SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DNA-binding pseudobarrel domain alignments in Glycine max v109

These alignments are sequences aligned to the 0048310 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1na6a1                           s.................................................................
Glyma02g40650.2|PACid:16249708  f.................................................................
Glyma02g40650.1|PACid:16249707  f.................................................................
Glyma14g38940.1|PACid:16296878  f.................................................................
Glyma11g31940.1|PACid:16285100  f.................................................................
Glyma02g45100.1|PACid:16250234  l.................................................................
Glyma13g29320.2|PACid:16291979  l.................................................................
Glyma13g29320.1|PACid:16291978  l.................................................................
Glyma05g27580.1|PACid:16259834  l.................................................................
Glyma08g10550.1|PACid:16270663  l.................................................................
Glyma08g10550.2|PACid:16270664  l.................................................................
Glyma18g05330.1|PACid:16307991  lsm...............................................................
Glyma14g03650.2|PACid:16294247  l.................................................................
Glyma14g03650.1|PACid:16294246  l.................................................................
Glyma15g09750.1|PACid:16298234  lp................................................................
Glyma17g37580.1|PACid:16307359  fgl...............................................................
Glyma14g40540.1|PACid:16297069  gh................................................................
Glyma11g15910.1|PACid:16284061  pt................................................................
Glyma12g07560.1|PACid:16286759  pt................................................................
Glyma09g08350.1|PACid:16275193  lk................................................................
Glyma15g19980.1|PACid:16299380  lk................................................................
Glyma12g29280.2|PACid:16288274  tp................................................................
Glyma12g29280.3|PACid:16288275  tp................................................................
Glyma12g29280.1|PACid:16288273  tp................................................................
Glyma12g28550.1|PACid:16288180  esp...............................................................
Glyma17g05220.1|PACid:16304477  lk................................................................
Glyma07g32300.1|PACid:16268480  kst...............................................................
Glyma13g24240.1|PACid:16291395  kst...............................................................
Glyma01g00510.1|PACid:16242917  al................................................................
Glyma13g30750.2|PACid:16292147  kst...............................................................
Glyma15g08540.1|PACid:16298095  ks................................................................
Glyma07g15640.2|PACid:16267394  al................................................................
Glyma07g15640.1|PACid:16267393  al................................................................
Glyma05g36430.1|PACid:16260906  flr...............................................................
Glyma16g02650.1|PACid:16301238  ni................................................................
Glyma07g06060.1|PACid:16266361  se................................................................
Glyma16g00220.1|PACid:16300944  esp...............................................................
Glyma05g38540.3|PACid:16261170  h.................................................................
Glyma05g38540.1|PACid:16261168  h.................................................................
Glyma05g38540.2|PACid:16261169  h.................................................................
Glyma08g03140.1|PACid:16269782  sl................................................................
Glyma08g03140.2|PACid:16269783  sl................................................................
Glyma07g40270.1|PACid:16269382  k.................................................................
Glyma08g01100.2|PACid:16269527  h.................................................................
Glyma13g17270.1|PACid:16290589  lk................................................................
Glyma08g01100.1|PACid:16269526  h.................................................................
Glyma03g41920.1|PACid:16254194  e.................................................................
Glyma06g17320.2|PACid:16263271  h.................................................................
Glyma04g37760.1|PACid:16257086  h.................................................................
Glyma06g17320.1|PACid:16263270  h.................................................................
Glyma01g25270.3|PACid:16244440  ae................................................................
Glyma01g25270.1|PACid:16244438  ae................................................................
Glyma01g25270.2|PACid:16244439  ae................................................................
Glyma18g40180.1|PACid:16310033  el................................................................
Glyma07g16170.1|PACid:16267457  elp...............................................................
Glyma03g17450.1|PACid:16251876  ep................................................................
Glyma13g40310.1|PACid:16293267  pt................................................................
Glyma03g36710.1|PACid:16253571  nid...............................................................
Glyma19g39340.1|PACid:16314303  ip................................................................
Glyma10g08860.1|PACid:16279028  dke...............................................................
Glyma03g35700.1|PACid:16253450  kv................................................................
Glyma02g36090.1|PACid:16249204  nke...............................................................
Glyma19g38340.1|PACid:16314191  ..................................................................
Glyma16g01950.1|PACid:16301154  ke................................................................
Glyma12g08110.1|PACid:16286827  kp................................................................
Glyma19g45090.1|PACid:16314994  n.................................................................
Glyma11g20490.1|PACid:16284466  sce...............................................................
Glyma04g43350.1|PACid:16257749  qt................................................................
Glyma07g05380.1|PACid:16266276  ke................................................................
Glyma01g22260.1|PACid:16244231  q.................................................................
Glyma13g02410.1|PACid:16289434  re................................................................
Glyma13g40030.1|PACid:16293233  ekp...............................................................
Glyma12g29720.1|PACid:16288327  ekp...............................................................
Glyma03g42300.1|PACid:16254247  e.................................................................
Glyma10g06080.1|PACid:16278741  qdk...............................................................
Glyma13g20370.1|PACid:16290957  etrd..............................................................
Glyma13g20370.2|PACid:16290958  etrd..............................................................
Glyma20g32040.1|PACid:16317570  kpp...............................................................
Glyma20g32730.1|PACid:16317646  q.................................................................
Glyma10g34760.1|PACid:16280958  q.................................................................
Glyma02g11060.1|PACid:16247693  q.................................................................
Glyma08g44640.1|PACid:16273838  skpihflrimhpdnllqgklrlpaefvnkygkhlsntmflklpngaewrvnlekrdgrvwfqe...
Glyma20g39140.1|PACid:16318372  q.................................................................
Glyma13g30750.1|PACid:16292146  kst...............................................................
Glyma18g30690.1|PACid:16309436  pi................................................................
Glyma16g05110.1|PACid:16301538  qvkpf.............................................................
Glyma19g27950.1|PACid:16313030  qvkpih............................................................
Glyma12g05250.2|PACid:16286476  feppnpfcrvvlrpsylyrgcim...........................................
Glyma12g05250.1|PACid:16286475  feppnpfcrvvlrpsylyrgcim...........................................
Glyma20g01130.1|PACid:16315121  feptnpfcrvvlrpsylyrgcim...........................................
Glyma07g21160.1|PACid:16267883  feptnpfcrvvlrpsylyrgcim...........................................
Glyma11g13210.1|PACid:16283724  phpsfhklllpstvqpnqqlrlpdnfm.......................................
Glyma11g13210.2|PACid:16283725  fepsnpfcrvvlrpsylyrgcim...........................................
Glyma11g13210.1|PACid:16283724  fepsnpfcrvvlrpsylyrgcim...........................................
Glyma20g01130.1|PACid:16315121  rpcfhklvlpttlqsrqlripdnflrkygtqlstiatltvpdgsvwriglkkadnr..........
Glyma07g21160.1|PACid:16267883  rpcfdklvlpttlqsrqlripdnflrkygtqlstiatltvpdgsvwpiglkkadnri.........
Glyma17g36470.1|PACid:16307244  ftspfpsfvkimkkfnvsgsytlkipyqfsaahlptyktevtlr......................
Glyma04g04030.1|PACid:16254791  esehpafiksmlqshisggfwlglpvhfcksnlpkgdevmtli.......................
Glyma18g38490.1|PACid:16309902  ll................................................................
Glyma06g04200.1|PACid:16261660  eseypafiksmlqshvsggfwlglpvhfcksnlpkkdevv..........................
Glyma08g47240.1|PACid:16274136  ll................................................................
Glyma14g08640.1|PACid:16294855  fsspfpsfvkimkkfnvsgsytlkipyqfsaahlptyktevtlr......................
Glyma09g18790.1|PACid:16275874  frsenpsfklvmnpsfiygdyleippefaeiylkkthavvilevlegrtwpvicsapt........
Glyma12g05250.4|PACid:16286478  phpsfhklllpstvqpnqqlrlpdnf........................................
Glyma12g05250.3|PACid:16286477  phpsfhklllpstvqpnqqlrlpdnf........................................
Glyma12g05250.1|PACid:16286475  phpsfhklllpstvqpnqqlrlpdnf........................................
Glyma12g05250.2|PACid:16286476  phpsfhklllpstvqpnqqlrlpdnf........................................
Glyma01g45640.1|PACid:16246437  lspqfptflksmlpshvaggfwl...........................................
Glyma01g11670.1|PACid:16243981  iapslqegklmlpnkfvekygeglpntlflkapngaewklt.........................
Glyma16g05110.1|PACid:16301538  fkpcnpfflvvmrpsyiqsnggplplqtkfcrrhfgllnkrhinlqvlngriwpakymiqkmkn..
Glyma02g40400.1|PACid:16249676  ssnpsfiksmvrshvyscfwlglpskfceehlpktlhdmvle........................
Glyma17g36470.1|PACid:16307244  ssfpyfvrimksfnvsgsytlnipyqfsmahl..................................
Glyma09g20060.1|PACid:16275911  avhfvkiilttslad...................................................
Glyma11g13220.2|PACid:16283727  ftsrnphwkhlltkcnlercilliaaefarkyipeale............................
Glyma11g13220.1|PACid:16283726  ftsrnphwkhlltkcnlercilliaaefarkyipeale............................
Glyma17g20180.1|PACid:16306128  refpsfvkslvrshvascfwmglpvsfckrhlpdkdttfiledesgkeymtkyiacktglsa....
Glyma17g36490.1|PACid:16307246  llalpkafsdnlkkklpenvtlkgpggvvwnigmttrddtlyfvhg....................
Glyma03g40650.1|PACid:16254040  iptsftkffngvl.....................................................
Glyma18g05840.1|PACid:16308040  p.................................................................
Glyma16g05480.1|PACid:16301580  f.................................................................
Glyma09g20060.1|PACid:16275911  rsehpffrlvmkpsfingyylkisqeippqfaerylkkthaivileildgrtwsvicsa.......
Glyma15g07350.1|PACid:16297945  tp................................................................
Glyma13g31970.1|PACid:16292309  tp................................................................
Glyma06g11320.1|PACid:16262536  c.................................................................
Glyma14g08630.1|PACid:16294854  fqflhfvqflhadydqhlalpktfsdnlkkklpenvtlkgpggvmwnigm................
Glyma04g43620.1|PACid:16257788  ripeefikrfgdelsnvatvtvpdgrvwkmrlkkcgkdvsfrskwr....................
Glyma08g44650.1|PACid:16273839  rlpekfvrkygnhlsnsmllklpngiewkvnlekrdgsvwfq........................
Glyma12g05240.1|PACid:16286473  rypdffkvflperhsermlipnafvrlpqlqgriped.............................
Glyma12g05240.2|PACid:16286474  rypdffkvflperhsermlipnafvrlpqlqgriped.............................
Glyma01g32810.1|PACid:16244986  vp................................................................
Glyma11g13350.1|PACid:16283742  rypdffkvflperhsermlipnafvrlpqsqgripe..............................
Glyma03g04330.1|PACid:16251084  vp................................................................
Glyma20g04730.1|PACid:16315501  il................................................................
Glyma14g08640.1|PACid:16294855  sfnvsgsytlnipyqfsmahl.............................................
Glyma04g36750.1|PACid:16256971  tsptsffklitkrehlttlyippafsstvsdlvnkkialndsserqwnv.................
Glyma18g30700.1|PACid:16309437  kfcrshldlhkkrrlislqvlsgriwpakyqihkqktairfkls......................
Glyma11g13230.1|PACid:16283729  vpeeflkhlnedlssnavligpsgdkwqvtilkkgn..............................
Glyma08g44640.1|PACid:16273838  sftvrmkssskqhmylpkdslkgyikggeqyvkllvge............................
Glyma11g13220.3|PACid:16283728  dnpavffttikntkqlkvpeeflkhlnkdlwsnsv...............................
Glyma11g13220.2|PACid:16283727  dnpavffttikntkqlkvpeeflkhlnkdlwsnsv...............................
Glyma11g13220.1|PACid:16283726  dnpavffttikntkqlkvpeeflkhlnkdlwsnsv...............................
Glyma20g24230.1|PACid:16316640  ipnkftkrhgdrlsnpvfmkppd...........................................
Glyma04g43620.1|PACid:16257788  pkhpsvtctiqpyrlyvrshfs............................................
Glyma11g13210.2|PACid:16283725  rkyggelspivtlsvpdgsvwhvglkkadnkycf................................
Glyma14g33730.1|PACid:16296329  gv................................................................
Glyma07g19380.1|PACid:16267767  vpssftrrhwqgisnpvilslpngtkrkvywlkdgcdvwfsngw......................
Glyma12g05260.1|PACid:16286479  dnlavfftiikntkllkvpeeflkhlnedlwsnevligpsgdkwlvtiwkkgndvym.........
Glyma09g20280.1|PACid:16275915  ipnkftreygvnlsnpvflkppdgiewkifwt..................................
Glyma10g42790.1|PACid:16281912  sswqr.............................................................
Glyma02g40280.1|PACid:16249662  vp................................................................
Glyma10g42780.1|PACid:16281911  gyifsykg..........................................................
Glyma14g06030.1|PACid:16294527  kyfvtvfkpeehsesmlipdafvkstrlqgwripe...............................
Glyma20g24210.1|PACid:16316638  r.................................................................
Glyma10g17480.1|PACid:16279604  devw..............................................................
Glyma19g27340.1|PACid:16312971  m.................................................................
Glyma04g16680.1|PACid:16256057  kk................................................................
Glyma20g24220.1|PACid:16316639  r.................................................................
Glyma07g35040.1|PACid:16268769  gkpywhsvlsptnlqprynlmpgmnlrsklpsnevptiliyggksw....................
Glyma09g18790.1|PACid:16275874  pvslkspdstrwkiywtkhdgeiwfqk.......................................
Glyma04g24640.1|PACid:16256300  dpwkikktltdsdlgilsrlslaadlvkkqilpmlgadharaaeteegtpvrvwdmdtksmhqlvl
Glyma02g46090.1|PACid:16250356  tqkklfktdlnpqharlsippakianrfltpteesslnerrgkhkrlsgmpvmvldpslreynmcf
Glyma17g36490.1|PACid:16307246  iyvvmkpshvykrffvsmrgtwigkhispssqdvilrm............................
Glyma06g04190.1|PACid:16261657  gskglpvhfcksnlpkedevmtlidedgneyptiyla.............................
Glyma18g22670.1|PACid:16309256  dpwkikktltdsdlgilsrlslatdlvkkqilpmlgadharaaeteegtpvrvwdmdtksmhqlvl
Glyma06g23040.1|PACid:16263861  dpwkikktltdsdlgilsrlllaadlvkkqilpmlgayharaaetegtpvrvwdmdtksmhqlvlk
Glyma19g27950.1|PACid:16313030  lkpcnpfflvvmhpsyihsngietqnnyfsfswhslltkfcrrhfgllnkkrhinlq.........
