SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


EspE N-terminal domain-like alignments

These alignments are sequences aligned to the 0053745 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2bh1x1 ....................................................................................i-RRLPFS
d2d28c1 meqrsaetriveallerrrlkdtdlvrarqlqaesgmgllallgrlglvserdhaetcaevlglplvdarqlgdtppemlpevqg---LSLR


         10        20        30        40        50        60         
          |         |         |         |         |         |         
d2bh1x1 FANRFKLVLDWNEDFSQASIYYLAPLSMEALVETKRVVKHAFQLIELSQAEFESKLTQVYQ.
d2d28c1 FLKQFHLCPV-GERDGRLDLWIADPYDDYAIDAVRLATGLPLLLHVGLRSEIDDLIERWY-g


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053745 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Phytophthora capsici
NoYes   Vibrio cholerae O395
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xylella fastidiosa subsp. fastidiosa GB514
NoYes   Xylella fastidiosa M12
NoYes   Xylella fastidiosa Temecula1
NoYes   Xylella fastidiosa 9a5c
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Combined (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]