ---------..----GN.DW-KEFAKANDLKTGESFKMELISEDGTRML----------------
kle_Thhalv10028330m|PACid:20189517 GQ-------..--KLTD.GW-KQFALAHDLRIGDILIFRHEK-----------------------
kle_Thhalv10027046m|PACid:20194382 ---------..------.-----------------------------------------------
kle_Thhalv10000097m|PACid:20208741 GRRLSDG--..------.-W-EEFAVANNFRTGDVVVVR--------------------------
kle_Thhalv10009500m|PACid:20186111 ---------..------.-----------------------------------------------
kle_Thhalv10028050m|PACid:20189955 NLRSAEKGK..KIRLVG.GW-KDF-----------------------------------------
kle_Thhalv10027046m|PACid:20194382 ---------..QDYILG.GW-RSFCRANELKTGIFYRFE--------------------------
kle_Thhalv10027563m|PACid:20194119 KR-------..------.-----------------------------------------------
kle_Thhalv10027046m|PACid:20194382 ---------..------.-----------------------------------------------
kle_Thhalv10000010m|PACid:20208455 ---------..------.-----------------------------------------------
kle_Thhalv10001785m|PACid:20189016 ---------..------.-----W-----------------------------------------
kle_Thhalv10028136m|PACid:20189592 ---------..------.-W-IGFCAANELKAGDTFK----------------------------
kle_Thhalv10014143m|PACid:20206480 ---------..------.-----------------------------------------------
kle_Thhalv10028002m|PACid:20189500 -----RKSS..GEVYIT.RVWRSFCEANGQKVGCSFVFKLVSNRT--------------------
kle_Thhalv10009348m|PACid:20188047 ---------..------.-----------------------------------------------
kle_Thhalv10004496m|PACid:20199788 ---------..------.-----------------------------------------------
kle_Thhalv10027164m|PACid:20194005 ---------..------.-----------------------------------------------
kle_Thhalv10028286m|PACid:20189501 --KRWNSTG..SYVLKT.NWSSDFVIRRNLQEGDEIGLFWNNPE---------------------
kle_Thhalv10000097m|PACid:20208741 ---------..------.-W-KWFCEANGVRTGESFTLEFISE----------------------
kle_Thhalv10019518m|PACid:20192323 ---------..------.-----------------------------------------------
kle_Thhalv10012253m|PACid:20184169 ----KQNSN..GYHVGT.GW-SNIKNAKDLEKDDVVQLY--------------------------
kle_Thhalv10027418m|PACid:20195830 ----A----..------.-----------------------------------------------
kle_Thhalv10004752m|PACid:20199853 ---------..------.--------------------W--------------------------
kle_Thhalv10021356m|PACid:20183715 ---------..------.-----------------------------------------------
kle_Thhalv10025105m|PACid:20195192 ---------..------.-----------------------------------------------
kle_Thhalv10029469m|PACid:20197619 ---------..------.-----------------------------------------------
kle_Thhalv10000579m|PACid:20208620 ---------..------.-W-KGFCEANGVKIGESFTLEFISE----------------------
kle_Thhalv10009706m|PACid:20185609 ---------..--L---.-----------------------------------------------
kle_Thhalv10022244m|PACid:20182095 ---------..------.-----------------------------------------------
kle_Thhalv10014488m|PACid:20206065 ---------..-----T.DYGLN------------------------------------------
kle_Thhalv10028330m|PACid:20189517 NLRSAEKGK..QIRLVG.GW-KDFF----------------------------------------
kle_Thhalv10022780m|PACid:20202142 ---------..------.-----------------------------------------------
kle_Thhalv10009730m|PACid:20186320 ---------..--L---.-----------------------------------------------
kle_Thhalv10025812m|PACid:20193747 ---------..------.GW-VKFVKDNSLSDGDFLTFVYNGD----------------------
kle_Thhalv10026054m|PACid:20194502 ---------..------.-W-VKFVEDNSLSDGDFLTFVYNGD----------------------
kle_Thhalv10028136m|PACid:20189592 ---------..------.-----------------------------C-----------------
kle_Thhalv10010633m|PACid:20207509 DDRI-----..------.-----------------------------------------------
kle_Thhalv10000579m|PACid:20208620 ---------..------.-----------------------------------------------
kle_Thhalv10009984m|PACid:20186046 ---------..------.-----------------------------------------------
kle_Thhalv10024893m|PACid:20192994 GNRLAGG--..------.-W-EEFAAVHRFRDGDVLVFRHDKDENF-------------------
kle_Thhalv10021356m|PACid:20183715 ---------..------.-----------------------------------------------
kle_Thhalv10000608m|PACid:20208283 TD-----TE..NYFLES.RW-SAIRQHLDLKAGKVIKLYWDYLNY--------------------
kle_Thhalv10017517m|PACid:20181248 ---------..------.-----------------------------------------------
kle_Thhalv10022780m|PACid:20202142 ---------..------.---------------------------E-------------------
kle_Thhalv10012233m|PACid:20184972 ---------..------.-----------------------------------------------
kle_Thhalv10000028m|PACid:20208357 GRRLSDG--..------.-W-EEFAVANNFRTGDVVLVR--------------------------
kle_Thhalv10009508m|PACid:20187652 ---------..------.-----------------------------------------------
kle_Thhalv10004752m|PACid:20199853 ---------..------.-----------------------------------------------
kle_Thhalv10024065m|PACid:20200950 ---------..-----T.GW-WDMVIANKFKVGDVY-----------------------------
kle_Thhalv10023005m|PACid:20202014 -------GH..NNTIGN.GW-NNMRNARGLKRGDVIRLY--------------------------
kle_Thhalv10000676m|PACid:20208372 KR--IKTTR..SYVFQG.AWAGEFVRRRRL-----------------------------------
kle_Thhalv10000999m|PACid:20202791 ---------..------.-----------------------------M-----------------
kle_Thhalv10023054m|PACid:20202135 ---------..------.-----------------------------------------------