Glyma20g24220.1|PACid:16316639  rtdnpsfiramgksyiersvlaislqktnkrrmtihssgqillsigwm..................
Glyma14g02670.1|PACid:16294117  mqkklyesdlnpnqnhacfsikiannfltqkeesfleenkmlagmhvivldpslrdcnmcfmkgsr
Glyma14g08630.1|PACid:16294854  iyvvmkpthvykrffvsirgtwigkhispssqdvilr.............................
Glyma14g38490.1|PACid:16296832  vp................................................................
Glyma08g01100.3|PACid:16269528  ..................................................................
Glyma08g44650.1|PACid:16273839  tylkshylpksplkrytksgeqyvkllvg.....................................
Glyma11g05870.1|PACid:16282832  lmhkrlfcsdvksnsnrmsmpineikceflteaeitklderdgpngkgrlvgvevtvldpclreft
Glyma10g20520.1|PACid:16279688  devwkikkvleksnigtmsrlilrremeeefvlpwsfvqiwdvdtkskhslvfkrwv.........
Glyma04g36750.1|PACid:16256971  eylpltrrvkpfthkkmvvllrdsqmrlwpvf..................................
Glyma11g13200.1|PACid:16283722  iqpenhffkaklyktrpneldisinllgdchhnlaqqtfiktkyqqvsgrvcrwk...........
Glyma11g13200.2|PACid:16283723  iqpenhffkaklyktrpneldisinllgdchhnlaqqtfiktkyqqvsgrvcrwk...........
Glyma11g31270.1|PACid:16285031  m.................................................................
Glyma03g25330.1|PACid:16252303  lmhkrlfcsdvkpnsnrlsmpineikceflteaeitklderdgpngkgrlvgvevtvldpclreft
Glyma01g05030.1|PACid:16243455  lmhkrlfcsdvrpnnnrlmpmneimcefltqdeieklderngsngkgrlvglevtvldpclrefsl
Glyma01g28050.1|PACid:16244626  lmhkrlfwsdvkpnnnrlsmpineimcefltqaeieklderngrngkgrlkwsmq...........
Glyma01g28030.1|PACid:16244624  lmhkrlfwsdvkpnnnrlsmpineimceclteaeikklderngsngkgrlkwsmq...........
Glyma01g39390.1|PACid:16245710  lmhkrlfcsdvrpnnnrlsmpmneimcefltqdeieklderdgsngkgrlkwsmq...........
Glyma01g28020.1|PACid:16244623  lmhkrlfwsdvkpnnnrlsmpineimcefltqaeieklderngsngkgrlkwsmq...........
Glyma01g28040.1|PACid:16244625  lmhkrlflsdvkpnnnrlsmpineimcefltqaeieklderngrngkgrlkwsmq...........
Glyma11g13350.1|PACid:16283742  ipmnelgdyhhnltqqthirkkyqevtgrvcrwqdricikg.........................
Glyma09g15670.1|PACid:16275699  lhkntikigk........................................................


                                                       10        20        30        40           50
                                                        |         |         |         |            |
d1na6a1                           .............-VFHNWLLEIACENYFVYIKRLSANDTGATGGHQVGLYIPSGIVEKL...FPS
Glyma02g40650.2|PACid:16249708  .............--LPMELGVPSKQPSNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma02g40650.1|PACid:16249707  .............--LPMELGVPSKQPSNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma14g38940.1|PACid:16296878  .............--LPMELGVPSKQPSNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma11g31940.1|PACid:16285100  .............--LPMELGIPSKQPSNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma02g45100.1|PACid:16250234  .............---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma13g29320.2|PACid:16291979  .............---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma13g29320.1|PACid:16291978  .............---PAELGTPSKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma05g27580.1|PACid:16259834  .............---PAELGTPSKQPTNYFCKILTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma08g10550.1|PACid:16270663  .............---PAELGTPSKQPTNYFCKILTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma08g10550.2|PACid:16270664  .............---PAELGTPSKQPTNYFCKILTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma18g05330.1|PACid:16307991  .............-----ELGIPSKQPSNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma14g03650.2|PACid:16294247  .............---PAELGTPGKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma14g03650.1|PACid:16294246  .............---PAELGTPGKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma15g09750.1|PACid:16298234  .............----AELGTASKQPTNYFCKTLTASDTSTHG----GFSVPRRAAEKV...FPP
Glyma17g37580.1|PACid:16307359  .............--------KHSKHPSEFFCKTLTASDTSTHG----GFSVPRRAAEKL...FPP
Glyma14g40540.1|PACid:16297069  .............--------KHSKHPSEFFCKTLTASDTSTHG----GFSVPRRAAEKL...FPP
Glyma11g15910.1|PACid:16284061  .............-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma12g07560.1|PACid:16286759  .............-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma09g08350.1|PACid:16275193  .............---------QNQQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma15g19980.1|PACid:16299380  .............---------QNQQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma12g29280.2|PACid:16288274  .............----------TKSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma12g29280.3|PACid:16288275  .............----------TKSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma12g29280.1|PACid:16288273  .............----------TKSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma12g28550.1|PACid:16288180  .............-----------RCTVHSFCKTLTASDTSTHG----GFSVLRRHADDC...LPP
Glyma17g05220.1|PACid:16304477  .............---------QNRQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI...LPP
Glyma07g32300.1|PACid:16268480  .............-------------TPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma13g24240.1|PACid:16291395  .............-------------TPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma01g00510.1|PACid:16242917  .............--------ESTKPPPDFFCKQLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma13g30750.2|PACid:16292147  .............-------------TPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma15g08540.1|PACid:16298095  .............------------TTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma07g15640.2|PACid:16267394  .............--------KSSKPQPDFFCKQLTASDTSTHG----GFSVPRRAADKI...FPP
Glyma07g15640.1|PACid:16267393  .............--------KSSKPQPDFFCKQLTASDTSTHG----GFSVPRRAADKI...FPP
Glyma05g36430.1|PACid:16260906  .............---------SSKPQPEFFCKQLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma16g02650.1|PACid:16301238  .............-------SEPPKQKFHSFCKILTASDTSTHG----GFSVLRKHATEC...LPA
Glyma07g06060.1|PACid:16266361  .............---------APKQKFHSFCKILTASDTSTHG----GFSVLRKHATEC...LPE
Glyma16g00220.1|PACid:16300944  .............-----------RCTVHSFCKTLTASDTSTHG----GFSVLRRHADDC...LPP
Glyma05g38540.3|PACid:16261170  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma05g38540.1|PACid:16261168  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma05g38540.2|PACid:16261169  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma08g03140.1|PACid:16269782  .............--------KLSKPQPEFFCKQLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma08g03140.2|PACid:16269783  .............--------KLSKPQPEFFCKQLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma07g40270.1|PACid:16269382  .............--------------IHSFCKTLTASDTSTHG----GFSVLRRHADDC...LPP
Glyma08g01100.2|PACid:16269527  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma13g17270.1|PACid:16290589  .............---------QNRQPTEFFCKTLTASDTSTHG----GFSVPRRAAEKI...FPP
Glyma08g01100.1|PACid:16269526  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma03g41920.1|PACid:16254194  .............---------TQKQVFHTFSKILTASDTSTHG----GFSVLRRHATEC...LPQ
Glyma06g17320.2|PACid:16263271  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma04g37760.1|PACid:16257086  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma06g17320.1|PACid:16263270  .............--------------VHSFCKTLTASDTSTHG----GFSVLRRHADEC...LPP
Glyma01g25270.3|PACid:16244440  .............---------PPRAPVHSFSKVLTASDTSTHG----GFSVLRKHATEC...LPV
Glyma01g25270.1|PACid:16244438  .............---------PPRAPVHSFSKVLTASDTSTHG----GFSVLRKHATEC...LPV
Glyma01g25270.2|PACid:16244439  .............---------PPRAPVHSFSKVLTASDTSTHG----GFSVLRKHATEC...LPV
Glyma18g40180.1|PACid:16310033  .............----------PSPRVHSFCKVLTASDTSTHG----GFSVLRKHATEC...LPA
Glyma07g16170.1|PACid:16267457  .............-----------RPRVHSFCKVLTASDTSTHG----GFSVLRKHATEC...LPA
Glyma03g17450.1|PACid:16251876  .............----------PRAPVHSFSKVLTASDTSTHG----GFSVLRKHAMEC...LPA
Glyma13g40310.1|PACid:16293267  .............-----------KSTPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPR
Glyma03g36710.1|PACid:16253571  .............-------QIPSRNAAYSFSKILTPSDTSTHG----GFSVPKKYADEC...FPP
Glyma19g39340.1|PACid:16314303  .............----------SITTTYTFSKILTPSDTSTHG----GFSVPKKHADEC...FPP
Glyma10g08860.1|PACid:16279028  .............---------------PMFEKPLTPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma03g35700.1|PACid:16253450  .............---------------AMFEKPLTPSDVGKLN----RLVIPKQHAEKH...FPL
Glyma02g36090.1|PACid:16249204  .............---------------PMFEKPLTPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma19g38340.1|PACid:16314191  .............----------------MFEKPLTPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma16g01950.1|PACid:16301154  .............---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma12g08110.1|PACid:16286827  .............---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma19g45090.1|PACid:16314994  .............----------------MFEKVVTPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma11g20490.1|PACid:16284466  .............-------------KPASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma04g43350.1|PACid:16257749  .............----------GENNVVSFSKVLTASDANNGG----GFSVPRFCADSI...FPP
Glyma07g05380.1|PACid:16266276  .............---------------HMFDKVVTPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma01g22260.1|PACid:16244231  .............----------------LFQKAVTPSDVGKLN----RLVIPKQHAEKH...FPL
Glyma13g02410.1|PACid:16289434  .............-----------NNGVVSFAKILTPSDANNGG----GFSVPRFCADSC...FPP
Glyma13g40030.1|PACid:16293233  .............---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma12g29720.1|PACid:16288327  .............---------------ASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma03g42300.1|PACid:16254247  .............---------------HMFEKVATPSDVGKLN----RLVIPKQHAEKY...FPL
Glyma10g06080.1|PACid:16278741  .............--------------PASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma13g20370.1|PACid:16290957  .............-------------KPASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma13g20370.2|PACid:16290958  .............-------------KPASFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma20g32040.1|PACid:16317570  .............---------------TSFAKTLTQSDANNGG----GFSVPRYCAETI...FPR
Glyma20g32730.1|PACid:16317646  .............----------------LFEKTVTQSDVGKLN----RLVIPKQHAEKH...FPL
Glyma10g34760.1|PACid:16280958  .............----------------LFEKTVTPSDVGKLN----RLVIPKQHAEKH...FPL
Glyma02g11060.1|PACid:16247693  .............----------------LFEKAVTPSDVGKLN----RLVIPKQHAEKH...FPL
Glyma08g44640.1|PACid:16273838  .............-----------------------------------------------...---
Glyma20g39140.1|PACid:16318372  .............----------------LFQKELTPSDVGKLN----RLVIPKKHAVSY...FPY
Glyma13g30750.1|PACid:16292146  .............-------------TPHMFCKTLTASDTSTHG----GFSVPRRAAEDC...FPP
Glyma18g30690.1|PACid:16309436  .............----------------HFFKIITA-----HNVHEGKLMIPNKFVKKY...GKR
Glyma16g05110.1|PACid:16301538  .............----------------HFFKIITAQNLQ-DG----KLMIPNKFVEKYgegLPN
Glyma19g27950.1|PACid:16313030  .............-----------------FFKIITAQNLQ-DG----KLMIPNKYVDKY...GEG
Glyma12g05250.2|PACid:16286476  .............-------------------------------------YLPSCFAEKH...LNG
Glyma12g05250.1|PACid:16286475  .............-------------------------------------YLPSCFAEKH...LNG
Glyma20g01130.1|PACid:16315121  .............-------------------------------------YLPSCFAEKN...LNG
Glyma07g21160.1|PACid:16267883  .............-------------------------------------YLPSTFAEKN...LNG
Glyma11g13210.1|PACid:16283724  .............-----------------------------------------------...---
Glyma11g13210.2|PACid:16283725  .............-------------------------------------YLPSCFAEKH...LNG
