SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

EF-hand alignments in Meleagris gallopavo 69_2

These alignments are sequences aligned to the 0035583 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  q.............................................................................
ENSMGAP00000010818  ad............................................................................
ENSMGAP00000014820  mgkq..........................................................................
ENSMGAP00000012925  mgkq..........................................................................
ENSMGAP00000006499  msrdaflekaytklklqvtpegriplkniyrlfsadrkrv......................................
ENSMGAP00000006483  vspmtclkkhwmklafltntngkipvrsitrtfasgktekvifqalkelglpsgkndeiepa................
ENSMGAP00000014837  mgkq..........................................................................
ENSMGAP00000007665  phctdyevgqfplrmrdwlknilmqyyerdqdkpgfltekqrnkvkkiylnekrlvsgehpvelllhdfeknyhmyvy
ENSMGAP00000015504  hpkmtelyqsladlnnvrfsayrtamklrrlqkalcldllnlsaacdaldqhnlkqndqpmdilqiinclttiydrle
ENSMGAP00000012038  s.............................................................................
ENSMGAP00000017351  s.............................................................................
ENSMGAP00000005416  mgkhg.........................................................................
ENSMGAP00000010422  r.............................................................................
ENSMGAP00000010973  p.............................................................................
ENSMGAP00000011986  rid...........................................................................
ENSMGAP00000003311  srytflekilvklkmqlnaegkipvrnif.................................................
ENSMGAP00000013173  h.............................................................................
ENSMGAP00000008329  a.............................................................................
ENSMGAP00000001399  saleeafrkfaihgdtratgkemhgknwsk................................................
ENSMGAP00000005345  kp............................................................................
ENSMGAP00000009666  hpkmtelyqtladlnnikfsayrta.....................................................
ENSMGAP00000001336  l.............................................................................
ENSMGAP00000007710  v.............................................................................
ENSMGAP00000011308  ee............................................................................
ENSMGAP00000008667  dp............................................................................
ENSMGAP00000017345  lks...........................................................................
ENSMGAP00000001713  dql...........................................................................
ENSMGAP00000008800  phvdnkdid.....................................................................
ENSMGAP00000017221  eddiep........................................................................
ENSMGAP00000003113  scswihtclrk...................................................................
ENSMGAP00000002095  av............................................................................
ENSMGAP00000003256  wit...........................................................................
ENSMGAP00000005178  y.............................................................................
ENSMGAP00000004306  le............................................................................
ENSMGAP00000003741  lr............................................................................
ENSMGAP00000012748  ptpsp.........................................................................
ENSMGAP00000018907  vdpea.........................................................................
ENSMGAP00000004316  e.............................................................................
ENSMGAP00000004292  e.............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  nmrts.........................................................................
ENSMGAP00000000614  ave...........................................................................
ENSMGAP00000008865  e.............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  p.............................................................................
ENSMGAP00000003121  rts...........................................................................
ENSMGAP00000004318  faiygdtaasgnn.................................................................
ENSMGAP00000002012  tfritkadaaefwrkafgekt.........................................................
ENSMGAP00000014898  qlfmemraqnfdvirlstyrtac.......................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  tpr...........................................................................
ENSMGAP00000000101  swihgmlqr.....................................................................
ENSMGAP00000004099  eftk..........................................................................
ENSMGAP00000011104  qlfaemraqdldrirlstyrtac.......................................................
ENSMGAP00000015217  fritkadaadfwrkffgdkt..........................................................
ENSMGAP00000015504  h.............................................................................
ENSMGAP00000014359  wflniiqddfm...................................................................
ENSMGAP00000001935  vcsdlefreianrlrdwfkalhesgiqnkktrivqrpertrfdtsilpi.............................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  d.............................................................................
ENSMGAP00000009004  r.............................................................................
ENSMGAP00000008132  ctdkelrslasrlkdwfgalhedanrvikptssetaqgrfdtsilp................................
ENSMGAP00000019273  tpi...........................................................................
ENSMGAP00000001471  aa............................................................................
ENSMGAP00000010396  q.............................................................................