kle_Thhalv10017938m|PACid:20179876 ---------..------.--------------G--------------------------------
kle_Thhalv10027418m|PACid:20195830 ---------..------.--------------------N--------------------------
kle_Thhalv10029268m|PACid:20197469 ---------..------.-----------------------------------------------
kle_Thhalv10029127m|PACid:20197407 MRK---EED..GNFRFH.GW-GSILGKRNFRTGDIIGFWW-------------------------
kle_Thhalv10003384m|PACid:20208196 ---------..------.-------V---------------------------------------
kle_Thhalv10000528m|PACid:20208661 GDEY-----..------.-----------------------------------------------
kle_Thhalv10016118m|PACid:20206561 ---------..------.-----------------------------------------------
kle_Thhalv10000689m|PACid:20208748 GD-------..-EYTVT.-----------------------------------------------
kle_Thhalv10026054m|PACid:20194502 ID-NHKNGK..LEAKTT.MWKDQRVYI--------------------------------------
kle_Thhalv10005614m|PACid:20199273 ---------..------.-----------------------------------------------
kle_Thhalv10000541m|PACid:20208467 ---------..------.-----------------------------------------------
kle_Thhalv10028696m|PACid:20196953 DQRV-----..------.-----------------------------------------------
kle_Thhalv10017854m|PACid:20180436 ---------..------.-----------------------------------------------
kle_Thhalv10025812m|PACid:20193747 ---------..------.---------------K-------------------------------
kle_Thhalv10019801m|PACid:20191643 ---------..------.-----------------------------------------------
kle_Thhalv10022269m|PACid:20183256 ---------..------.-----------------------------------------------
kle_Thhalv10000711m|PACid:20208463 GD-------..------.-----------------------------------------------


                                      150       160       170                                       
                                        |         |         |                                       
d1na6a1                            IETAIGEVIPGALISGPAGQILGGLSLQQ--ap................................
kle_Thhalv10006747m|PACid:20185923 -------VMPSSVLSSDSMHLGLLAAAAH--a.................................
kle_Thhalv10006754m|PACid:20185924 -------VMPSSVLSSDSMHLGLLAAAAH--a.................................
kle_Thhalv10018139m|PACid:20192001 -------IVPSSMLSSDSMHIGLLAAAAH--a.................................
kle_Thhalv10006748m|PACid:20187001 -------ALPSSVLSADSMHIGVLAAAAH--a.................................
kle_Thhalv10023325m|PACid:20201174 -------NIPSSVISSHSMHIGVLATAAH--a.................................
kle_Thhalv10023326m|PACid:20201173 -------NIPSSVISSHSMHIGVLATAAH--a.................................
kle_Thhalv10006635m|PACid:20185449 -------TLSSSVISSDSMHIGILAAAAH--a.................................
kle_Thhalv10012513m|PACid:20203957 -------ALSSSVISSDSMHIGVLAAAAH--a.................................
kle_Thhalv10016394m|PACid:20181239 -------------------------------asafstqynqn.......................
kle_Thhalv10012728m|PACid:20205149 -------------------------------prn...............................
kle_Thhalv10003641m|PACid:20199612 -------NVPSSVISSHSMHLGVLATAWH--a.................................
kle_Thhalv10001365m|PACid:20188811 -------TMPASVISSQSMHLGVLATASH--a.................................
kle_Thhalv10005857m|PACid:20190472 -------TMPTSVISSQSMHLGVLATASH--a.................................
kle_Thhalv10024662m|PACid:20195558 -------SMPSSVISSHSMHLGVLATACH--a.................................
kle_Thhalv10024554m|PACid:20195557 -------SMPSSVISSHSMHLGVLATACH--a.................................
kle_Thhalv10012074m|PACid:20185111 -------------------------------rng...............................
kle_Thhalv10010019m|PACid:20188671 -------------------------------qlyigwksrs........................
kle_Thhalv10029379m|PACid:20196948 -------SIPLSIISKESMHHGITA------ta................................
kle_Thhalv10006123m|PACid:20190422 -------------------------------klyidwrrrpki......................
kle_Thhalv10019566m|PACid:20192106 -------------------------------drq...............................
kle_Thhalv10007983m|PACid:20187835 -------------------------------rqlyi.............................
kle_Thhalv10017156m|PACid:20181075 -------------------------------ffigwrrrg.........................
kle_Thhalv10029161m|PACid:20197833 -------SIPLSIIS----------------keimhh............................
kle_Thhalv10021305m|PACid:20183091 -------------------------------rlfigwrrrg........................
kle_Thhalv10028783m|PACid:20197484 -------------------------------r.................................
kle_Thhalv10015675m|PACid:20205196 -------------------------------lfigwrrr..........................
kle_Thhalv10001555m|PACid:20188796 -------------------------------gds...............................
kle_Thhalv10008068m|PACid:20187490 -------------------------------g.................................
kle_Thhalv10004508m|PACid:20200254 -------------------------------rqlyig............................
kle_Thhalv10024601m|PACid:20195479 -------------------------------kr................................
kle_Thhalv10016329m|PACid:20180956 -------------------------------ra................................
kle_Thhalv10018331m|PACid:20192490 -------------------------------pis...............................
kle_Thhalv10012152m|PACid:20184762 -------------------------------dvs...............................
