SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Hypothetical protein MPN330 alignments

These alignments are sequences aligned to the 0049596 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                10        20        30        40        50        60        70        80        90  
                 |         |         |         |         |         |         |         |         |  
d1td6a_ PNQFVNHLSALKKHFASYKELREAFNDYHKHNGDELTTFFLHQFDKVMELVKQKDFKTAQSRCEEELAAPYLPKPLVSFFQSLLQLVNHDLL


             100       110       120       130       140       150       160       170       180    
               |         |         |         |         |         |         |         |         |    
d1td6a_ EQQNAALASLPAAKIIELVLQDYPNKLNMIHYLLPKTKAFVKPHLLQRLQFVLTDSELLELKRFSFFQALNQIPGFQGEQVEYFNSKLKQKF


           190       200       210       220       230       240       250       260       270      
             |         |         |         |         |         |         |         |         |      
d1td6a_ TLTLGEFEIAQQPDAKAYFEQLITQIQQLFLKEPVNAEFANEIIDAFLVSYFPLHPPVPLAQLAAKIYEYVSQIVLNEAVNLKDELIKLIVH


         280       
           |       
d1td6a_ TLYEQLDRP-v


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0049596 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma putrefaciens KS1
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Leuconostoc citreum KM20
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Geobacillus sp. JF8
NoYes   Rickettsia akari str. Hartford
NoYes   Mesoplasma florum W37
NoYes   Spiroplasma syrphidicola EA-1
NoYes   Spiroplasma diminutum CUAS-1
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Spiroplasma taiwanense CT-1
NoYes   Spiroplasma apis B31
NoYes   Ureaplasma parvum serovar 3 str. ATCC 700970
NoYes   Mycoplasma leachii PG50
NoYes   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale
NoYes   Mycoplasma mycoides subsp. mycoides SC str. PG1
NoYes   Mycoplasma putrefaciens Mput9231
NoYes   Mycoplasma pneumoniae M129-B7
NoYes   Mycoplasma pneumoniae FH
NoYes   Mycoplasma pneumoniae M129
NoYes   Mycoplasma genitalium M2321
NoYes   Mycoplasma genitalium M2288
NoYes   Mycoplasma genitalium M6282
NoYes   Mycoplasma genitalium M6320
NoYes   Mycoplasma gallisepticum NC08_2008.031-4-3P
NoYes   Mycoplasma gallisepticum CA06_2006.052-5-2P
NoYes   Mycoplasma gallisepticum NC06_2006.080-5-2P
NoYes   Mycoplasma gallisepticum WI01_2001.043-13-2P
NoYes   Mycoplasma gallisepticum NY01_2001.047-5-1P
NoYes   Mycoplasma gallisepticum NC96_1596-4-2P
NoYes   Mycoplasma gallisepticum NC95_13295-2-2P
NoYes   Mycoplasma gallisepticum VA94_7994-1-7P
NoYes   Mycoplasma gallisepticum S6
NoYes   Mycoplasma gallisepticum str. R(high)
NoYes   Mycoplasma gallisepticum str. R(low)
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Bacillus coagulans 36D1
NoYes   Rickettsia massiliae str. AZT80
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]