Glyma11g13210.1|PACid:16283724  .............-------------------------------------YLPSCFAEKH...LNG
Glyma20g01130.1|PACid:16315121  .............-----------------------------------------------...---
Glyma07g21160.1|PACid:16267883  .............-----------------------------------------------...---
Glyma17g36470.1|PACid:16307244  .............-----------------------------------------------...---
Glyma04g04030.1|PACid:16254791  .............-----------------------------------------------...---
Glyma18g38490.1|PACid:16309902  .............------------------QKVLKQSDVGSLG----RIVLPKKEAETH...LPE
Glyma06g04200.1|PACid:16261660  .............-----------------------------------------------...---
Glyma08g47240.1|PACid:16274136  .............------------------QKVLKQSDVGSLG----RIVLPKKEAETH...LPE
Glyma14g08640.1|PACid:16294855  .............-----------------------------------------------...---
Glyma09g18790.1|PACid:16275874  .............-----------------------------------------------...---
Glyma12g05250.4|PACid:16286478  .............-----------------------------------------------...---
Glyma12g05250.3|PACid:16286477  .............-----------------------------------------------...---
Glyma12g05250.1|PACid:16286475  .............-----------------------------------------------...---
Glyma12g05250.2|PACid:16286476  .............-----------------------------------------------...---
Glyma01g45640.1|PACid:16246437  .............-------------------------------------GLPKKFCNLY...MPK
Glyma01g11670.1|PACid:16243981  .............-----------------------------------------------...---
Glyma16g05110.1|PACid:16301538  .............-----------------------------------------------...---
Glyma02g40400.1|PACid:16249676  .............-----------------------------------------------...---
Glyma17g36470.1|PACid:16307244  .............-----------------------------------------------...---
Glyma09g20060.1|PACid:16275911  .............-----------------------------------GILLPKKFTRKY...GDG
Glyma11g13220.2|PACid:16283727  .............-----------------------------------------------...---
Glyma11g13220.1|PACid:16283726  .............-----------------------------------------------...---
Glyma17g20180.1|PACid:16306128  .............-----------------------------------------------...---
Glyma17g36490.1|PACid:16307246  .............-----------------------------------------------...---
Glyma03g40650.1|PACid:16254040  .............-----------------------------------------------...---
Glyma18g05840.1|PACid:16308040  .............----------------LFEKVLSASDAGRIG----RLVLPKACAEAY...FPP
Glyma16g05480.1|PACid:16301580  .............----------------LFQKELKNSDVSSLR----RMILPKKAAEAF...LPA
Glyma09g20060.1|PACid:16275911  .............-----------------------------------------------...---
Glyma15g07350.1|PACid:16297945  .............----------------LFQKTLSASDAGRIG----RLVLPKKCAETY...FPP
Glyma13g31970.1|PACid:16292309  .............----------------LFQKTLSASDAGRIG----RLVLPKKCAETY...FPP
Glyma06g11320.1|PACid:16262536  .............----------------------------------------------I...FPP
Glyma14g08630.1|PACid:16294854  .............---------------------T-------------------------...---
Glyma04g43620.1|PACid:16257788  .............-----------------------------------------------...---
Glyma08g44650.1|PACid:16273839  .............-----------------------------------------------...---
Glyma12g05240.1|PACid:16286473  .............-----------------------------------------------...---
Glyma12g05240.2|PACid:16286474  .............-----------------------------------------------...---
Glyma01g32810.1|PACid:16244986  .............----------------LFEKMLSASDAGRIG----RLVLPKACAEAY...FPP
Glyma11g13350.1|PACid:16283742  .............-----------------------------------------------...---
Glyma03g04330.1|PACid:16251084  .............----------------LFEKMLSASDAGRIG----RLVLPKACAEAY...FPP
Glyma20g04730.1|PACid:16315501  .............------------------TKKLNNSDVGVLG----RIVLPKREAEDK...LPT
Glyma14g08640.1|PACid:16294855  .............-----------------------------------------------...---
Glyma04g36750.1|PACid:16256971  .............-----------------------------------------------...---
Glyma18g30700.1|PACid:16309437  .............-----------------------------------------------...---
Glyma11g13230.1|PACid:16283729  .............-----------------------------------------------...---
Glyma08g44640.1|PACid:16273838  .............-----------------------------------------------...---
Glyma11g13220.3|PACid:16283728  .............-----------------------------------------------...---
Glyma11g13220.2|PACid:16283727  .............-----------------------------------------------...---
Glyma11g13220.1|PACid:16283726  .............-----------------------------------------------...---
Glyma20g24230.1|PACid:16316640  .............-----------------------------------------------...---
Glyma04g43620.1|PACid:16257788  .............-----------------------------------------------...---
Glyma11g13210.2|PACid:16283725  .............-----------------------------------------------...---
Glyma14g33730.1|PACid:16296329  .............---------------VSFSKILTPSDANNGG----GFSVPRYL----...---
Glyma07g19380.1|PACid:16267767  .............---------------R-------------------------------...---
Glyma12g05260.1|PACid:16286479  .............-----------------------------------------------...---
Glyma09g20280.1|PACid:16275915  .............-----------------------------------------------...---
Glyma10g42790.1|PACid:16281912  .............--------------------------------------IPRSFVNKY...WEG
Glyma02g40280.1|PACid:16249662  .............----------------LFEKVLSASDAGRIG----RLVLPKSCAESE...---
Glyma10g42780.1|PACid:16281911  .............--------------------------------------IPRSFVNKC...WEG
Glyma14g06030.1|PACid:16294527  .............-----------------------------------------------...---
Glyma20g24210.1|PACid:16316638  .............--------------------------------------IPRSFVNKC...WEG
Glyma10g17480.1|PACid:16279604  .............----------------KIKKVLKESDVGSMS----RLILTREMAEKFv..LPV
Glyma19g27340.1|PACid:16312971  .............-------------------------------------ILPKKAAEAF...LPA
Glyma04g16680.1|PACid:16256057  .............--------------------VLTNTDVNVN---QNRIFLKKEHVEKS...FLP
Glyma20g24220.1|PACid:16316639  .............--------------------------------------IPRSFVNKC...WEG
Glyma07g35040.1|PACid:16268769  .............-----------------------------------------------...---
Glyma09g18790.1|PACid:16275874  .............-----------------------------------------------...---
Glyma04g24640.1|PACid:16256300  ...........kr-----------------------------------------------...---
Glyma02g46090.1|PACid:16250356  .kkwemtksyvyn-----------------------------------------------...---
Glyma17g36490.1|PACid:16307246  .............-----------------------------------------------...---
Glyma06g04190.1|PACid:16261657  .............-----------------------------------------------...---
Glyma18g22670.1|PACid:16309256  ............k-----------------------------------------------...---
Glyma06g23040.1|PACid:16263861  ............r-----------------------------------------------...---
Glyma19g27950.1|PACid:16313030  .............-----------------------------------------------...---
Glyma20g24220.1|PACid:16316639  .............-----------------------------------------------...---
Glyma14g02670.1|PACid:16294117  .............-----------------------------------------------...---
Glyma14g08630.1|PACid:16294854  .............-----------------------------------------------...---
Glyma14g38490.1|PACid:16296832  .............----------------LFEKVLSASDAGRIG----RLVLPKSCAESE...---
Glyma08g01100.3|PACid:16269528  .............-----------------------------------------------...---
Glyma08g44650.1|PACid:16273839  .............-----------------------------------------------...---
Glyma11g05870.1|PACid:16282832  lllkkwsmqrtdt-----------------------------------------------...---
Glyma10g20520.1|PACid:16279688  .............-----------------------------------------------...---
Glyma04g36750.1|PACid:16256971  .............-----------------------------------------------...---
Glyma11g13200.1|PACid:16283722  .............-----------------------------------------------...---
Glyma11g13200.2|PACid:16283723  .............-----------------------------------------------...---
Glyma11g31270.1|PACid:16285031  .............-----------------------------------------------...---
Glyma03g25330.1|PACid:16252303  .lplkkwsmqrtd-----------------------------------------------...---
Glyma01g05030.1|PACid:16243455  ....alkkwsmqr-----------------------------------------------...---
Glyma01g28050.1|PACid:16244626  .............-----------------------------------------------...---
Glyma01g28030.1|PACid:16244624  .............-----------------------------------------------...---
Glyma01g39390.1|PACid:16245710  .............-----------------------------------------------...---
Glyma01g28020.1|PACid:16244623  .............-----------------------------------------------...---
Glyma01g28040.1|PACid:16244625  .............-----------------------------------------------...---
Glyma11g13350.1|PACid:16283742  .............--------------W--------------------------------...---
Glyma09g15670.1|PACid:16275699  .............-----------------------------------------------...---


                                                                         60         70          80  
                                                                          |          |           |  
d1na6a1                           I...........NH.............TRELNP.......SVFLTAHVSS.HD.C.PDSEARAIYY
Glyma02g40650.2|PACid:16249708  L...........-D.............FSQQPP.......AQELIAR--D.LH.D.VEWKFRHIFR
Glyma02g40650.1|PACid:16249707  L...........-D.............FSQQPP.......AQELIAR--D.LH.D.VEWKFRHIFR
Glyma14g38940.1|PACid:16296878  L...........-D.............FSQQPP.......AQELIAR--D.LH.D.VEWKFRHIFR
Glyma11g31940.1|PACid:16285100  L...........-D.............FSQQPP.......AQELIAR--D.LH.D.VEWKFRHIFR
Glyma02g45100.1|PACid:16250234  L...........-D.............YSQQPP.......AQELIAR--D.LH.D.NEWKFRHIFR
Glyma13g29320.2|PACid:16291979  L...........-D.............FSQQPP.......AQELIAR--D.LH.G.NEWKFRHIFR
Glyma13g29320.1|PACid:16291978  L...........-D.............FSQQPP.......AQELIAR--D.LH.G.NEWKFRHIFR
Glyma05g27580.1|PACid:16259834  L...........-D.............FSQQPP.......CQELIAR--D.LH.G.NEWKFRHIFR
Glyma08g10550.1|PACid:16270663  L...........-D.............FSQQPP.......CQELIAR--D.LH.G.NEWKFRHIFR
Glyma08g10550.2|PACid:16270664  L...........-D.............FSQQPP.......CQELIAR--D.LH.G.NEWKFRHIFR
Glyma18g05330.1|PACid:16307991  L...........-D.............FSLQPP.......AQELIAR--D.LH.D.AEWKFRHIFR
Glyma14g03650.2|PACid:16294247  L...........-D.............YSQQPP.......AQELIAR--D.LH.D.NEWKFRHIFR
Glyma14g03650.1|PACid:16294246  L...........-D.............YSQQPP.......AQELIAR--D.LH.D.NEWKFRHIFR
Glyma15g09750.1|PACid:16298234  L...........-D.............FSQQPP.......AQELIAR--D.LH.G.NEWKFRHIFR
Glyma17g37580.1|PACid:16307359  L...........-D.............YTIQPP.......TQELVVR--D.LH.D.NTWTFRHIYR
Glyma14g40540.1|PACid:16297069  L...........-D.............YTIQPP.......TQELVVR--D.LH.D.NTWTFRHIYR
Glyma11g15910.1|PACid:16284061  L...........-D.............YKQQRP.......SQELVAK--D.LH.D.VEWKFRHIYR
Glyma12g07560.1|PACid:16286759  L...........-D.............YKQQRP.......SQELVAK--D.LH.G.VEWKFRHIYR
Glyma09g08350.1|PACid:16275193  L...........-D.............FSMQPP.......AQEIVAK--D.LH.D.NTWTFRHIYR
Glyma15g19980.1|PACid:16299380  L...........-D.............FSMQPP.......AQEIVAK--D.LH.D.NTWTFRHIYR
Glyma12g29280.2|PACid:16288274  L...........-D.............YKKQRP.......SQELVAK--D.LH.G.VEWKFRHIYR
Glyma12g29280.3|PACid:16288275  L...........-D.............YKKQRP.......SQELVAK--D.LH.G.VEWKFRHIYR
Glyma12g29280.1|PACid:16288273  L...........-D.............YKKQRP.......SQELVAK--D.LH.G.VEWKFRHIYR