kle_Thhalv10012161m|PACid:20185016 -------------------------------ec................................
kle_Thhalv10012356m|PACid:20184298 -------------------------------n.................................
kle_Thhalv10012377m|PACid:20184279 -------------------------------nde...............................
kle_Thhalv10019015m|PACid:20192089 -------------------------------ttfkvyitr.........................
kle_Thhalv10027164m|PACid:20194005 -------------------------------egdmlfhvtalgpscceiqy..............
kle_Thhalv10021527m|PACid:20183453 -------------------------------ifkykgnssflvtifdvsac..............
kle_Thhalv10000111m|PACid:20208496 -------------------------------lvlrlsptds........................
kle_Thhalv10010633m|PACid:20207509 -------------------------------tfevsvyd..........................
kle_Thhalv10000999m|PACid:20202791 -------------------------------evsvynr...........................
kle_Thhalv10014972m|PACid:20203483 -------------------------------gectfevsvygrwgc...................
kle_Thhalv10000010m|PACid:20208455 -------------------------------esiwedatpvlsl.....................
kle_Thhalv10012062m|PACid:20185054 -------------------------------vlkvtafrvn........................
kle_Thhalv10000010m|PACid:20208455 -------------------------------esiwedatpvlsl.....................
kle_Thhalv10005481m|PACid:20199536 -------------------------------rk................................
kle_Thhalv10000010m|PACid:20208455 -------------------------------ktpmlslvh.........................
kle_Thhalv10003110m|PACid:20196814 -------------------------------vkcgk.............................
kle_Thhalv10025105m|PACid:20195192 -------------------------------egdmlfhvtalgt.....................
kle_Thhalv10000028m|PACid:20208357 -------------------------------lchaecsmd.........................
kle_Thhalv10009082m|PACid:20186232 -------------------------------hviifghh..........................
kle_Thhalv10021075m|PACid:20182250 -------------------------------vlkvtafrvn........................
kle_Thhalv10000579m|PACid:20208620 -------------------------------cpa...............................
kle_Thhalv10001785m|PACid:20189016 -------------------------------mvlqvs............................
kle_Thhalv10000130m|PACid:20208871 -------------------------------viqm..............................
kle_Thhalv10000010m|PACid:20208455 -------------------------------fcst..............................
kle_Thhalv10028696m|PACid:20196953 -------------------------------svfevsiyglhgc.....................
kle_Thhalv10021075m|PACid:20182250 -------------------------------kaenkiwfqdgwqefvdrysirigyllifryegn
kle_Thhalv10027418m|PACid:20195830 -------------------------------kttgqafisrgwrsfckenglkaesfcrfecvqs
kle_Thhalv10004496m|PACid:20199788 -------------------------------svsifakegc........................
kle_Thhalv10015705m|PACid:20206714 -------------------------------gsswpvkisknpsfhymedrgwnrfvsdnalgen
kle_Thhalv10027164m|PACid:20194005 -------------------------------tfkllqnantpvfrlc..................
kle_Thhalv10000130m|PACid:20208871 -------------------------------pmlq..............................
kle_Thhalv10009849m|PACid:20185584 -------------------------------sirkysgk..........................
kle_Thhalv10000010m|PACid:20208455 -------------------------------kwedttpvlclcpee...................
kle_Thhalv10000279m|PACid:20208355 ---------------------K---------wmanllresqgrmslgkgwkdfargngleigesf
kle_Thhalv10027291m|PACid:20195068 -------------------------------kpetkplhiyv.......................
kle_Thhalv10000028m|PACid:20208357 -------------------------------chgecsid..........................
kle_Thhalv10029137m|PACid:20197359 -------------------------------mvrfirtecn........................
kle_Thhalv10028050m|PACid:20189955 -------------------------------lflrltste.........................
kle_Thhalv10025105m|PACid:20195192 -------------------------------pvfqlc............................
kle_Thhalv10009500m|PACid:20186111 -------------------------------egdmvfhvtalgpscceiqyt.............
kle_Thhalv10024778m|PACid:20195017 -------------------------------ka................................
kle_Thhalv10028240m|PACid:20189403 -------------------------------egnlvfhvtpfgpscceliy..............
kle_Thhalv10028240m|PACid:20189403 -------------------------------rnrtgpvlim........................
kle_Thhalv10022336m|PACid:20182221 -------------------------------gdllfnvtsfgpscc...................
kle_Thhalv10024481m|PACid:20195016 -------------------------------ka................................
kle_Thhalv10028050m|PACid:20189955 -------------------------------tpvlrls...........................
kle_Thhalv10011760m|PACid:20184627 -------------------------------slskghflyfyykgnssfrvvifdvs........
kle_Thhalv10015617m|PACid:20203507 -------------------------------ekhgwnqfvsdnalgdnefvtfthkgkmwfdvni
kle_Thhalv10024526m|PACid:20195208 -------------------------------k.................................
kle_Thhalv10026818m|PACid:20193545 -------------------------------egdmvfnvtpfgpscc..................
kle_Thhalv10000010m|PACid:20208455 -------------------------------tdhvfkfcsn........................
kle_Thhalv10000515m|PACid:20208843 -------------------------------qrgknlvlrlslnese..................
kle_Thhalv10026818m|PACid:20193545 -------------------------------stpm..............................
kle_Thhalv10000028m|PACid:20208357 -------------------------------klvgngetpvlsfsp...................
kle_Thhalv10000515m|PACid:20208843 -------------------------------ancvlkfcs.........................
kle_Thhalv10000130m|PACid:20208871 -------------------------------egdllfhvtalgpscceiqy..............
