SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


BB2672-like alignments

These alignments are sequences aligned to the 0054631 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                   10        20        30        40        50        60        70        80        9
                    |         |         |         |         |         |         |         |         
d2qtpa1 ...KIRKIAVFIEETRIEAGREISPPTRKAVAVAVIENPFAGRYVEDLTELMDTGAELGALLGERCVQALGIRPEQAESYGKSAMVGENGEL
d3byqa1 sliEIRKRTLIVETTYHENGPAPAQPLKLAASCAVIRNPYAGRYEPDLMPFMAELRSLGTLLATELVDTLG--KDNIEVYSKAAIVGVDGEM


        0       100       110       120       130       140       150       160                     
        |         |         |         |         |         |         |         |                     
d2qtpa1 EHAAAILHPKLGAPLRKAVEKGAALVPSSKKMGSPGQVLDVPLGHKDAAYVRSHFDGIEVRLNDAPRANEIMVAVAVTD-s...........
d3byqa1 EHG-AVWHEAGGWAMRSVLGEPKAMVPAVKAVATAGYRMMVPVHYIHASYVRSHFNSIEIGIQDAPRPREILFALVMGTGarvharlggltk


                  
                  
d2qtpa1 ..........
d3byqa1 eavsvhdgqr


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0054631 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Conexibacter woesei DSM 14684
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Pandoraea sp. RB-44
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Methylibium petroleiphilum PM1
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia xenovorans LB400
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Polaromonas sp. JS666
NoYes   Variovorax paradoxus S110
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Collimonas fungivorans Ter331
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Azospirillum sp. B510
NoYes   Acidiphilium multivorum AIU301
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Hyphomicrobium sp. MC1
NoYes   Oligotropha carboxidovorans OM4
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas sp. VLB120
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter sp. ADP1
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Corynebacterium terpenotabidum Y-11
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Bordetella pertussis CS
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Candidatus Pelagibacter ubique HTCC1062
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Mesorhizobium australicum WSM2073
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Serratia marcescens FGI94
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Acinetobacter calcoaceticus ruh2202
NoYes   Acinetobacter baumannii ZW85-1
NoYes   Acinetobacter baumannii TYTH-1
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii BJAB07104
NoYes   Acinetobacter baumannii TCDC-AB0715
NoYes   Acinetobacter baumannii MDR-TJ
NoYes   Acinetobacter baumannii 1656-2
NoYes   Acinetobacter baumannii ATCC 19606
NoYes   Acinetobacter baumannii AB307-0294
NoYes   Acinetobacter baumannii AYE
NoYes   Acinetobacter baumannii MDR-ZJ06
NoYes   Acinetobacter baumannii AB0057
NoYes   Acinetobacter baumannii ACICU
NoYes   Ricinus communis - Castor bean
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]