Glyma12g28550.1|PACid:16288180  L...........-D.............MTQQPP.......WQELVAT--D.LH.G.NEWHFRHIFR
Glyma17g05220.1|PACid:16304477  L...........-D.............YSMQPP.......AQELVAK--D.LH.D.NTWAFRHIYR
Glyma07g32300.1|PACid:16268480  L...........-D.............YSQQRP.......SQELVAK--D.LH.G.QEWRFRHIYR
Glyma13g24240.1|PACid:16291395  L...........-D.............YSQQRP.......SQELVAK--D.LH.G.QEWRFRHIYR
Glyma01g00510.1|PACid:16242917  L...........-D.............YSMQPP.......AQELVAR--D.LH.D.TVWKFRHIYR
Glyma13g30750.2|PACid:16292147  L...........-D.............YSQQRP.......SQELVAK--D.LH.G.LEWRFRHIYR
Glyma15g08540.1|PACid:16298095  L...........-D.............YSQQRP.......SQELVAK--D.LH.G.LEWRFRHIYR
Glyma07g15640.2|PACid:16267394  L...........-D.............YSMQPP.......AQELVAR--D.LH.D.TVWTFRHIYR
Glyma07g15640.1|PACid:16267393  L...........-D.............YSMQPP.......AQELVAR--D.LH.D.TVWTFRHIYR
Glyma05g36430.1|PACid:16260906  L...........-D.............YSVQPP.......AQELVAR--D.LH.D.NVWRFRHIYR
Glyma16g02650.1|PACid:16301238  L...........-D.............MTQATP.......TQELAAK--D.LH.G.FEWKFKHIYR
Glyma07g06060.1|PACid:16266361  L...........-D.............MTQSTP.......TQELAAK--D.LH.G.FEWKFKHIYR
Glyma16g00220.1|PACid:16300944  L...........-D.............MTQQPP.......WQELVAT--D.LH.G.NEWHFRHIFR
Glyma05g38540.3|PACid:16261170  L...........-D.............MTKQPP.......TQELVAK--D.LH.G.NEWRFRHIFR
Glyma05g38540.1|PACid:16261168  L...........-D.............MTKQPP.......TQELVAK--D.LH.G.NEWRFRHIFR
Glyma05g38540.2|PACid:16261169  L...........-D.............MTKQPP.......TQELVAK--D.LH.G.NEWRFRHIFR
Glyma08g03140.1|PACid:16269782  L...........-D.............YSLQSP.......VQELVAR--D.LH.D.NVWRFRHIYR
Glyma08g03140.2|PACid:16269783  L...........-D.............YSLQSP.......VQELVAR--D.LH.D.NVWRFRHIYR
Glyma07g40270.1|PACid:16269382  L...........-D.............MSQQPP.......WQELVAT--D.LH.G.NEWHFRHIFR
Glyma08g01100.2|PACid:16269527  L...........-D.............MSKQPP.......TQELVAK--D.LH.A.NEWRFRHIFR
Glyma13g17270.1|PACid:16290589  LleiesqevcmlTD.............YSMQPP.......AQELVAK--D.LH.D.NTWAFRHIYR
Glyma08g01100.1|PACid:16269526  L...........-D.............MSKQPP.......TQELVAK--D.LH.A.NEWRFRHIFR
Glyma03g41920.1|PACid:16254194  L...........-D.............MTQTTP.......SQELVAE--D.LH.G.FEWKFKHIFR
Glyma06g17320.2|PACid:16263271  L...........-D.............MSKQPP.......TQELVAK--D.LH.A.NEWRFKHIFR
Glyma04g37760.1|PACid:16257086  L...........-D.............MSKQPP.......TQELVAK--D.LH.A.NEWRFKHIFR
Glyma06g17320.1|PACid:16263270  L...........-D.............MSKQPP.......TQELVAK--D.LH.A.NEWRFKHIFR
Glyma01g25270.3|PACid:16244440  L...........-D.............MSQPTP.......TQELVAK--D.LH.G.YEWRFKHIFR
Glyma01g25270.1|PACid:16244438  L...........-D.............MSQPTP.......TQELVAK--D.LH.G.YEWRFKHIFR
Glyma01g25270.2|PACid:16244439  L...........-D.............MSQPTP.......TQELVAK--D.LH.G.YEWRFKHIFR
Glyma18g40180.1|PACid:16310033  L...........-D.............MSKSTP.......TQELVAK--D.LQ.G.YEWRFKHIFR
Glyma07g16170.1|PACid:16267457  L...........-D.............MSKSTP.......TQELVAK--D.LQ.G.FEWRFKHIFR
Glyma03g17450.1|PACid:16251876  L...........-D.............MSQPTP.......TQELVAK--D.LH.G.YEWRFKHIFR
Glyma13g40310.1|PACid:16293267  L...........-D.............YKQQRP.......SQELVAK--D.LH.G.VEWKFRHIYR
Glyma03g36710.1|PACid:16253571  L...........-D.............MTLQTP.......AQEIVAK--D.LN.G.FEWRFRHIYR
Glyma19g39340.1|PACid:16314303  L...........-D.............MTQQTP.......AQEIVAK--D.LN.G.FEWHFRHIYR
Glyma10g08860.1|PACid:16279028  S...........-G.............DSGGSE.......CKGLLLSFED.ES.G.KCWRFRYSYW
Glyma03g35700.1|PACid:16253450  D...........--.............-SSAA-.......-KGLLLSFED.ES.G.KCWRFRYSYW
Glyma02g36090.1|PACid:16249204  S...........GG.............DSGSSE.......CKGLLLSFED.ES.G.KCWRFRYSYW
Glyma19g38340.1|PACid:16314191  D...........SS.............GGDSAA.......AKGLLLSFED.ES.G.KCWRFRYSYW
Glyma16g01950.1|PACid:16301154  -...........-D.............SSANEK.......GLLLNFE--D.RN.G.KLWRFRYSYW
Glyma12g08110.1|PACid:16286827  L...........-D.............YTAEPP.......VQTVVAK--D.VH.G.ETWRFRHIYR
Glyma19g45090.1|PACid:16314994  -...........-D.............SSSNEK.......GLLLNFE--D.RN.G.KVWRFRYSYW
Glyma11g20490.1|PACid:16284466  L...........-D.............CTAEPP.......VQTVVAK--D.VH.G.ETWRFRHIYR
Glyma04g43350.1|PACid:16257749  L...........-N.............FQADPP.......VQNLLVT--D.VH.G.FVWEFRHIYR
Glyma07g05380.1|PACid:16266276  -...........-D.............SSANEK.......GLLLNFE--D.RN.G.KLWRFRYSYW
Glyma01g22260.1|PACid:16244231  Q...........SAangvsa.......TATAAK.......GVLLNFE--D.VG.G.KVWRFRYSYW
Glyma13g02410.1|PACid:16289434  L...........-D.............FRADPP.......VQLLSVA--D.IH.G.VEWRFRHIYR
Glyma13g40030.1|PACid:16293233  L...........-D.............YSAEPP.......VQTVIAR--D.VH.G.EVWKFRHIYR
Glyma12g29720.1|PACid:16288327  L...........-D.............YSAEPP.......VQTVIAK--D.VH.G.EVWKFRHIYR
Glyma03g42300.1|PACid:16254247  -...........-D.............SSTNEK.......GLLLNFE--D.RN.G.KVWRFRYSYW
Glyma10g06080.1|PACid:16278741  L...........-D.............YSVDPP.......VQNILAK--D.VH.G.ETWKFRHIYR
Glyma13g20370.1|PACid:16290957  L...........-D.............YSADPP.......VQNILAK--D.VH.G.ETWKFRHIYR
Glyma13g20370.2|PACid:16290958  L...........-D.............YSADPP.......VQNILAK--D.VH.G.ETWKFRHIYR
Glyma20g32040.1|PACid:16317570  L...........-D.............YSAEPP.......VQTIIAK--D.ML.G.QCWKFRHIYR
Glyma20g32730.1|PACid:16317646  S...........GS.............GGGALPcmaaaagAKGMLLNFED.VG.G.KVWRFRYSYW
Glyma10g34760.1|PACid:16280958  S...........GS.............GDESSPcvagasaAKGMLLNFED.VG.G.KVWRFRYSYW
Glyma02g11060.1|PACid:16247693  Q...........SSngvsattiaavtaTPTAAK.......GVLLNFE--D.VG.G.KVWRFRYSYW
Glyma08g44640.1|PACid:16273838  -...........--.............------.......----------.--.-.----------
Glyma20g39140.1|PACid:16318372  V...........GG.............SADESG.......SVDVEAVFYD.KL.M.RLWKFRYCYW
Glyma13g30750.1|PACid:16292146  L...........ST.............V-----.......TFRITVNR-D.LH.K.SLWQRIFMAW
Glyma18g30690.1|PACid:16309436  L...........--.............------.......QNTLFLK--T.PN.G.AEWKMILKKR
Glyma16g05110.1|PACid:16301538  A...........--.............------.......---LFLK--T.PN.G.TEWNFNLEKH
Glyma19g27950.1|PACid:16313030  L...........--.............----P-.......-NSLFLK--T.PN.G.TEWNFNLKKR
Glyma12g05250.2|PACid:16286476  V...........--.............------.......SGFIKLQ--I.SN.G.RQWPVRCLYR
Glyma12g05250.1|PACid:16286475  V...........--.............------.......SGFIKLQ--I.SN.G.RQWPVRCLYR
Glyma20g01130.1|PACid:16315121  V...........--.............------.......SGFIKLQ--L.SN.G.RQWSVRCLYR
Glyma07g21160.1|PACid:16267883  V...........--.............------.......SGFIKLQ--L.SN.G.RQWSVRCLYR
Glyma11g13210.1|PACid:16283724  -...........--.............------.......----------.--.-.----------
Glyma11g13210.2|PACid:16283725  V...........--.............------.......SGFIKLQ--I.SN.G.RQWPVRCLYK
Glyma11g13210.1|PACid:16283724  V...........--.............------.......SGFIKLQ--I.SN.G.RQWPVRCLYK
Glyma20g01130.1|PACid:16315121  -...........--.............------.......----------.--.-.----------
Glyma07g21160.1|PACid:16267883  -...........--.............------.......----------.--.-.----------
Glyma17g36470.1|PACid:16307244  -...........--.............------.......---------N.SR.G.ECWTVN----
Glyma04g04030.1|PACid:16254791  -...........--.............------.......---------D.ED.G.NEY--PTIYL
Glyma18g38490.1|PACid:16309902  L...........--.............--EARD.......GISITME--D.IGtS.RVWNMRYRYW
Glyma06g04200.1|PACid:16261660  -...........--.............------.......------TLID.ED.G.TEY--STIYL
Glyma08g47240.1|PACid:16274136  L...........--.............--EARD.......GISITME--D.IGtS.RVWNMRYRYW
Glyma14g08640.1|PACid:16294855  -...........--.............------.......---------N.SR.G.GCWTVN----
Glyma09g18790.1|PACid:16275874  -...........--.............------.......----------.--.-.----------
Glyma12g05250.4|PACid:16286478  -...........--.............------.......----------.--.-.----------
Glyma12g05250.3|PACid:16286477  -...........--.............------.......----------.--.-.----------
Glyma12g05250.1|PACid:16286475  -...........--.............------.......----------.--.-.----------
Glyma12g05250.2|PACid:16286476  -...........--.............------.......----------.--.-.----------
Glyma01g45640.1|PACid:16246437  L...........-D.............TT----.......---IALE--D.ET.G.QLYETK----
Glyma01g11670.1|PACid:16243981  -...........--.............------.......----------.--.-.----------
Glyma16g05110.1|PACid:16301538  -...........--.............------.......----------.--.-.----------
Glyma02g40400.1|PACid:16249676  -...........--.............------.......---------D.E-.-.NGSEYEAVYI
Glyma17g36470.1|PACid:16307244  -...........--.............-----P.......NCKIKIILHN.LK.G.EHWTVN----
Glyma09g20060.1|PACid:16275911  M...........SN.............PVFLKP.......----------.AD.G.TEWKIHYTKH
Glyma11g13220.2|PACid:16283727  -...........--.............------.......----QIYLWN.SE.G.KSWEVRVHYF
Glyma11g13220.1|PACid:16283726  -...........--.............------.......----QIYLWN.SE.G.KSWEVRVHYF
Glyma17g20180.1|PACid:16306128  -...........--.............------.......----------.--.-.----------
Glyma17g36490.1|PACid:16307246  -...........--.............------.......----------.--.-.----------
Glyma03g40650.1|PACid:16254040  -...........--.............------.......--PLKVTLVD.HD.R.KSWDV---YL
Glyma18g05840.1|PACid:16308040  I...........-S.............QSE---.......--GVPLRMQD.VK.G.NEWTFQFRFW
Glyma16g05480.1|PACid:16301580  L...........ES.............KE----.......--GIVISMDD.ID.GlHVWSFKYRFW
Glyma09g20060.1|PACid:16275911  -...........--.............------.......----------.--.-.----------
Glyma15g07350.1|PACid:16297945  I...........SQ.............PEG---.......---LPLKILD.AK.G.KEWIFQFRFW
Glyma13g31970.1|PACid:16292309  I...........SQ.............PEG---.......---LPLKILD.AK.G.KEWIFQFRFW
Glyma06g11320.1|PACid:16262536  L...........-N.............FPADPP.......VQNLLVT--D.VH.G.FVWEFRHIYR
Glyma14g08630.1|PACid:16294854  -...........--.............------.......----------.--.-.----------
Glyma04g43620.1|PACid:16257788  -...........--.............------.......----------.--.-.----------
Glyma08g44650.1|PACid:16273839  -...........--.............------.......----------.--.-.----------
Glyma12g05240.1|PACid:16286473  -...........--.............------.......---VILR--N.AS.G.RVWHVKTRYV
Glyma12g05240.2|PACid:16286474  -...........--.............------.......---VILR--N.AS.G.RVWHVKTRYV
Glyma01g32810.1|PACid:16244986  I...........SQ.............PEG---.......---LPLRIQD.VK.G.KEWMFQFRFW
Glyma11g13350.1|PACid:16283742  -...........--.............------.......--DVILR--N.IS.G.RVWQVKTRYI
Glyma03g04330.1|PACid:16251084  I...........SQ.............PEG---.......---LPLRIQD.VK.G.KEWMFQFRFW
Glyma20g04730.1|PACid:16315501  L...........WK.............KE----.......GINIVLK--DvYS.E.IEWSIKYKYW
Glyma14g08640.1|PACid:16294855  -...........--.............-----P.......NCKIKIILHN.LK.G.EHWTVN----
Glyma04g36750.1|PACid:16256971  -...........--.............------.......----------.--.-.-----K----
Glyma18g30700.1|PACid:16309437  -...........--.............------.......----------.--.-.----------
Glyma11g13230.1|PACid:16283729  -...........--.............------.......----------.--.-.------NVYM
Glyma08g44640.1|PACid:16273838  -...........--.............------.......----------.--.-.RSWRVKLVHY
Glyma11g13220.3|PACid:16283728  -...........--.............------.......-------LIG.PS.G.DKWQVTILKK
Glyma11g13220.2|PACid:16283727  -...........--.............------.......-------LIG.PS.G.DKWQVTILKK
Glyma11g13220.1|PACid:16283726  -...........--.............------.......-------LIG.PS.G.DKWQVTILKK
Glyma20g24230.1|PACid:16316640  -...........--.............------.......----------.--.G.TEWEVQWTKQ
Glyma04g43620.1|PACid:16257788  -...........--.............KKHLKP.......NVCMMLQ--N.CN.G.EQWDVSCVCH
Glyma11g13210.2|PACid:16283725  -...........--.............------.......----------.--.-.----------