kle_Thhalv10014229m|PACid:20204077 -------------------------------fvriyrn...........................
kle_Thhalv10000111m|PACid:20208496 -------------------------------nlrseitgdrirmvggwqeffkancvkigesvml
kle_Thhalv10000111m|PACid:20208496 -------------------------------kdmafhvtlmgpscceiqye..............
kle_Thhalv10014143m|PACid:20206480 -------------------------------hdelltfthkghmcfsvniyqidckei.......
kle_Thhalv10000097m|PACid:20208741 -------------------------------aldlrfskssdsfyisrgwrkfceengreaesff
kle_Thhalv10028050m|PACid:20189955 -------------------------------ekgmsfhveilgpsgcevqye.............
kle_Thhalv10000111m|PACid:20208496 -------------------------------gfkageaftfkliqrgkvpvlrl...........
kle_Thhalv10000515m|PACid:20208843 -------------------------------dmtfhvtpfgpscceiqye...............
kle_Thhalv10016263m|PACid:20180001 -------------------------------gklim.............................
kle_Thhalv10000097m|PACid:20208741 -------------------------------kwltnlqrdkngtmkmemglkdfvkanglkmses
kle_Thhalv10000279m|PACid:20208355 -------------------------------rlanllressgrmslgkglkdftkanglkmgesf
kle_Thhalv10024893m|PACid:20192994 -------------------------------pvlwlcpqe.........................
kle_Thhalv10015705m|PACid:20206714 -------------------------------egenswevlylvtgvqsrfsagwsrlakdlglvv
kle_Thhalv10022138m|PACid:20181474 -------------------------------knprfyyiekpgwnqfvsdlalgdnefvtfthkg
kle_Thhalv10026818m|PACid:20193545 -------------------------------ltkltkdgpnygrrglgkgwkdfckandvfkigq
kle_Thhalv10028330m|PACid:20189517 -------------------------------lvlrlsstese.......................
kle_Thhalv10015617m|PACid:20203507 -------------------------------vrenrtifssgwtklareyplligdrcifklikp
kle_Thhalv10000010m|PACid:20208455 -------------------------------lrlvh.............................
kle_Thhalv10024698m|PACid:20195209 -------------------------------k.................................
kle_Thhalv10014488m|PACid:20206065 -------------------------------cfnfciyep.........................
kle_Thhalv10029136m|PACid:20197544 -------------------------------gllcfalvtp........................
kle_Thhalv10022336m|PACid:20182221 -------------------------------tkktqsrayiargwrsfcranekranclltfklv
kle_Thhalv10029471m|PACid:20197403 -------------------------------sfrwggllcfalv.....................
kle_Thhalv10027563m|PACid:20194119 -------------------------------egdlvfhvtcfgpscteiqyd.............
kle_Thhalv10000028m|PACid:20208357 -------------------------------irdgtvalengwdefckangvklgesftlefvye
kle_Thhalv10027563m|PACid:20194119 -------------------------------legnst............................
kle_Thhalv10022043m|PACid:20183918 -------------------------------ssdrfy............................
kle_Thhalv10022138m|PACid:20181474 -------------------------------smiftihhskgsgswrvlclvreartvfssgwsk
kle_Thhalv10024893m|PACid:20192994 -------------------------------gkcgtewfylrkgwkemckangvkvndsfvleli
kle_Thhalv10029137m|PACid:20197359 -------------------------------llstrdgtvaleygwdgfceangvklgedftlef
kle_Thhalv10000028m|PACid:20208357 -------------------------------grkwptsllldktgqmrwrkgwkefvkgnglesg
kle_Thhalv10000130m|PACid:20208871 -------------------------------gtmslgrnwkgfceingvkmdesfvlelvweerv
kle_Thhalv10009500m|PACid:20186111 -------------------------------dllqnkrtgtmrigkgwrefcdahgvkigesfvl
kle_Thhalv10028240m|PACid:20189403 -------------------------------gngakp............................
kle_Thhalv10012266m|PACid:20184241 -------------------------------ecdd..............................
kle_Thhalv10029137m|PACid:20197359 -------------------------------tsllkdnkgimslgsgwkdfvkangletgftlkl
kle_Thhalv10025105m|PACid:20195192 -------------------------------nst...............................
kle_Thhalv10029259m|PACid:20197343 -------------------------------ggllcfalvtp.......................
kle_Thhalv10023054m|PACid:20202135 -------------------------------wekfvrenylgeddfltfthkgkmcfnvkifkkd
kle_Thhalv10000028m|PACid:20208357 -------------------------------klvhs.............................
kle_Thhalv10028330m|PACid:20189517 -------------------------------hmafhvkilgpsgcevqye...............
kle_Thhalv10027046m|PACid:20194382 -------------------------------lngrsfaggwedfsaahclkdddvlifrhhgdmt
kle_Thhalv10000097m|PACid:20208741 -------------------------------yegdmvfhvsdlgssccei...............
kle_Thhalv10009500m|PACid:20186111 -------------------------------kyneagmhtfirpgwrrfcaqngmkqghytfklv
kle_Thhalv10028050m|PACid:20189955 -------------------------------fkancli...........................
kle_Thhalv10027046m|PACid:20194382 -------------------------------lvrngarpllqlcsd...................
kle_Thhalv10027563m|PACid:20194119 -------------------------------drrmrlgsglkeflkaidvtayksfvlelvwedt
kle_Thhalv10027046m|PACid:20194382 -------------------------------qgrlyitkgvidfwaanqietgetftlelvrgeg
kle_Thhalv10000010m|PACid:20208455 ----------------G--------------kdgskwlanllqesrgrmtlgdgwksfvtanglk
kle_Thhalv10001785m|PACid:20189016 -------------------------------kvklskfmgsylmekngwekflydnklgdreflt
kle_Thhalv10028136m|PACid:20189592 -------------------------------fefvggegktpmlkfc..................
