SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

PSTPO5379-like alignments in Bifidobacterium adolescentis ATCC 15703

These alignments are sequences aligned to the 0054510 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                               10        20        30        40        50        60 
                                                |         |         |         |         |         | 
d2pifa1                          arqsai------AAAREARGTYRNGLVTPTAGVAPGMTQANLIALPRDWAYDFLLYAQRNPKACPIL
gi|119025095|ref|YP_908940.1|  .....s-------TPEQARAAFRDGLVRPTCGIAQGYAQANLMILPKEQAFDFLLFAQRNHKPCPLL


                                        70        80        90       100       110       120       1
                                         |         |         |         |         |         |        
d2pifa1                          DVSDAGSPTTLLAEGSDLRTDIPMYRIWRDGKLAEEVSDATQAWAEHDDMVAFLIGCSFTFETPLQE
gi|119025095|ref|YP_908940.1|  EVMEPGVTAPVTAPGADIRTDVPLYRVWKRGELVAEVPDIREYWR--SDLVTFVIGCSFTFEFPLME


                                 30       140       150       160       170       180       190     
                                  |         |         |         |         |         |         |     
d2pifa1                          AGIEVRHITDGCNVPMYRTNRACRPAGRLHGEMVVSMRPIPADRVAEASAISGRYPSVHGAPVHIGE
gi|119025095|ref|YP_908940.1|  AGVPVRHITAGRNVPMYDTSIECRSAGAFHSTMVVSMRGIPSTQVADACRISGYYPSVHGAPVCVGD


                                   200       210       220       230       240       250       
                                     |         |         |         |         |         |       
d2pifa1                          PGRLGINDLSRPDFGDAVSIKPGEVPVFWACGVTPQAAVMASGVPFAITHSPGYMFITDV-p
gi|119025095|ref|YP_908940.1|  PSAIGIDDIMHPDYGDAPVLEPGDVPVFWACGVTPQAAVMASKPEFAITHAPGHMFIT---s


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0054510 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Proterospongia sp. ATCC 50818
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Sphaerobolus stellatus v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe grisea 70-15
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Glomerella graminicola 22
NoYes   Nectria haematococca mpVI
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Mycosphaerella graminicola IPO323
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus flavus NRRL3357
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Pichia membranifaciensv1.0
NoYes   Wickerhamomyces anomalus
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Zygosaccharomyces rouxii
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Aureococcus anophagefferens
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Naegleria gruberi
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Rivularia sp. PCC 7116
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Modestobacter marinus
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Nocardioides sp. JS614
NoYes   Actinoplanes sp. N902-109
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium glutamicum R
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Arthrobacter sp. FB24
NoYes   Micrococcus luteus NCTC 2665
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Solibacillus silvestris StLB046
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Treponema azotonutricium ZAS-9
NoYes   Geobacillus sp. JF8
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Variovorax paradoxus S110
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Pelagibacterium halotolerans B2
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Shewanella woodyi ATCC 51908
NoYes   Marinobacter adhaerens HP15
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas mediterranea MMB-1
NoYes   Providencia stuartii MRSN 2154
NoYes   Escherichia blattae DSM 4481
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Psychrobacter arcticus 273-4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Aspergillus fumigatus A1163
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Mycobacterium gilvum Spyr1
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium urealyticum DSM 7111
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Bifidobacterium longum subsp. longum BBMN68
NoYes   Bifidobacterium thermophilum RBL67
NoYes   Clostridium saccharolyticum Clostridium cf. saccharolyticum K10
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Thermoanaerobacter sp. X513
NoYes   Lactobacillus fermentum F-6
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia solanacearum PSI07
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Bordetella pertussis CS
NoYes   Bordetella parapertussis 18323
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Octadecabacter antarcticus 307
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Candidatus Pelagibacter ubique HTCC1062
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium meliloti Rm41
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Vibrio fischeri ES114
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter genomosp. 13TU RUH2624
NoYes   Acinetobacter sp. SH024
NoYes   Acinetobacter calcoaceticus ruh2202
NoYes   Acinetobacter baumannii ZW85-1
NoYes   Acinetobacter baumannii TYTH-1
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii BJAB0715
NoYes   Acinetobacter baumannii BJAB07104
NoYes   Acinetobacter baumannii TCDC-AB0715
NoYes   Acinetobacter baumannii D1279779
NoYes   Acinetobacter baumannii MDR-TJ
NoYes   Acinetobacter baumannii 1656-2
NoYes   Acinetobacter baumannii ATCC 19606
NoYes   Acinetobacter baumannii AB307-0294
NoYes   Acinetobacter baumannii AYE
NoYes   Acinetobacter baumannii SDF
NoYes   Acinetobacter baumannii MDR-ZJ06
NoYes   Acinetobacter baumannii AB0057
NoYes   Acinetobacter baumannii ACICU
NoYes   Acinetobacter johnsonii SH046
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   1_Upper_euphotic (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]