Glyma14g33730.1|PACid:16296329  -...........--.............------.......----------.--.-.---ALRHIYR
Glyma07g19380.1|PACid:16267767  -...........--.............------.......----------.--.-.----------
Glyma12g05260.1|PACid:16286479  -...........--.............------.......----------.--.-.----------
Glyma09g20280.1|PACid:16275915  -...........--.............------.......----------.--.-.----------
Glyma10g42790.1|PACid:16281912  I...........--.............---SNP.......V---------.--.-.----------
Glyma02g40280.1|PACid:16249662  -...........--.............------.......--GLPLQFKD.VK.G.NDWTFQFRFW
Glyma10g42780.1|PACid:16281911  I...........S-.............----NP.......----------.--.-.----------
Glyma14g06030.1|PACid:16294527  -...........--.............------.......----------.--.-.----------
Glyma20g24210.1|PACid:16316638  I...........--.............---SNP.......VLLLLPN---.--.G.VEWKVK----
Glyma10g17480.1|PACid:16279604  L...........GDd............ADQIDS.......GVSVQIWDAD.TN.S.MHSLVFKRWV
Glyma19g27340.1|PACid:16312971  L...........ES.............KE----.......--GIVISMDD.ID.GlHVWSFKYRFW
Glyma04g16680.1|PACid:16256057  L...........-L.............RNDENI.......EEGIRVCAYD.MH.D.NSYTLM--FK
Glyma20g24220.1|PACid:16316639  M...........--.............---SNP.......VVLLLRN---.--.G.AEWK------
Glyma07g35040.1|PACid:16268769  -...........--.............------.......----------.--.-.-----DMVYY
Glyma09g18790.1|PACid:16275874  -...........--.............------.......----------.--.-.----------
Glyma04g24640.1|PACid:16256300  -...........--.............------.......----------.--.-.----------
Glyma02g46090.1|PACid:16250356  -...........--.............------.......----------.--.-.----------
Glyma17g36490.1|PACid:16307246  -...........--.............------.......----------.-G.K.GEWIARYSYN
Glyma06g04190.1|PACid:16261657  -...........--.............------.......----------.--.-.----------
Glyma18g22670.1|PACid:16309256  -...........--.............------.......----------.--.-.----------
Glyma06g23040.1|PACid:16263861  -...........--.............------.......----------.--.-.----------
Glyma19g27950.1|PACid:16313030  -...........--.............------.......----------.--.-.----------
Glyma20g24220.1|PACid:16316639  -...........--.............------.......----------.--.-.----------
Glyma14g02670.1|PACid:16294117  -...........--.............------.......----------.--.-.------S---
Glyma14g08630.1|PACid:16294854  -...........--.............------.......----------.MG.K.GEWIARYSYN
Glyma14g38490.1|PACid:16296832  -...........--.............------.......--GLPLQFKD.VK.G.NDWTFQFRFW
Glyma08g01100.3|PACid:16269528  -...........--.............------.......----------.--.-.----------
Glyma08g44650.1|PACid:16273839  -...........--.............------.......----------.--.D.RSWRVKVTYC
Glyma11g05870.1|PACid:16282832  -...........--.............------.......----------.--.-.----------
Glyma10g20520.1|PACid:16279688  -...........--.............------.......----------.--.-.----------
Glyma04g36750.1|PACid:16256971  -...........--.............------.......----------.--.-.---------Y
Glyma11g13200.1|PACid:16283722  -...........--.............------.......----------.--.-.----------
Glyma11g13200.2|PACid:16283723  -...........--.............------.......----------.--.-.----------
Glyma11g31270.1|PACid:16285031  -...........--.............------.......--------QD.VK.G.NEWTFQFRFW
Glyma03g25330.1|PACid:16252303  -...........--.............------.......----------.--.-.----------
Glyma01g05030.1|PACid:16243455  -...........--.............------.......----------.--.-.----------
Glyma01g28050.1|PACid:16244626  -...........--.............------.......----------.--.-.----------
Glyma01g28030.1|PACid:16244624  -...........--.............------.......----------.--.-.----------
Glyma01g39390.1|PACid:16245710  -...........--.............------.......----------.--.-.----------
Glyma01g28020.1|PACid:16244623  -...........--.............------.......----------.--.-.----------
Glyma01g28040.1|PACid:16244625  -...........--.............------.......----------.--.-.----------
Glyma11g13350.1|PACid:16283742  -...........--.............------.......----------.--.-.----------
Glyma09g15670.1|PACid:16275699  -...........--.............------.......----------.--.-.----------


                                          90           100         110       120          130       
                                           |             |           |         |            |       
d1na6a1                           NSAHF..GKTR...NEKRIT.RWGRG..SPLQDPENTGALTLLAFKL..DE.QGGDCKEVNIWVCA
Glyma02g40650.2|PACid:16249708  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma02g40650.1|PACid:16249707  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma14g38940.1|PACid:16296878  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma11g31940.1|PACid:16285100  GQ---..--PK...RHLLTT.GW-SI..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma02g45100.1|PACid:16250234  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma13g29320.2|PACid:16291979  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma13g29320.1|PACid:16291978  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma05g27580.1|PACid:16259834  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma08g10550.1|PACid:16270663  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma08g10550.2|PACid:16270664  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma18g05330.1|PACid:16307991  GQ---..--PK...RHLLTT.GW-SI..FVSAKRLVAGDSVLFIWNE..KN.QL-LLGIRRANRPQ
Glyma14g03650.2|PACid:16294247  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWYM..NEkNQLLLGIRRANRPQ
Glyma14g03650.1|PACid:16294246  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWYM..NEkNQLLLGIRRANRPQ
Glyma15g09750.1|PACid:16298234  GQ---..--PK...RHLLTT.GW-SV..FVSAKRLVAGDSVLFIWQAmnEK.NQLLLGIRRANRPQ
Glyma17g37580.1|PACid:16307359  GQ---..--PK...RHLLTT.GW-SL..FVGSKRLRAGDSVLFIRDE..KS.QL-RVGVRRVNRQQ
Glyma14g40540.1|PACid:16297069  GQ---..--PK...RHLLTT.GW-SL..FVGSKRLRAGDSVLFIRDE..RS.QL-RVGVRRVNRQQ
Glyma11g15910.1|PACid:16284061  GQ---..--PR...RHLLTT.GW-SI..FVSQKNLVSGDAVLFLRGE..NG.EL-RLGIRRAVRPR
Glyma12g07560.1|PACid:16286759  GQ---..--PR...RHLLTT.GW-SI..FVSQKNLVSGDAVLFLRGE..NG.EL-RLGIRRAVRPR
Glyma09g08350.1|PACid:16275193  GQ---..--PK...RHLLTT.GW-SV..FVSTKRLFAGDSVLFIRDE..KQ.QL-LLGIKRANRQQ
Glyma15g19980.1|PACid:16299380  GQ---..--PK...RHLLTT.GW-SV..FVSTKRLFAGDSVLFIRDE..KQ.QL-LLGIKRANRQQ
Glyma12g29280.2|PACid:16288274  GQ---..--PR...RHLLTT.GW-SI..FVSQKNLVSGDAVLFLRGE..NG.EL-RLGIRRAARPR
Glyma12g29280.3|PACid:16288275  GQ---..--PR...RHLLTT.GW-SI..FVSQKNLVSGDAVLFLRGE..NG.EL-RLGIRRAARPR
Glyma12g29280.1|PACid:16288273  GQ---..--PR...RHLLTT.GW-SI..FVSQKNLVSGDAVLFLRGE..NG.EL-RLGIRRAARPR
Glyma12g28550.1|PACid:16288180  GQ---..--PR...RHLLTT.GW-SV..FVSSKKLVAGDAFIFLRGE..NG.EL-RVGVRRLMRQQ
Glyma17g05220.1|PACid:16304477  GQ---..--PK...RHLLTT.GW-SV..FVSTKRLFAGDSVLFIRDE..KQ.HL-LLGIRRANRQQ
Glyma07g32300.1|PACid:16268480  GQ---..--PR...RHLLTT.GW-SA..FVNKKKLVSGDAVLFLRGE..DG.EL-RLGIRRAAQLK
Glyma13g24240.1|PACid:16291395  GQ---..--PR...RHLLTT.GW-SA..FVNKKKLVSGDAVLFLRGE..DG.EL-RLGIRRAAQLK
Glyma01g00510.1|PACid:16242917  GQ---..--PK...RHLLTT.GW-SL..FVSGKRLFAGDSVLFIRDE..KQ.QL-LLGIRRANRQP
Glyma13g30750.2|PACid:16292147  GQ---..--PR...RHLLTT.GW-SA..FVNKKKLVSGDAVLFLRGD..DG.EL-RLGIRRAAQL-
Glyma15g08540.1|PACid:16298095  GQ---..--PR...RHLLTT.GW-SA..FVNKKKLVSGDAVLFLRGN..DG.EL-RLGIRR-----
Glyma07g15640.2|PACid:16267394  GQ---..--PK...RHLLTT.GW-SL..FVSGKRLLAGDSVLFIRDE..KQ.HL-LLGIRRANRQP
Glyma07g15640.1|PACid:16267393  GQ---..--PK...RHLLTT.GW-SL..FVSGKRLLAGDSVLFIRDE..KQ.HL-LLGIRRANRQP
Glyma05g36430.1|PACid:16260906  GQ---..--PK...RHLLTT.GW-SL..FIGGKRLLAGDSVLFVRDE..KQ.QL-LLGIRRANRQP
Glyma16g02650.1|PACid:16301238  GQ---..--PR...RHLLTT.GW-ST..FVASKRLVAGDAFVFLRGE..HG.QL-RVGVRRLARQQ
Glyma07g06060.1|PACid:16266361  GQ---..--PR...RHLLTT.GW-ST..FVASKRLVAGDAFVFLRGE..HG.QL-RVGVRRLARQQ
Glyma16g00220.1|PACid:16300944  GQ---..--PR...RHLLTT.GW-SV..FVSSKKLVAGDAFIFLRQA..RQ.MIVVLFFLRLMRQH
Glyma05g38540.3|PACid:16261170  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma05g38540.1|PACid:16261168  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma05g38540.2|PACid:16261169  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma08g03140.1|PACid:16269782  GK---..--PK...RHLLTT.GW-SL..FISGKRLLAGDSVLFVRDE..KQ.QL-LLGIRRANRQP
Glyma08g03140.2|PACid:16269783  GK---..--PK...RHLLTT.GW-SL..FISGKRLLAGDSVLFVRDE..KQ.QL-LLGIRRANRQP
Glyma07g40270.1|PACid:16269382  GQ---..--PK...RHLLTT.GW-SV..FVSSKKLAAGDAFIFLRQL..--.---RVGVRRVMRQQ
Glyma08g01100.2|PACid:16269527  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma13g17270.1|PACid:16290589  GQ---..--PK...RHLLTT.GW-SV..FVSTKRLFAGDSVLFIRDE..KQ.HL-LLGIRRANRQQ
Glyma08g01100.1|PACid:16269526  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma03g41920.1|PACid:16254194  GQ---..--PR...RHLLTT.GW-ST..FVTSKKLVAGDAFVFLRGE..NG.EL-RVGVRRVARQQ
Glyma06g17320.2|PACid:16263271  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma04g37760.1|PACid:16257086  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma06g17320.1|PACid:16263270  GQ---..--PR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma01g25270.3|PACid:16244440  GQ---..--PR...RHLLTT.GW-ST..FVTSKRLVAGDTFVFLRGD..NG.EL-RVGVRRLARQA
Glyma01g25270.1|PACid:16244438  GQ---..--PR...RHLLTT.GW-ST..FVTSKRLVAGDTFVFLRGD..NG.EL-RVGVRRLARQA
Glyma01g25270.2|PACid:16244439  GQ---..--PR...RHLLTT.GW-ST..FVTSKRLVAGDTFVFLRGD..NG.EL-RVGVRRLARQA
Glyma18g40180.1|PACid:16310033  GQ---..--PR...RHLLTT.GW-SN..FVTSKRLVAGDTFVFLRGN..NG.EL-RVGVRRIAPVQ
Glyma07g16170.1|PACid:16267457  GQ---..--PR...RHLLTT.GW-ST..FVTSKRLVAGDTFVFLRGN..NG.EL-RVGVRRIAPLQ
Glyma03g17450.1|PACid:16251876  GQ---..--PR...RHLLTT.GW-ST..FVTSKRLVAGDTFVFLRGD..NG.EL-RVGVRRLARQA
Glyma13g40310.1|PACid:16293267  GQ---..--PR...RHLLTT.GW-SI..FVSQKNLV-----------..--.--------------
Glyma03g36710.1|PACid:16253571  GQ---..--PK...RHLLTS.GW-SL..FVNAKKLVAGDSCIFVRGE..SG.EL-RVGIRRAAENL
Glyma19g39340.1|PACid:16314303  GK---..--PK...RHLLTS.GW-ST..FVNAKKLVAGDSCIFVRAE..SG.EI-RVGIRRATEHL
Glyma10g08860.1|PACid:16279028  NS---..--SQ...SYVLTK.GW-SR..YVKDKRLDAGDVVLFERHR..VD.AQR-----------
Glyma03g35700.1|PACid:16253450  NS---..--SQ...SYVLTK.GW-SR..YVKDKRLHAGDVVLFHRHR..SL.PQ------------
Glyma02g36090.1|PACid:16249204  NS---..--SQ...SYVLTK.GW-SR..YVKDKRLDAGDVVLFQRHR..AD.AQR-----------
Glyma19g38340.1|PACid:16314191  NS---..--SQ...SYVLTK.GW-SR..YVKDKRLHAGDVVLFHRHR..AH.PQR-----------
Glyma16g01950.1|PACid:16301154  NS---..--SQ...SYVMTK.GW-SR..FVKEKKLDAGDIVSFQRGV..GE.SYRH----------
Glyma12g08110.1|PACid:16286827  GT---..--PR...RHLLTT.GW-SS..FVNQKKLVAGDSVVFLRAE..NG.DL-CVGIR------
Glyma19g45090.1|PACid:16314994  NS---..--SQ...SYVMTK.GW-SR..FVKEKKLDAGDIVSFQR--..--.--------------
Glyma11g20490.1|PACid:16284466  GT---..--PR...RHLLTT.GW-SS..FVNQKKLVAGDSVVFLRAE..NG.DL-CVGIR------
Glyma04g43350.1|PACid:16257749  GT---..--PR...RHLLTT.GW-ST..FVNNKKLVAGDVVVFMKNS..GG.GL-FVGIRRATR--
Glyma07g05380.1|PACid:16266276  NS---..--SQ...SYVMTK.GW-SR..FVKEKKLDAGDMVSFQR--..--.--------------
Glyma01g22260.1|PACid:16244231  NS---..--SQ...SYVLTK.GW-SR..FVKEKNLKAGDTVCFQRST..GP.DR------------
Glyma13g02410.1|PACid:16289434  GT---..--PR...RHLFTT.GW-SK..FVNHKKLVAGDTVVFVKDS..DG.IV-SVGIRRAA---
Glyma13g40030.1|PACid:16293233  GT---..--PR...RHLLTT.GW-SS..FVNQKKLVAGDSIVFLRAE..NG.DL-CVGIR------
Glyma12g29720.1|PACid:16288327  GT---..--PR...RHLLTT.GW-SS..FVNQKKLVAGDSIVFLRAE..NG.DL-CVGIR------
Glyma03g42300.1|PACid:16254247  NS---..--SQ...SYVMTK.GW-SR..FVKEKKLDAGDIVSFQRGL..GD.LYR-----------
Glyma10g06080.1|PACid:16278741  GT---..--PR...RHLLTT.GW-ST..FVNHKKLVAGDSIVFLRAE..NG.DL-CVGIR------
Glyma13g20370.1|PACid:16290957  GT---..--PR...RHLLTT.GW-ST..FVNHKKLVAGDSIVFLRAE..NG.DL-CVGIR------
Glyma13g20370.2|PACid:16290958  GT---..--PR...RHLLTT.GW-ST..FVNHKKLVAGDSIVFLRAE..NG.DL-CVGIR------