kle_Thhalv10014143m|PACid:20206480 -------------------------------kvkyvvsdicesrfspgwvrlarefvlqvgdvct
kle_Thhalv10028002m|PACid:20189500 -------------------------------spllim............................
kle_Thhalv10009348m|PACid:20188047 -------------------------------tadefkilgddniynegrmgvaailvdqrtkqwr
kle_Thhalv10004496m|PACid:20199788 -------------------------------kwplkivnhcsrglkfsydswllfsqshklrrpd
kle_Thhalv10027164m|PACid:20194005 ------------------------M------nlkvekgsgtmyimsgkhwkrfcavnevgagesl
kle_Thhalv10028286m|PACid:20189501 -------------------------------lrfhfcvfpp........................
kle_Thhalv10000097m|PACid:20208741 -------------------------------qtkttyvlkfcsre....................
kle_Thhalv10019518m|PACid:20192323 -------------------------------emagdiiqnlgngvkvkvliyeeeyivtlkrksn
kle_Thhalv10012253m|PACid:20184169 -------------------------------wkdtk.............................
kle_Thhalv10027418m|PACid:20195830 -------------------------------dgwktfsdhhcvryddvlifrhdgdmvfhvtplg
kle_Thhalv10004752m|PACid:20199853 -------------------------------lkrdkkglfmeeedwnefvddnflgphdvlfvth
kle_Thhalv10021356m|PACid:20183715 -------------------------------tllfthqdtmhfqvrifkkd..............
kle_Thhalv10025105m|PACid:20195192 -------------------------------kgsrrmhlgsglieflraigveayksfvlelvwe
kle_Thhalv10029469m|PACid:20197619 -------------------------------eailqkfevekesgrrswnynltcgwneivkang
kle_Thhalv10000579m|PACid:20208620 -------------------------------qykttyvlkfcsn.....................
kle_Thhalv10009706m|PACid:20185609 -------------------------------mltrwdmkknsgggtlnyaltcgsndivkgnrlk
kle_Thhalv10022244m|PACid:20182095 -------------------------------qtrllipmqsvnehirkylmndkigmiededskg
kle_Thhalv10014488m|PACid:20206065 -------------------------------fpenitlvdtlvkkfgklakkikiqlngsvfvkg
kle_Thhalv10028330m|PACid:20189517 -------------------------------kancvkidepillkliwegdtsci..........
kle_Thhalv10022780m|PACid:20202142 -------------------------------prheqglsgyfssgwrilvqeypvlvgeackftf
kle_Thhalv10009730m|PACid:20186320 -------------------------------mltrwdmkknsgggtlnyaltcgsndivkgnrlk
kle_Thhalv10025812m|PACid:20193747 -------------------------------rifevsiygpdgc.....................
kle_Thhalv10026054m|PACid:20194502 -------------------------------rifevsiygpdgc.....................
kle_Thhalv10028136m|PACid:20189592 -------------------------------lrddhvlvfrhdgdmlfhvtptgrsfsqk.....
kle_Thhalv10010633m|PACid:20207509 -------------------------------cfkgwdricrrnrlnkqdqvicemlhnrk.....
kle_Thhalv10000579m|PACid:20208620 -------------------------------lanlrrettgtmnlgkgwkdfakann........
kle_Thhalv10009984m|PACid:20186046 -------------------------------lkiiqedayrdhmvgvdanlvssdgwvfdvnvrr
kle_Thhalv10024893m|PACid:20192994 -------------------------------hvsv..............................
kle_Thhalv10021356m|PACid:20183715 -------------------------------yfhlphgtkhkgftkfygrshgfngweevseryn
kle_Thhalv10000608m|PACid:20208283 -------------------------------kfiv..............................
kle_Thhalv10017517m|PACid:20181248 -------------------------------kmwsvdtpvlssgwrefftdygfqmhcdiltirm
kle_Thhalv10022780m|PACid:20202142 -------------------------------lsgkmkiraewgsswdigisknprfyfmeksgwe
kle_Thhalv10012233m|PACid:20184972 -------------------------------mngiwvyvfntrwwnvvtankfkvgdiyhvwsfr
kle_Thhalv10000028m|PACid:20208357 -------------------------------yegdlvfhvsdlgpncc.................
kle_Thhalv10009508m|PACid:20187652 -------------------------------ifkkwnmkkksgrgtwnysltcgwndivegnglk
kle_Thhalv10004752m|PACid:20199853 -------------------------------kqpvidkyglkfgphkstmyyligkekhealtki
kle_Thhalv10024065m|PACid:20200950 -------------------------------pvwyfrfg..........................
kle_Thhalv10023005m|PACid:20202014 -------------------------------wkdtk.............................
kle_Thhalv10000676m|PACid:20208372 -------------------------------kegykiglfw........................
kle_Thhalv10000999m|PACid:20202791 -------------------------------vgergkwaddricfkgwdricrrnrlrvqdkvnc
kle_Thhalv10023054m|PACid:20202135 -------------------------------gwrilvqeypvlvgeackftflkptelllivs..
kle_Thhalv10017938m|PACid:20179876 -------------------------------ktsslyclayqwndvikentlrqgdmlhlwsfrs
kle_Thhalv10027418m|PACid:20195830 -------------------------------ikgrgqfyirrfkdcfvangikkindsftlevvr
kle_Thhalv10029268m|PACid:20197469 -------------------------------rdistflvmkkddegnfklsgwgticdrrefkeg
kle_Thhalv10029127m|PACid:20197407 -------------------------------dkyyt.............................
kle_Thhalv10003384m|PACid:20208196 -------------------------------lsspkwnkfveyykiklhcdfvtiwmfrhketrq
kle_Thhalv10000528m|PACid:20208661 -------------------------------tvtlrcignnkfyfgvgwgtmkhsmdlnegetlk
kle_Thhalv10016118m|PACid:20206561 -----------------------G-------eninfideegtvvgeranfgddricfkgwdricr
kle_Thhalv10000689m|PACid:20208748 -------------------------------lrgvdndkfyfgdgwstmkysmdlnegetlklyw
kle_Thhalv10026054m|PACid:20194502 -------------------------------kkwqrickrnslkkedgilcelfrrqglvyavkv
kle_Thhalv10005614m|PACid:20199273 -------------------------------emvgdliqnlgngvkvkvlvyeeeyilyayaewp
kle_Thhalv10000541m|PACid:20208467 -------------------------------yksdeytvtlrcidnnkfyfgvgwstmkhsmdlk
kle_Thhalv10028696m|PACid:20196953 -------------------------------cikrwkricdrnklkkndrivceilrnqdlvyai
kle_Thhalv10017854m|PACid:20180436 -------------------------------vlcsgwnkvvnsnklkegq...............
kle_Thhalv10025812m|PACid:20193747 -------------------------------llaetavwndervcikgwqhicernqvkkedgil
kle_Thhalv10019801m|PACid:20191643 -------------------------------dlvqnlgngvkvkvfvvdeeeyivtlkkksngsy
kle_Thhalv10022269m|PACid:20183256 -------------------------------lipfkilkrhdfltsdemkilgddsinnegrmgv
kle_Thhalv10000711m|PACid:20208463 -------------------------------eytvtlrcignnkfyfgvcwstmkhsmdlneget


                                                                                             
                                                                                             
d1na6a1                            ..........................................................
kle_Thhalv10006747m|PACid:20185923 ..........................................................
kle_Thhalv10006754m|PACid:20185924 ..........................................................
kle_Thhalv10018139m|PACid:20192001 ..........................................................
kle_Thhalv10006748m|PACid:20187001 ..........................................................
kle_Thhalv10023325m|PACid:20201174 ..........................................................
kle_Thhalv10023326m|PACid:20201173 ..........................................................
kle_Thhalv10006635m|PACid:20185449 ..........................................................
kle_Thhalv10012513m|PACid:20203957 ..........................................................
kle_Thhalv10016394m|PACid:20181239 ..........................................................
kle_Thhalv10012728m|PACid:20205149 ..........................................................
kle_Thhalv10003641m|PACid:20199612 ..........................................................
kle_Thhalv10001365m|PACid:20188811 ..........................................................
kle_Thhalv10005857m|PACid:20190472 ..........................................................
kle_Thhalv10024662m|PACid:20195558 ..........................................................
kle_Thhalv10024554m|PACid:20195557 ..........................................................
kle_Thhalv10012074m|PACid:20185111 ..........................................................
kle_Thhalv10010019m|PACid:20188671 ..........................................................
kle_Thhalv10029379m|PACid:20196948 ..........................................................
kle_Thhalv10006123m|PACid:20190422 ..........................................................
kle_Thhalv10019566m|PACid:20192106 ..........................................................
kle_Thhalv10007983m|PACid:20187835 ..........................................................
kle_Thhalv10017156m|PACid:20181075 ..........................................................
kle_Thhalv10029161m|PACid:20197833 ..........................................................
kle_Thhalv10021305m|PACid:20183091 ..........................................................
kle_Thhalv10028783m|PACid:20197484 ..........................................................
kle_Thhalv10015675m|PACid:20205196 ..........................................................
kle_Thhalv10001555m|PACid:20188796 ..........................................................
kle_Thhalv10008068m|PACid:20187490 ..........................................................
kle_Thhalv10004508m|PACid:20200254 ..........................................................
kle_Thhalv10024601m|PACid:20195479 ..........................................................
kle_Thhalv10016329m|PACid:20180956 ..........................................................
kle_Thhalv10018331m|PACid:20192490 ..........................................................
kle_Thhalv10012152m|PACid:20184762 ..........................................................
kle_Thhalv10012161m|PACid:20185016 ..........................................................
kle_Thhalv10012356m|PACid:20184298 ..........................................................
kle_Thhalv10012377m|PACid:20184279 ..........................................................
kle_Thhalv10019015m|PACid:20192089 ..........................................................
kle_Thhalv10027164m|PACid:20194005 ..........................................................
kle_Thhalv10021527m|PACid:20183453 ..........................................................
kle_Thhalv10000111m|PACid:20208496 ..........................................................
kle_Thhalv10010633m|PACid:20207509 ..........................................................
kle_Thhalv10000999m|PACid:20202791 ..........................................................
kle_Thhalv10014972m|PACid:20203483 ..........................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10012062m|PACid:20185054 ..........................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10005481m|PACid:20199536 ..........................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10003110m|PACid:20196814 ..........................................................
kle_Thhalv10025105m|PACid:20195192 ..........................................................
kle_Thhalv10000028m|PACid:20208357 ..........................................................
kle_Thhalv10009082m|PACid:20186232 ..........................................................
kle_Thhalv10021075m|PACid:20182250 ..........................................................
kle_Thhalv10000579m|PACid:20208620 ..........................................................
kle_Thhalv10001785m|PACid:20189016 ..........................................................
kle_Thhalv10000130m|PACid:20208871 ..........................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10028696m|PACid:20196953 ..........................................................