Glyma20g32040.1|PACid:16317570  GT---..--PR...RHLLTT.GW-SN..FVNQKRLVAGDSIVFLRAE..NG.DL-CVGIR------
Glyma20g32730.1|PACid:16317646  NS---..--SQ...SYVLTK.GW-SR..FVKEKNLRAGDAVQFFKS-..--.--------------
Glyma10g34760.1|PACid:16280958  NS---..--SQ...SYVLTK.GW-SR..FVKEKNLRAGDAVQFFKST..GP.D-------------
Glyma02g11060.1|PACid:16247693  NS---..--SQ...SYVLTK.GW-SR..FVKEKNLKAGDTVCFHRST..GP.D-------------
Glyma08g44640.1|PACid:16273838  -----..----...------.GW-KK..FVEHHSLAHGHLLVFKY--..--.--------------
Glyma20g39140.1|PACid:16318372  KS---..--SQ...SYVFTR.GW-NR..FVKDKKLKAKDVIAFF---..--.--------------
Glyma13g30750.1|PACid:16292146  NG---..GQPR...RHLLTT.GW-SA..FVNKKKLVSGDAVLFLRGD..DG.EL-RLGIRRAAQL-
Glyma18g30690.1|PACid:16309436  DGKIW..F---...----QK.GW-KE..FAEYHSLAHGHLLVFRWDV..T-.--------------
Glyma16g05110.1|PACid:16301538  DGKIW..FQK-...------.GW-KE..FAEYHSLAHGHLLVFRRHG..TS.H-------------
Glyma19g27950.1|PACid:16313030  DGKIW..FQK-...------.GW-KE..FAEYHSLAHGHLLVFRRHR..TS.HF------------
Glyma12g05250.2|PACid:16286476  GG---..----...RAKLSQ.GW-FE..FSLENNLGEGDVCVFELLR..MK.EV------------
Glyma12g05250.1|PACid:16286475  GG---..----...RAKLSQ.GW-FE..FSLENNLGEGDVCVFELLR..MK.EV------------
Glyma20g01130.1|PACid:16315121  GG---..----...RAKLSQ.GW-FE..FTVENNLGEGDVCVFELLR..TK.EV------------
Glyma07g21160.1|PACid:16267883  GG---..----...RAKLSQ.GW-FE..FTVENNLGEGDVCVFELLR..MK.EV------------
Glyma11g13210.1|PACid:16283724  -----..----...------.-----..-------------------..--.--------------
Glyma11g13210.2|PACid:16283725  GG---..----...RAKLSQ.GW-FE..FSLENNLGEGDVCVFELLR..MK.EV------------
Glyma11g13210.1|PACid:16283724  GG---..----...RAKLSQ.GW-FE..FSLENNLGEGDVCVFELLR..MK.EV------------
Glyma20g01130.1|PACid:16315121  -----..----...-I----.-----..-------------------..--.--------------
Glyma07g21160.1|PACid:16267883  -----..----...--W---.-----..-------------------..--.--------------
Glyma17g36470.1|PACid:16307244  ---SV..PDAK...GRTVHT.FCGGWmaFVRDNDINFGDTCIFELV-..--.--------------
Glyma04g04030.1|PACid:16254791  AR---..----...KTGLSG.GW-KG..FAVGHDLADGDAVIFQLIK..HT.--------------
Glyma18g38490.1|PACid:16309902  PN---..-NKS...RMYLLE.NT-GD..FVRANGLQEGDFIVIYSDV..--.--------------
Glyma06g04200.1|PACid:16261660  AGKTGlsG---...------.GW-RG..FAIAHDLADGDALIFQLI-..--.--------------
Glyma08g47240.1|PACid:16274136  PN---..-NKS...RMYLLE.NT-GD..FVRANGLQEGDFIVIYSDV..--.--------------
Glyma14g08640.1|PACid:16294855  ---SV..PDAK...GRTVHT.FCGGWmaFVRDNDINFGDTCIFEL--..--.--------------
Glyma09g18790.1|PACid:16275874  -----..----...----IT.GGWHK..FASENHLNVGDVCVFEL--..--.--------------
Glyma12g05250.4|PACid:16286478  -----..----...------.-----..-------------------..--.--------------
Glyma12g05250.3|PACid:16286477  -----..----...------.-----..-------------------..--.--------------
Glyma12g05250.1|PACid:16286475  -----..----...------.-----..-------------------..--.--------------
Glyma12g05250.2|PACid:16286476  -----..----...------.-----..-------------------..--.--------------
Glyma01g45640.1|PACid:16246437  -----..----...------.-----..-------------------..--.--------------
Glyma01g11670.1|PACid:16243981  -----..----...------.-----..-------------------..--.--------------
Glyma16g05110.1|PACid:16301538  -----..--KT...NFRLTS.GW-KT..FVKDNNLKVGNVCTFELID..GT.K-------------
Glyma02g40400.1|PACid:16249676  GNRAGlsG---...------.GW-RA..FALDHKLDDGDALVFELIE..--.--------------
Glyma17g36470.1|PACid:16307244  ---SV..PTTR...VHTSHT.LCGGWmaFVRGNNIKVGDICIFELVH..EC.EL------------
Glyma09g20060.1|PACid:16275911  G----..----...------.-----..-------------------..--.--------------
Glyma11g13220.2|PACid:16283727  RNRNT..---W...YAAFKR.GW-ER..FVRDNKLMKGDTCIFEVEE..EQ.GHWSVHI-------
Glyma11g13220.1|PACid:16283726  RNRNT..---W...YAAFKR.GW-ER..FVRDNKLMKGDTCIFEVEE..EQ.GHWSVHI-------
Glyma17g20180.1|PACid:16306128  -----..----...------.GW-RQ..FSAVHKLHEGDVVVFQLVE..--.--------------
Glyma17g36490.1|PACid:16307246  -----..----...------.-W-EQ..FVKDHCLKEND--------..--.--------------
Glyma03g40650.1|PACid:16254040  EK---..--TE...GCLVFKdGW-QQ..FAKEKVLEDGDFLVFQYDG..R-.--------------
Glyma18g05840.1|PACid:16308040  PN---..-NNS...RMYVLE.GV-TP..CIQAMQLCAGDTVTFSRID..PG.GKLVMGFR------
Glyma16g05480.1|PACid:16301580  PN---..-NNS...RMYVLE.NT-GD..FVNTHGLRFGDSILVYQDS..EN.NNYV----------
Glyma09g20060.1|PACid:16275911  -----..----...--TRLT.EGWQK..FASENNLNVGDVCVFEL--..--.--------------
Glyma15g07350.1|PACid:16297945  PN---..-NNS...RMYVLE.GV-TP..CIQSMQLQAGDTVTFSRLE..PE.GRLVMGFR------
Glyma13g31970.1|PACid:16292309  PN---..-NNS...RMYVLE.GV-TP..CIQSMQLQAGDTVTFSRLE..PE.GRLVMGFR------
Glyma06g11320.1|PACid:16262536  GT---..--PR...RHLLTT.GW-ST..FVNNKKLVAGDAVVFMKNS..RG.GL-LVGIRRTTRFS
Glyma14g08630.1|PACid:16294854  -----..----...------.-----..-------------------..--.--------------
Glyma04g43620.1|PACid:16257788  -----..----...------.----E..F------------------..--.--------------
Glyma08g44650.1|PACid:16273839  -----..----...------.-----..-------------------..--.-------------E
Glyma12g05240.1|PACid:16286473  GEKLYfdDGWR...AFHQEN.CLGQA..-------------------..--.--------------
Glyma12g05240.2|PACid:16286474  GEKLYfdDGWR...AFHQEN.CLGQA..-------------------..--.--------------
Glyma01g32810.1|PACid:16244986  PN---..-NNS...RMYVLE.GV-TP..CIQSMQLQAGDTVTFSRMD..PE.GKLIMGFR------
Glyma11g13350.1|PACid:16283742  GEKLYfdD---...------.---GW..NAFHEENCLGHADFLVF--..--.--------------
Glyma03g04330.1|PACid:16251084  PN---..-NNS...RMYVLE.GV-TP..CIQSMQLQAGDTVTFSRMD..PE.GKLIMGFR------
Glyma20g04730.1|PACid:16315501  TN---..--NK...SRMYIL.DNTGD..FVNHYKLQTGDFITLYK--..--.--------------
Glyma14g08640.1|PACid:16294855  ---SV..PTTR...VHTSHT.LCGGWmaFIRGNNIKVGDICIFELVR..E-.--------------
Glyma04g36750.1|PACid:16256971  -----..----...------.-----..-------------------..--.--------------
Glyma18g30700.1|PACid:16309437  -----..----...------.-W-NA..FVKDNNLKVGDVCIFELVH..GT.KLT-----------
Glyma11g13230.1|PACid:16283729  NN---..----...------.G--WS..QFLKDNSVVLDEFLLFTYH..GG.NCFYVQ--------
Glyma08g44640.1|PACid:16273838  KN---..--RS...SCFFSA.NW-PA..FARENDLKEGDACWFQLLN..SS.--------------
Glyma11g13220.3|PACid:16283728  GNNVY..----...---MDN.G--WS..QFLKDNSVVLDEFLLFTYH..GG.NCFYVQ--------
Glyma11g13220.2|PACid:16283727  GNNVY..----...---MDN.G--WS..QFLKDNSVVLDEFLLFTYH..GG.NCFYVQ--------
Glyma11g13220.1|PACid:16283726  GNNVY..----...---MDN.G--WS..QFLKDNSVVLDEFLLFTYH..GG.NCFYVQ--------
Glyma20g24230.1|PACid:16316640  NGEVWf.EK--...------.GW-KE..FVENYFLNHGHLVLFNYEG..--.--------------
Glyma04g43620.1|PACid:16257788  NTRYG..----...GMMLTR.GW-RK..FVRDNDLSEGDPCVLELIE..TN.--------------
Glyma11g13210.2|PACid:16283725  -----..----...----L-.-----..-------------------..--.--------------
Glyma14g33730.1|PACid:16296329  GT---..--PR...RHLFTT.GW-SK..FVNHKKLVAGDTVVFVKDS..DG.RV-SVGIRR-----
Glyma07g19380.1|PACid:16267767  -----..----...------.-----..-------------------..--.--------------
Glyma12g05260.1|PACid:16286479  K----..----...------.-----..-------------------..--.--------------
Glyma09g20280.1|PACid:16275915  -----..----...------.-----..-----------------K-..--.--------------
Glyma10g42790.1|PACid:16281912  -----..----...------.-----..-------------------..--.--------------
Glyma02g40280.1|PACid:16249662  PN---..-NNS...RMYVLE.GV-TP..CMQAMQLNAGDTVMFSRID..PG.G-------------
Glyma10g42780.1|PACid:16281911  -----..----...------.-----..-------------------..--.--------------
Glyma14g06030.1|PACid:16294527  -----..----...-DVILT.NVGRR..VWNVKTRLVGNKIYFE---..--.--------------
Glyma20g24210.1|PACid:16316638  -----..----...------.-----..-------------------..--.--------------
Glyma10g17480.1|PACid:16279604  -----..-SSR...SYVFIG.NWIKD..FVARRGLRKGDEIGFQWNP..FK.N-------------
Glyma19g27340.1|PACid:16312971  PN---..-NNS...RMYVLE.NT-GD..FVNTHGLRFGDSIMVYQDS..EN.NNYV----------
Glyma04g16680.1|PACid:16256057  KW---..--TK...KFYVLN.GEWKK..FFQIHE-------------..--.--------------
Glyma20g24220.1|PACid:16316639  -----..----...------.-----..-------------------..--.--------------
Glyma07g35040.1|PACid:16268769  GQ---..-SKQ...KAFGVT.GW-KK..FVIDNCLRVGDACIFELME..SS.D-------------
Glyma09g18790.1|PACid:16275874  -----..----...------.-----..-----------------G-..--.--------------
Glyma04g24640.1|PACid:16256300  ----W..SSSK...SYVLIG.KWNQD..FVRRRDLKKGDEIGFHWDP..YN.C-------------
Glyma02g46090.1|PACid:16250356  -----..----...---LTM.GW-NQ..IVGDNHLKLGDTL------..--.--------------
Glyma17g36490.1|PACid:16307246  NI---..---R...NNGGLT.GGWKH..FSLDNNLEEGDACVFK---..--.--------------
Glyma06g04190.1|PACid:16261657  -R---..----...------.-----..-------------------..--.--------------
Glyma18g22670.1|PACid:16309256  ---RW..SSSK...SYVLIA.KWNQD..FVRRRDLKKGDEIGFHWDP..YN.C-------------
Glyma06g23040.1|PACid:16263861  ----W..SSSK...SYVLIG.KWNQD..FVRRRDLRKGDEIGFHWDP..YN.C-------------
Glyma19g27950.1|PACid:16313030  -K---..--TKnkiNFRLTS.GW-KA..FVKDNNLKVGNVCTFEL--..--.--------------
Glyma20g24220.1|PACid:16316639  -----..----...------.----D..FVKDNNLKIGNVCVFE---..--.--------------
Glyma14g02670.1|PACid:16294117  -----..----...------.-----..-------------------..--.--------------
Glyma14g08630.1|PACid:16294854  NI---..---R...NNGGLT.GGWKH..FSLDSNLEEGDACVFK---..--.--------------
Glyma14g38490.1|PACid:16296832  PN---..----...------.-----..-------------------..--.--------------
Glyma08g01100.3|PACid:16269528  -----..GQPR...RHLLQS.GW-SV..FVSSKRLVAGDAFIFLRGE..NG.EL-RVGVRRAMRQQ
Glyma08g44650.1|PACid:16273839  RNKTL..----...-SY---.-----..-------FTGDWLVFA---..--.--------------
Glyma11g05870.1|PACid:16282832  -----..----...-YNLVT.NW---..-------------------..--.--------------
Glyma10g20520.1|PACid:16279688  -----..-PSR...SYVFIG.NWIKD..FVARRGLRKGDEIGFQWNP..F-.--------------
Glyma04g36750.1|PACid:16256971  -----..----...------.-----..-------------------..--.--------------
Glyma11g13200.1|PACid:16283722  -----..----...------.-----..-------------------..--.--------------
Glyma11g13200.2|PACid:16283723  -----..----...------.-----..-------------------..--.--------------
Glyma11g31270.1|PACid:16285031  PN---..-NNS...RMYVLE.GV-TP..CIQAMQLCAGDTVTFSRID..PG.GKLVMGFR------
Glyma03g25330.1|PACid:16252303  -----..----...TYNLVT.NW---..-------------------..--.--------------
Glyma01g05030.1|PACid:16243455  -----..--TD...TYNLVT.NW-NR..IVFINEFEEGHELQIW---..--.--------------
Glyma01g28050.1|PACid:16244626  -----..-RTD...TYNLVT.DW-NS..IVSTNEFEEGQELQILS--..--.--------------
Glyma01g28030.1|PACid:16244624  -----..-RTD...TYNLVT.EW-NS..IVSTNEFEEGQELQIW---..--.--------------
Glyma01g39390.1|PACid:16245710  -----..-RTD...TYNLVT.NW-NR..IVFINEFEEGHELQIW---..--.--------------
Glyma01g28020.1|PACid:16244623  -----..-RTD...TYNLVT.DW-NS..IVSTNEFEEGQELQIW---..--.--------------
Glyma01g28040.1|PACid:16244625  -----..-RTD...TYNLVT.DW-NS..IVSTNKFEEGQELQ-----..--.--------------
Glyma11g13350.1|PACid:16283742  -----..----...------.-----..-------------------..--.--------------
Glyma09g15670.1|PACid:16275699  -----..----...------.GW-KC..YYKYNKLQKGDKIIFTF--..--.--------------


                                  140       150       160       170                                 
                                    |         |         |         |                                 
d1na6a1                           STDEEDVIETAIGEVIPGALISGPAGQILGGLSLQQ--ap..........................
Glyma02g40650.2|PACid:16249708  T-------------VMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma02g40650.1|PACid:16249707  T-------------VMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma14g38940.1|PACid:16296878  T-------------VMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma11g31940.1|PACid:16285100  T-------------VMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma02g45100.1|PACid:16250234  T-------------IMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma13g29320.2|PACid:16291979  T-------------VMPSSVLSSDSMHLGLLAAAAH--a...........................
Glyma13g29320.1|PACid:16291978  T-------------VMPSSVLSSDSMHLGLLAAAAH--a...........................