kle_Thhalv10021075m|PACid:20182250 safsvyifnl................................................
kle_Thhalv10027418m|PACid:20195830 gtkpvlqlcpnsss............................................
kle_Thhalv10004496m|PACid:20199788 ..........................................................
kle_Thhalv10015705m|PACid:20206714 eyltftheanmcfnvniyepdgtem.................................
kle_Thhalv10027164m|PACid:20194005 ..........................................................
kle_Thhalv10000130m|PACid:20208871 ..........................................................
kle_Thhalv10009849m|PACid:20185584 ..........................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10000279m|PACid:20208355 tlesiwedatpmlrl...........................................
kle_Thhalv10027291m|PACid:20195068 ..........................................................
kle_Thhalv10000028m|PACid:20208357 ..........................................................
kle_Thhalv10029137m|PACid:20197359 ..........................................................
kle_Thhalv10028050m|PACid:20189955 ..........................................................
kle_Thhalv10025105m|PACid:20195192 ..........................................................
kle_Thhalv10009500m|PACid:20186111 ..........................................................
kle_Thhalv10024778m|PACid:20195017 ..........................................................
kle_Thhalv10028240m|PACid:20189403 ..........................................................
kle_Thhalv10028240m|PACid:20189403 ..........................................................
kle_Thhalv10022336m|PACid:20182221 ..........................................................
kle_Thhalv10024481m|PACid:20195016 ..........................................................
kle_Thhalv10028050m|PACid:20189955 ..........................................................
kle_Thhalv10011760m|PACid:20184627 ..........................................................
kle_Thhalv10015617m|PACid:20203507 yhqngkeil.................................................
kle_Thhalv10024526m|PACid:20195208 ..........................................................
kle_Thhalv10026818m|PACid:20193545 ..........................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10000515m|PACid:20208843 ..........................................................
kle_Thhalv10026818m|PACid:20193545 ..........................................................
kle_Thhalv10000028m|PACid:20208357 ..........................................................
kle_Thhalv10000515m|PACid:20208843 ..........................................................
kle_Thhalv10000130m|PACid:20208871 ..........................................................
kle_Thhalv10014229m|PACid:20204077 ..........................................................
kle_Thhalv10000111m|PACid:20208496 kliwegdkscvlkfc...........................................
kle_Thhalv10000111m|PACid:20208496 ..........................................................
kle_Thhalv10014143m|PACid:20206480 ..........................................................
kle_Thhalv10000097m|PACid:20208741 mfklvrngetpvlgfcpse.......................................
kle_Thhalv10028050m|PACid:20189955 ..........................................................
kle_Thhalv10000111m|PACid:20208496 ..........................................................
kle_Thhalv10000515m|PACid:20208843 ..........................................................
kle_Thhalv10016263m|PACid:20180001 ..........................................................
kle_Thhalv10000097m|PACid:20208741 ftleliwedttpmlslcpaecsid..................................
kle_Thhalv10000279m|PACid:20208355 tleliwenatpvlrl...........................................
kle_Thhalv10024893m|PACid:20192994 ..........................................................
kle_Thhalv10015705m|PACid:20206714 gdvctfklikptemllkvsr......................................
kle_Thhalv10022138m|PACid:20181474 kmcfnvniyqqdgkel..........................................
kle_Thhalv10026818m|PACid:20193545 pfkleliwedtipvlkfcs.......................................
kle_Thhalv10028330m|PACid:20189517 ..........................................................
kle_Thhalv10015617m|PACid:20203507 telll.....................................................
kle_Thhalv10000010m|PACid:20208455 ..........................................................
kle_Thhalv10024698m|PACid:20195209 ..........................................................
kle_Thhalv10014488m|PACid:20206065 ..........................................................
kle_Thhalv10029136m|PACid:20197544 ..........................................................
kle_Thhalv10022336m|PACid:20182221 q.........................................................
kle_Thhalv10029471m|PACid:20197403 ..........................................................
kle_Thhalv10027563m|PACid:20194119 ..........................................................
kle_Thhalv10000028m|PACid:20208357 lntsivlkfc................................................
kle_Thhalv10027563m|PACid:20194119 ..........................................................
kle_Thhalv10022043m|PACid:20183918 ..........................................................
kle_Thhalv10022138m|PACid:20181474 lareypllvgdkctlklikptelll.................................
kle_Thhalv10024893m|PACid:20192994 wedanptfkfysk.............................................
kle_Thhalv10029137m|PACid:20197359 iyeqgtvtvlrfcs............................................
kle_Thhalv10000028m|PACid:20208357 ftlkliwegttpvfslc.........................................
kle_Thhalv10000130m|PACid:20208871 pilkfcsk..................................................
kle_Thhalv10009500m|PACid:20186111 eliweekaspvlkfc...........................................
kle_Thhalv10028240m|PACid:20189403 ..........................................................
kle_Thhalv10012266m|PACid:20184241 ..........................................................
kle_Thhalv10029137m|PACid:20197359 mwegt.....................................................
kle_Thhalv10025105m|PACid:20195192 ..........................................................
kle_Thhalv10029259m|PACid:20197343 ..........................................................
kle_Thhalv10023054m|PACid:20202135 g.........................................................
kle_Thhalv10000028m|PACid:20208357 ..........................................................
kle_Thhalv10028330m|PACid:20189517 ..........................................................
kle_Thhalv10027046m|PACid:20194382 fhvtpsg...................................................
kle_Thhalv10000097m|PACid:20208741 ..........................................................
kle_Thhalv10009500m|PACid:20186111 qksgppvirlc...............................................