Glyma05g27580.1|PACid:16259834  P-------------VMPSSVLSSDSMHLGLLAAAAH--a...........................
Glyma08g10550.1|PACid:16270663  P-------------VMPSSVLSSDSMHLGLLAAAAH--a...........................
Glyma08g10550.2|PACid:16270664  P-------------VMPSSVLSSDSMHLGLLAAAAH--a...........................
Glyma18g05330.1|PACid:16307991  T-------------VMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma14g03650.2|PACid:16294247  T-------------IMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma14g03650.1|PACid:16294246  T-------------IMPSSVLSSDSMHIGLLAAAAH--a...........................
Glyma15g09750.1|PACid:16298234  T-------------VMPSSVLSSDSMHLGLLAAAAH--a...........................
Glyma17g37580.1|PACid:16307359  T-------------TLPSSVLSADSMHIGVLAAAAH--a...........................
Glyma14g40540.1|PACid:16297069  T-------------TLPSSVLSADSMHIGVLAAAAH--a...........................
Glyma11g15910.1|PACid:16284061  ND------------------------------------lpes........................
Glyma12g07560.1|PACid:16286759  ND------------------------------------lpes........................
Glyma09g08350.1|PACid:16275193  P-------------ALSSSVISSDSMHIGILAAAAH--a...........................
Glyma15g19980.1|PACid:16299380  P-------------ALSSSVISSDSMHIGILAAAAH--a...........................
Glyma12g29280.2|PACid:16288274  N-------------------------------------glpesi......................
Glyma12g29280.3|PACid:16288275  N-------------------------------------glpesi......................
Glyma12g29280.1|PACid:16288273  N-------------------------------------glpesi......................
Glyma12g28550.1|PACid:16288180  S-------------NMPSSVISSHSMHLGVLATASH--a...........................
Glyma17g05220.1|PACid:16304477  P-------------ALSSSVISSDSMHIGILAAAAH--a...........................
Glyma07g32300.1|PACid:16268480  S-------------------------------------gst.........................
Glyma13g24240.1|PACid:16291395  SG------------------------------------stfsal......................
Glyma01g00510.1|PACid:16242917  T-------------NISSSVLSSDSMHIGILAAAAH--a...........................
Glyma13g30750.2|PACid:16292147  --------------------------------------ksa.........................
Glyma15g08540.1|PACid:16298095  --------------------------------------aaq.........................
Glyma07g15640.2|PACid:16267394  T-------------NISSSVLSSDSMHIGILAAAAH--a...........................
Glyma07g15640.1|PACid:16267393  T-------------NISSSVLSSDSMHIGILAAAAH--a...........................
Glyma05g36430.1|PACid:16260906  S-------------NLSSSVLSSDSMHIGVLAAA----aq..........................
Glyma16g02650.1|PACid:16301238  S-------------PMPSSVISSQSMHLGVLATASH--a...........................
Glyma07g06060.1|PACid:16266361  S-------------PMPSSVISSQSMHLGVLATASH--a...........................
Glyma16g00220.1|PACid:16300944  S-------------NMPSSVISSHSMHLGVLATASH--a...........................
Glyma05g38540.3|PACid:16261170  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma05g38540.1|PACid:16261168  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma05g38540.2|PACid:16261169  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma08g03140.1|PACid:16269782  S-------------NLSSSVLSSDSMHIGVLAAA----aq..........................
Glyma08g03140.2|PACid:16269783  S-------------NLSSSVLSSDSMHIGVLAAA----aq..........................
Glyma07g40270.1|PACid:16269382  S-------------NVPSSVISSHSMHLGVLATASH--a...........................
Glyma08g01100.2|PACid:16269527  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma13g17270.1|PACid:16290589  P-------------ALSSSVISSDSMHIGILAAAAH--a...........................
Glyma08g01100.1|PACid:16269526  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma03g41920.1|PACid:16254194  S-------------PMPSSVISSQSMHLGVLATASH--a...........................
Glyma06g17320.2|PACid:16263271  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma04g37760.1|PACid:16257086  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma06g17320.1|PACid:16263270  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma01g25270.3|PACid:16244440  S-------------SMPSSVISSQSMHLGVLATASH--a...........................
Glyma01g25270.1|PACid:16244438  S-------------SMPSSVISSQSMHLGVLATASH--a...........................
Glyma01g25270.2|PACid:16244439  S-------------SMPSSVISSQSMHLGVLATASH--a...........................
Glyma18g40180.1|PACid:16310033  S-------------SMPSSVISSQSMHLGVLATASH--a...........................
Glyma07g16170.1|PACid:16267457  S-------------SMPSSVISSQSMHLGVLATASH--a...........................
Glyma03g17450.1|PACid:16251876  S-------------SMPSSVISSQSMHLGVLATASH--a...........................
Glyma13g40310.1|PACid:16293267  --------------------------------------s...........................
Glyma03g36710.1|PACid:16253571  S-----------NISQSSSLISGHSMQL----------gi..........................
Glyma19g39340.1|PACid:16314303  S-----------NVSQSSSLISGHSMQLGILAS-----ash.........................
Glyma10g08860.1|PACid:16279028  --------------------------------------lfigwrrrrq..................
Glyma03g35700.1|PACid:16253450  --------------------------------------rffiscsrrqp.................
Glyma02g36090.1|PACid:16249204  --------------------------------------lfigwrrrrq..................
Glyma19g38340.1|PACid:16314191  --------------------------------------ffisctrhq...................
Glyma16g01950.1|PACid:16301154  --------------------------------------rlyidwkrr...................
Glyma12g08110.1|PACid:16286827  --------------------------------------ra..........................
Glyma19g45090.1|PACid:16314994  --------------------------------------g...........................
Glyma11g20490.1|PACid:16284466  --------------------------------------ra..........................
Glyma04g43350.1|PACid:16257749  --------------------------------------fs..........................
Glyma07g05380.1|PACid:16266276  --------------------------------------g...........................
Glyma01g22260.1|PACid:16244231  --------------------------------------qlyid.......................
Glyma13g02410.1|PACid:16289434  --------------------------------------rfa.........................
Glyma13g40030.1|PACid:16293233  --------------------------------------ra..........................
Glyma12g29720.1|PACid:16288327  --------------------------------------ra..........................
Glyma03g42300.1|PACid:16254247  --------------------------------------hrlyidwkr...................
Glyma10g06080.1|PACid:16278741  --------------------------------------ra..........................
Glyma13g20370.1|PACid:16290957  --------------------------------------ra..........................
Glyma13g20370.2|PACid:16290958  --------------------------------------ra..........................
Glyma20g32040.1|PACid:16317570  --------------------------------------ra..........................
Glyma20g32730.1|PACid:16317646  --------------------------------------tgldrqlyidckarsg............
Glyma10g34760.1|PACid:16280958  --------------------------------------rqlyidck....................
Glyma02g11060.1|PACid:16247693  --------------------------------------kqlyidw.....................
Glyma08g44640.1|PACid:16273838  --------------------------------------dgtfhfhvlifdps..............
Glyma20g39140.1|PACid:16318372  --------------------------------------twgks.......................
Glyma13g30750.1|PACid:16292146  --------------------------------------ksa.........................
Glyma18g30690.1|PACid:16309436  --------------------------------------shfqvhifdlsaleieyp..........
Glyma16g05110.1|PACid:16301538  --------------------------------------fqvhifdls...................
Glyma19g27950.1|PACid:16313030  --------------------------------------qvhifdls....................
Glyma12g05250.2|PACid:16286476  --------------------------------------vlqvtvfr....................
Glyma12g05250.1|PACid:16286475  --------------------------------------vlqvtvfr....................
Glyma20g01130.1|PACid:16315121  --------------------------------------vlqvtvfrv...................
Glyma07g21160.1|PACid:16267883  --------------------------------------vlqvtvfrv...................
Glyma11g13210.1|PACid:16283724  --------RKYGGELSPIVTLSVPDGSV----------whvglkkadnkycfldgwkefvqrysig
Glyma11g13210.2|PACid:16283725  --------------------------------------vlqvtifh....................
Glyma11g13210.1|PACid:16283724  --------------------------------------vlqvtifh....................
Glyma20g01130.1|PACid:16315121  --------------------------------------lfvdgwqdfvqhysigvgyflvfmyegn
Glyma07g21160.1|PACid:16267883  --------------------------------------fvdgwqdfvqrysigvgyflvfmyegns
Glyma17g36470.1|PACid:16307244  --------------------------------------aqcemhvyisg.................
Glyma04g04030.1|PACid:16254791  --------------------------------------afkvyiiran..................
Glyma18g38490.1|PACid:16309902  --------------------------------------kcgkym......................
Glyma06g04200.1|PACid:16261660  --------------------------------------krttfkvyivr.................
Glyma08g47240.1|PACid:16274136  --------------------------------------kcgkym......................
Glyma14g08640.1|PACid:16294855  --------------------------------------vaqcemqvyisg................
Glyma09g18790.1|PACid:16275874  --------------------------------------iqkiqglafkvsifr.............
Glyma12g05250.4|PACid:16286478  -------MRKYGGELLPIVTLSVPDGSV----------wrvglkkadnkywfldgwkefvkhysis
Glyma12g05250.3|PACid:16286477  -------MRKYGGELLPIVTLSVPDGSV----------wrvglkkadnkywfldgwkefvkhysis
Glyma12g05250.1|PACid:16286475  -------MRKYGGELLPIVTLSVPDGSV----------wrvglkkadnkywfldgwkefvkhysis
Glyma12g05250.2|PACid:16286476  -------MRKYGGELLPIVTLSVPDGSV----------wrvglkkadnkywfldgwkefvkhysis
Glyma01g45640.1|PACid:16246437  --------------------------------------ylaqkaglsagwrgfsiahnllemdvli
Glyma01g11670.1|PACid:16243981  ---------------------------------L----ekrddkmwfqkgwrefakhhsldhghll
Glyma16g05110.1|PACid:16301538  --------------------------------------ltllvhifr...................
Glyma02g40400.1|PACid:16249676  --------------------------------------asrfkiyivr..................
Glyma17g36470.1|PACid:16307244  --------------------------------------rvria.......................
Glyma09g20060.1|PACid:16275911  --------------------------------------geiwfqkgwkefatyysldhghllffey
Glyma11g13220.2|PACid:16283727  --------------------------------------frtg........................
Glyma11g13220.1|PACid:16283726  --------------------------------------frtg........................
Glyma17g20180.1|PACid:16306128  --------------------------------------ptkfk.......................
Glyma17g36490.1|PACid:16307246  --------------------------------------flvfkyngesqfdvlifn..........
Glyma03g40650.1|PACid:16254040  --------------------------------------stfnvkifsktgc...............
Glyma18g05840.1|PACid:16308040  --------------------------------------ka..........................
Glyma16g05480.1|PACid:16301580  --------------------------------------iq..........................
Glyma09g20060.1|PACid:16275911  --------------------------------------iqkiqglcfkvsiy..............
Glyma15g07350.1|PACid:16297945  --------------------------------------k...........................
Glyma13g31970.1|PACid:16292309  --------------------------------------k...........................
Glyma06g11320.1|PACid:16262536  PGK-----------------------------------ggdv........................
Glyma14g08630.1|PACid:16294854  --------------------------------------trddtlyfghgweqfvkdhclkendflv
Glyma04g43620.1|PACid:16257788  --------------------------------------veyyslgygsylvfryegnskfrvlifd
Glyma08g44650.1|PACid:16273839  --------------------------------------gwkdfaeyyslanghllgfrydgtshfh
Glyma12g05240.1|PACid:16286473  --------------------------------------dflvfklerrnefvvlilq.........
Glyma12g05240.2|PACid:16286474  --------------------------------------dflvfklerrnefvvlilq.........
Glyma01g32810.1|PACid:16244986  --------------------------------------ka..........................
Glyma11g13350.1|PACid:16283742  --------------------------------------khdrsnefkvliless............
Glyma03g04330.1|PACid:16251084  --------------------------------------ka..........................
Glyma20g04730.1|PACid:16315501  --------------------------------------delk........................
Glyma14g08640.1|PACid:16294855  --------------------------------------celrvria....................
Glyma04g36750.1|PACid:16256971  --------------------------------------vsgfngsfafmegwstfslnhgvkvgyl
Glyma18g30700.1|PACid:16309437  --------------------------------------flvhifret...................
Glyma11g13230.1|PACid:16283729  --------------------------------------ifcgn.......................
Glyma08g44640.1|PACid:16273838  --------------------------------------cfflqit.....................
Glyma11g13220.3|PACid:16283728  --------------------------------------ifggn.......................
Glyma11g13220.2|PACid:16283727  --------------------------------------ifggn.......................
Glyma11g13220.1|PACid:16283726  --------------------------------------ifggn.......................
Glyma20g24230.1|PACid:16316640  --------------------------------------tsqihvlildhttleihyp.........
Glyma04g43620.1|PACid:16257788  --------------------------------------pavvl.......................
Glyma11g13210.2|PACid:16283725  --------------------------------------dgwkefvqrysigvgyllvfryegkssf
Glyma14g33730.1|PACid:16296329  --------------------------------------aa..........................
Glyma07g19380.1|PACid:16267767  --------------------------------------efakklrldvshfvvfryegnscfnvii
Glyma12g05260.1|PACid:16286479  --------------------------------------ngwslflkdnsvvldefflftyhggncf
Glyma09g20280.1|PACid:16275915  --------------------------------------hdgdiwfqkgwkefatyyslshkylvlf
Glyma10g42790.1|PACid:16281912  --------------------------------------llllpkgaewnvkwkkldadiwlidewk
Glyma02g40280.1|PACid:16249662  --------------------------------------kfvm........................
Glyma10g42780.1|PACid:16281911  --------------------------------------vvlvlpngaewkvnwkrldldvwlidew
Glyma14g06030.1|PACid:16294527  --------------------------------------egwkvfqeenflgkedylvfkydganif
Glyma20g24210.1|PACid:16316638  --------------------------------------wkkldadilliedwkefaefcsldkdhl
Glyma10g17480.1|PACid:16279604  --------------------------------------g...........................
Glyma19g27340.1|PACid:16312971  --------------------------------------iq..........................
Glyma04g16680.1|PACid:16256057  --------------------------------------lqkndvvtvwifrhsks...........
Glyma20g24220.1|PACid:16316639  --------------------------------------vkwkkldvdvwliddwkefadfccldqd
Glyma07g35040.1|PACid:16268769  --------------------------------------kkvile......................
Glyma09g18790.1|PACid:16275874  --------------------------------------wkeyatyygldhghllffeyegtshfnv
Glyma04g24640.1|PACid:16256300  --------------------------------------vfnfcvl.....................
Glyma02g46090.1|PACid:16250356  --------------------------------------hlwsfrlssqlcfa..............
Glyma17g36490.1|PACid:16307246  --------------------------------------pagqmnntfvi.................
Glyma06g04190.1|PACid:16261657  --------------------------------------ktglrggwkgfavahdladrdafsflll
Glyma18g22670.1|PACid:16309256  --------------------------------------vfnfcvl.....................
Glyma06g23040.1|PACid:16263861  --------------------------------------vfnfcvl.....................
Glyma19g27950.1|PACid:16313030  --------------------------------------idgtklt.....................
Glyma20g24220.1|PACid:16316639  --------------------------------------qikkpgisfrvvifr.............
Glyma14g02670.1|PACid:16294117  --------------------------------------cfynltngwnqivlqndlklhdilqlws
Glyma14g08630.1|PACid:16294854  --------------------------------------pagqin......................
Glyma14g38490.1|PACid:16296832  --------------------------------------nnsrmyvlegvtpciqamqlnavtfsri
Glyma08g01100.3|PACid:16269528  G-------------NVPSSVISSHSMHLGVLATAWH--a...........................
Glyma08g44650.1|PACid:16273839  --------------------------------------kendlkegdac.................
Glyma11g05870.1|PACid:16282832  --------------------------------------nsivstnkfeedqelqiwsfrvgsklyl
Glyma10g20520.1|PACid:16279688  --------------------------------------k...........................
Glyma04g36750.1|PACid:16256971  --------------------------------------heqprllthgwldfsranniqpedecif
Glyma11g13200.1|PACid:16283722  ------------------------D-------------yriyikgwdsfcrrneierddtcfcevi
Glyma11g13200.2|PACid:16283723  ------------------------D-------------yriyikgwdsfcrrneierddtcfcevi
Glyma11g31270.1|PACid:16285031  --------------------------------------ka..........................
Glyma03g25330.1|PACid:16252303  --------------------------------------nsivstnkfeedq...............
Glyma01g05030.1|PACid:16243455  --------------------------------------sfregamfva..................
Glyma01g28050.1|PACid:16244626  --------------------------------------frfsftllrvcr................
Glyma01g28030.1|PACid:16244624  --------------------------------------sfrfsftllrvcr...............
Glyma01g39390.1|PACid:16245710  --------------------------------------sfregamfva..................
Glyma01g28020.1|PACid:16244623  --------------------------------------sfridnkglgvfcl..............
Glyma01g28040.1|PACid:16244625  --------------------------------------iwsfrgfgv...................
Glyma11g13350.1|PACid:16283742  --------------------------------------asfskrnkierndtcfcevisgedqvvr
Glyma09g15670.1|PACid:16275699  --------------------------------------d...........................


                                                                   
                                                                   
d1na6a1                           .................................
Glyma02g40650.2|PACid:16249708  .................................
Glyma02g40650.1|PACid:16249707  .................................
Glyma14g38940.1|PACid:16296878  .................................
Glyma11g31940.1|PACid:16285100  .................................
Glyma02g45100.1|PACid:16250234  .................................
Glyma13g29320.2|PACid:16291979  .................................
Glyma13g29320.1|PACid:16291978  .................................
Glyma05g27580.1|PACid:16259834  .................................
Glyma08g10550.1|PACid:16270663  .................................
Glyma08g10550.2|PACid:16270664  .................................
Glyma18g05330.1|PACid:16307991  .................................
Glyma14g03650.2|PACid:16294247  .................................
Glyma14g03650.1|PACid:16294246  .................................
Glyma15g09750.1|PACid:16298234  .................................
Glyma17g37580.1|PACid:16307359  .................................
Glyma14g40540.1|PACid:16297069  .................................
Glyma11g15910.1|PACid:16284061  .................................
Glyma12g07560.1|PACid:16286759  .................................
Glyma09g08350.1|PACid:16275193  .................................
Glyma15g19980.1|PACid:16299380  .................................
Glyma12g29280.2|PACid:16288274  .................................
Glyma12g29280.3|PACid:16288275  .................................
Glyma12g29280.1|PACid:16288273  .................................
Glyma12g28550.1|PACid:16288180  .................................
Glyma17g05220.1|PACid:16304477  .................................
Glyma07g32300.1|PACid:16268480  .................................
Glyma13g24240.1|PACid:16291395  .................................
Glyma01g00510.1|PACid:16242917  .................................
Glyma13g30750.2|PACid:16292147  .................................
Glyma15g08540.1|PACid:16298095  .................................
Glyma07g15640.2|PACid:16267394  .................................
Glyma07g15640.1|PACid:16267393  .................................
Glyma05g36430.1|PACid:16260906  .................................
Glyma16g02650.1|PACid:16301238  .................................
Glyma07g06060.1|PACid:16266361  .................................
Glyma16g00220.1|PACid:16300944  .................................
Glyma05g38540.3|PACid:16261170  .................................
Glyma05g38540.1|PACid:16261168  .................................
Glyma05g38540.2|PACid:16261169  .................................
Glyma08g03140.1|PACid:16269782  .................................
Glyma08g03140.2|PACid:16269783  .................................
Glyma07g40270.1|PACid:16269382  .................................
Glyma08g01100.2|PACid:16269527  .................................
Glyma13g17270.1|PACid:16290589  .................................
Glyma08g01100.1|PACid:16269526  .................................
Glyma03g41920.1|PACid:16254194  .................................
Glyma06g17320.2|PACid:16263271  .................................
Glyma04g37760.1|PACid:16257086  .................................
Glyma06g17320.1|PACid:16263270  .................................
Glyma01g25270.3|PACid:16244440  .................................
Glyma01g25270.1|PACid:16244438  .................................
Glyma01g25270.2|PACid:16244439  .................................
Glyma18g40180.1|PACid:16310033  .................................
Glyma07g16170.1|PACid:16267457  .................................
Glyma03g17450.1|PACid:16251876  .................................
Glyma13g40310.1|PACid:16293267  .................................
Glyma03g36710.1|PACid:16253571  .................................
Glyma19g39340.1|PACid:16314303  .................................
Glyma10g08860.1|PACid:16279028  .................................
Glyma03g35700.1|PACid:16253450  .................................
Glyma02g36090.1|PACid:16249204  .................................
Glyma19g38340.1|PACid:16314191  .................................
Glyma16g01950.1|PACid:16301154  .................................
Glyma12g08110.1|PACid:16286827  .................................
Glyma19g45090.1|PACid:16314994  .................................
Glyma11g20490.1|PACid:16284466  .................................
Glyma04g43350.1|PACid:16257749  .................................
Glyma07g05380.1|PACid:16266276  .................................
Glyma01g22260.1|PACid:16244231  .................................
Glyma13g02410.1|PACid:16289434  .................................
Glyma13g40030.1|PACid:16293233  .................................
Glyma12g29720.1|PACid:16288327  .................................
Glyma03g42300.1|PACid:16254247  .................................
Glyma10g06080.1|PACid:16278741  .................................
Glyma13g20370.1|PACid:16290957  .................................
Glyma13g20370.2|PACid:16290958  .................................
Glyma20g32040.1|PACid:16317570  .................................
Glyma20g32730.1|PACid:16317646  .................................
Glyma10g34760.1|PACid:16280958  .................................
Glyma02g11060.1|PACid:16247693  .................................
Glyma08g44640.1|PACid:16273838  .................................
Glyma20g39140.1|PACid:16318372  .................................
Glyma13g30750.1|PACid:16292146  .................................
Glyma18g30690.1|PACid:16309436  .................................
Glyma16g05110.1|PACid:16301538  .................................
Glyma19g27950.1|PACid:16313030  .................................
Glyma12g05250.2|PACid:16286476  .................................
Glyma12g05250.1|PACid:16286475  .................................
Glyma20g01130.1|PACid:16315121  .................................
Glyma07g21160.1|PACid:16267883  .................................
Glyma11g13210.1|PACid:16283724  vgyllvfryegkssfnvhifn............
Glyma11g13210.2|PACid:16283725  .................................
Glyma11g13210.1|PACid:16283724  .................................
Glyma20g01130.1|PACid:16315121  ssfivhifnl.......................
Glyma07g21160.1|PACid:16267883  sfivhifnl........................
Glyma17g36470.1|PACid:16307244  .................................
Glyma04g04030.1|PACid:16254791  .................................
Glyma18g38490.1|PACid:16309902  .................................
Glyma06g04200.1|PACid:16261660  .................................
Glyma08g47240.1|PACid:16274136  .................................
Glyma14g08640.1|PACid:16294855  .................................
Glyma09g18790.1|PACid:16275874  .................................
Glyma12g05250.4|PACid:16286478  igyllvfkyegkssfsvhifn............
Glyma12g05250.3|PACid:16286477  igyllvfkyegkssfsvhifn............
Glyma12g05250.1|PACid:16286475  igyllvfkyegkssfsvhifn............
Glyma12g05250.2|PACid:16286476  igyllvfkyegkssfsvhifn............
Glyma01g45640.1|PACid:16246437  fhlvqpskfrvyiirs.................
Glyma01g11670.1|PACid:16243981  lfryqrtshfqvhifdgs...............
Glyma16g05110.1|PACid:16301538  .................................
Glyma02g40400.1|PACid:16249676  .................................
Glyma17g36470.1|PACid:16307244  .................................
Glyma09g20060.1|PACid:16275911  egtshfdvhifdss...................
Glyma11g13220.2|PACid:16283727  .................................
Glyma11g13220.1|PACid:16283726  .................................
Glyma17g20180.1|PACid:16306128  .................................
Glyma17g36490.1|PACid:16307246  .................................
Glyma03g40650.1|PACid:16254040  .................................
Glyma18g05840.1|PACid:16308040  .................................
Glyma16g05480.1|PACid:16301580  .................................
Glyma09g20060.1|PACid:16275911  .................................
Glyma15g07350.1|PACid:16297945  .................................
Glyma13g31970.1|PACid:16292309  .................................
Glyma06g11320.1|PACid:16262536  .................................
Glyma14g08630.1|PACid:16294854  fkynggs..........................
Glyma04g43620.1|PACid:16257788  t................................
Glyma08g44650.1|PACid:16273839  vficdm...........................
Glyma12g05240.1|PACid:16286473  .................................
Glyma12g05240.2|PACid:16286474  .................................
Glyma01g32810.1|PACid:16244986  .................................
Glyma11g13350.1|PACid:16283742  .................................
Glyma03g04330.1|PACid:16251084  .................................
Glyma20g04730.1|PACid:16315501  .................................
Glyma14g08640.1|PACid:16294855  .................................
Glyma04g36750.1|PACid:16256971  lvfnyvkdlhfdvkiydpsac............
Glyma18g30700.1|PACid:16309437  .................................
Glyma11g13230.1|PACid:16283729  .................................
Glyma08g44640.1|PACid:16273838  .................................
Glyma11g13220.3|PACid:16283728  .................................
Glyma11g13220.2|PACid:16283727  .................................
Glyma11g13220.1|PACid:16283726  .................................
Glyma20g24230.1|PACid:16316640  .................................
Glyma04g43620.1|PACid:16257788  .................................
Glyma11g13210.2|PACid:16283725  nvhifn...........................
Glyma14g33730.1|PACid:16296329  .................................
Glyma07g19380.1|PACid:16267767  fgksaleveyp......................
Glyma12g05260.1|PACid:16286479  hvqifggn.........................
Glyma09g20280.1|PACid:16275915  kyqetshlevhifdqs.................
Glyma10g42790.1|PACid:16281912  kfaefcsldqehllvfkyvgksrfqvvtfdqn.
Glyma02g40280.1|PACid:16249662  .................................
Glyma10g42780.1|PACid:16281911  kkfaqvlsldkdhlmvfryvgnsqfqvvildqs
Glyma14g06030.1|PACid:16294527  kvvileq..........................
Glyma20g24210.1|PACid:16316638  lvfeylrksqflvvifdqnglemeyp.......
Glyma10g17480.1|PACid:16279604  .................................
Glyma19g27340.1|PACid:16312971  .................................
Glyma04g16680.1|PACid:16256057  .................................
Glyma20g24220.1|PACid:16316639  hllvfkymgksrfqvvifyqnglemqyp.....
Glyma07g35040.1|PACid:16268769  .................................
Glyma09g18790.1|PACid:16275874  hifdts...........................
Glyma04g24640.1|PACid:16256300  .................................
Glyma02g46090.1|PACid:16250356  .................................
Glyma17g36490.1|PACid:16307246  .................................
Glyma06g04190.1|PACid:16261657  ptdsfclniaifc....................
Glyma18g22670.1|PACid:16309256  .................................
Glyma06g23040.1|PACid:16263861  .................................
Glyma19g27950.1|PACid:16313030  .................................
Glyma20g24220.1|PACid:16316639  .................................
Glyma14g02670.1|PACid:16294117  frvssylwfalv.....................
Glyma14g08630.1|PACid:16294854  .................................
Glyma14g38490.1|PACid:16296832  dpggkfvmgyrr.....................
Glyma08g01100.3|PACid:16269528  .................................
Glyma08g44650.1|PACid:16273839  .................................
Glyma11g05870.1|PACid:16282832  .................................
Glyma10g20520.1|PACid:16279688  .................................
Glyma04g36750.1|PACid:16256971  evepd............................
Glyma11g13200.1|PACid:16283722  sgeeqgvrtlrvhv...................
Glyma11g13200.2|PACid:16283723  sgeeqgvrtlrvhv...................
Glyma11g31270.1|PACid:16285031  .................................
Glyma03g25330.1|PACid:16252303  .................................
Glyma01g05030.1|PACid:16243455  .................................
Glyma01g28050.1|PACid:16244626  .................................
Glyma01g28030.1|PACid:16244624  .................................
Glyma01g39390.1|PACid:16245710  .................................
Glyma01g28020.1|PACid:16244623  .................................
Glyma01g28040.1|PACid:16244625  .................................
Glyma11g13350.1|PACid:16283742  tlevh............................
Glyma09g15670.1|PACid:16275699  .................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048310 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Eubacterium rectale ATCC 33656
NoYes   Bacteroides fragilis YCH46
NoYes   Treponema succinifaciens DSM 2489
NoYes   Geobacter lovleyi SZ
NoYes   Thauera sp. MZ1T
NoYes   Acidiphilium cryptum JF-5
NoYes   Edwardsiella ictaluri 93-146
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Serratia proteamaculans 568
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Taylorella equigenitalis 14/56
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli IAI39
NoYes   Pseudomonas putida GB-1
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]