kle_Thhalv10028050m|PACid:20189955 ..........................................................
kle_Thhalv10027046m|PACid:20194382 ..........................................................
kle_Thhalv10027563m|PACid:20194119 ttppml....................................................
kle_Thhalv10027046m|PACid:20194382 ttpmlkfcsk................................................
kle_Thhalv10000010m|PACid:20208455 tey.......................................................
kle_Thhalv10001785m|PACid:20189016 ftnegnncltvnifekn.........................................
kle_Thhalv10028136m|PACid:20189592 ..........................................................
kle_Thhalv10014143m|PACid:20206480 felikpaemvlsvtkkrq........................................
kle_Thhalv10028002m|PACid:20189500 ..........................................................
kle_Thhalv10009348m|PACid:20188047 vvlkkcvlktvtgrrrrclllsgewsnvveanslrdddnislwsfsrdgilffaldfa
kle_Thhalv10004496m|PACid:20199788 kclfefivtsd...............................................
kle_Thhalv10027164m|PACid:20194005 tlelirggklhnnylcfqmeq.....................................
kle_Thhalv10028286m|PACid:20189501 ..........................................................
kle_Thhalv10000097m|PACid:20208741 ..........................................................
kle_Thhalv10019518m|PACid:20192323 rsymlsagwpalvktngfqtndliglcwvssssrfyl.....................
kle_Thhalv10012253m|PACid:20184169 ..........................................................
kle_Thhalv10027418m|PACid:20195830 r.........................................................
kle_Thhalv10004752m|PACid:20199853 edtmnlevriyk..............................................
kle_Thhalv10021356m|PACid:20183715 ..........................................................
kle_Thhalv10025105m|PACid:20195192 dktsppvlkfc...............................................
kle_Thhalv10029469m|PACid:20197619 lkqgdnisvwsfrwgallcfalvt..................................
kle_Thhalv10000579m|PACid:20208620 ..........................................................
kle_Thhalv10009706m|PACid:20185609 kdddisfwsfrchnvicfalv.....................................
kle_Thhalv10022244m|PACid:20182095 wivnvydtdthsthtlclkkwnstgsyvlkknwrkdfvirrnlqegheigilwnptee
kle_Thhalv10014488m|PACid:20206065 ygailrrnnvksrdklicelkktgsnnmvht...........................
kle_Thhalv10028330m|PACid:20189517 ..........................................................
kle_Thhalv10022780m|PACid:20202142 lkptelllivs...............................................
kle_Thhalv10009730m|PACid:20186320 kdddisfwsfrchnvicfalv.....................................
kle_Thhalv10025812m|PACid:20193747 ..........................................................
kle_Thhalv10026054m|PACid:20194502 ..........................................................
kle_Thhalv10028136m|PACid:20189592 ..........................................................
kle_Thhalv10010633m|PACid:20207509 ..........................................................
kle_Thhalv10000579m|PACid:20208620 ..........................................................
kle_Thhalv10009984m|PACid:20186046 wnmdkksgssshiynlvtgwktvvsfcglkendtirvwsfrsgd..............
kle_Thhalv10024893m|PACid:20192994 ..........................................................
kle_Thhalv10021356m|PACid:20183715 lkvgdsvvcele..............................................
kle_Thhalv10000608m|PACid:20208283 ..........................................................
kle_Thhalv10017517m|PACid:20181248 frhlitrkicf...............................................
kle_Thhalv10022780m|PACid:20202142 kfvrenyleednfltfthkgnmgf..................................
kle_Thhalv10012233m|PACid:20184972 sgqgkl....................................................
kle_Thhalv10000028m|PACid:20208357 ..........................................................
kle_Thhalv10009508m|PACid:20187652 vyddisiwsfrchnvlcfalv.....................................
kle_Thhalv10004752m|PACid:20199853 ycngrnfcfsgwaaicrkyklgegdtvvcelersg.......................
kle_Thhalv10024065m|PACid:20200950 ..........................................................
kle_Thhalv10023005m|PACid:20202014 ..........................................................
kle_Thhalv10000676m|PACid:20208372 ..........................................................
kle_Thhalv10000999m|PACid:20202791 emlhh.....................................................
kle_Thhalv10023054m|PACid:20202135 ..........................................................
kle_Thhalv10017938m|PACid:20179876 qqrlclalv.................................................
kle_Thhalv10027418m|PACid:20195830 ggtspilkict...............................................
kle_Thhalv10029268m|PACid:20197469 dtigfwwenar...............................................
kle_Thhalv10029127m|PACid:20197407 ..........................................................
kle_Thhalv10003384m|PACid:20208196 icfa......................................................
kle_Thhalv10000528m|PACid:20208661 lywd......................................................
kle_Thhalv10016118m|PACid:20206561 rnkikvqdkiecemfhh.........................................
kle_Thhalv10000689m|PACid:20208748 d.........................................................
kle_Thhalv10026054m|PACid:20194502 hiir......................................................
kle_Thhalv10005614m|PACid:20199273 alvkangfqtnnliglcwvnssrrfy................................
kle_Thhalv10000541m|PACid:20208467 egetlelywdylhe............................................
kle_Thhalv10028696m|PACid:20196953 kvhiv.....................................................
kle_Thhalv10017854m|PACid:20180436 ..........................................................
kle_Thhalv10025812m|PACid:20193747 celfrkrelvyaikvhiik.......................................
kle_Thhalv10019801m|PACid:20191643 ils.......................................................
kle_Thhalv10022269m|PACid:20183256 gaflvdqrtsqwnvvlkk........................................
kle_Thhalv10000711m|PACid:20208463 lklywd....................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]