ENSMGAP00000005510  dfft..........................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ki............................................................................
ENSMGAP00000012414  gcpdgkkvefitslldalttdmvqainsaaptgggrfsepdpshtl................................
ENSMGAP00000003667  mgnkqti.......................................................................
ENSMGAP00000009666  vkekfqylfsqvanagglcdqrhlgvll..................................................
ENSMGAP00000005687  mgnkqti.......................................................................
ENSMGAP00000011104  k.............................................................................
ENSMGAP00000015388  ppvaewavp.....................................................................
ENSMGAP00000000479  e.............................................................................
ENSMGAP00000013677  dd............................................................................
ENSMGAP00000011946  k.............................................................................
ENSMGAP00000011948  k.............................................................................
ENSMGAP00000015556  ahysdd........................................................................
ENSMGAP00000003279  elksifrlslfipsqefstyr.........................................................
ENSMGAP00000005348  prqkqd........................................................................
ENSMGAP00000012873  rvsepdpnhtle..................................................................
ENSMGAP00000006199  q.............................................................................
ENSMGAP00000014876  nspkiapsdwavpqa...............................................................
ENSMGAP00000007897  t.............................................................................
ENSMGAP00000010932  ichvfst.......................................................................
ENSMGAP00000006099  pte...........................................................................
ENSMGAP00000000986  kqghgl........................................................................
ENSMGAP00000018863  v.............................................................................
ENSMGAP00000010191  a.............................................................................
ENSMGAP00000011498  wvvspadk......................................................................
ENSMGAP00000005636  ethwavr.......................................................................
ENSMGAP00000014876  gpn...........................................................................
ENSMGAP00000013745  q.............................................................................
ENSMGAP00000005636  qpsvnwvvpm....................................................................
ENSMGAP00000019260  sqlegam.......................................................................
ENSMGAP00000010308  sqlegam.......................................................................
ENSMGAP00000015629  eadinql.......................................................................
ENSMGAP00000007270  efaklvrslg....................................................................
ENSMGAP00000015388  ggnqdiwait....................................................................
ENSMGAP00000001784  l.............................................................................
ENSMGAP00000015545  k.............................................................................
ENSMGAP00000010427  a.............................................................................
ENSMGAP00000000998  mselekam......................................................................
ENSMGAP00000012493  se............................................................................
ENSMGAP00000001668  dinq..........................................................................
ENSMGAP00000011498  lsgtassdipwavk................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  eqqiqar.......................................................................
ENSMGAP00000013797  mpsqmeham.....................................................................
ENSMGAP00000000945  iaaalrdcqapdsfspkkffqisgm.....................................................
ENSMGAP00000002904  t.............................................................................
ENSMGAP00000008628  llakyka.......................................................................
ENSMGAP00000014571  wrdilkl.......................................................................
ENSMGAP00000003057  k.............................................................................
ENSMGAP00000010332  el............................................................................
ENSMGAP00000019524  scqaadsfnyksffs...............................................................
ENSMGAP00000005528  rdkpmyd.......................................................................
ENSMGAP00000010575  wl............................................................................
ENSMGAP00000001307  s.............................................................................
ENSMGAP00000017273  pacldteltefplrmrdwlknvlitlyerdedn.............................................
ENSMGAP00000017264  hptgplyc......................................................................
ENSMGAP00000012328  etqiltrd......................................................................
ENSMGAP00000010402  adpa..........................................................................
ENSMGAP00000011891  vvakdkpaydeifytlspi...........................................................
ENSMGAP00000008022  e.............................................................................
ENSMGAP00000011257  lg............................................................................
ENSMGAP00000008628  afndiqssvyrtalklrslqslcqldlinvslvqhivsseqrqrekdislkvqqlsg.....................
ENSMGAP00000012468  enqiltrd......................................................................
ENSMGAP00000010049  hptaplydpeekq.................................................................
ENSMGAP00000010311  lselek........................................................................
ENSMGAP00000013157  esq...........................................................................
ENSMGAP00000006617  ke............................................................................
ENSMGAP00000004752  pleqalav......................................................................
ENSMGAP00000003256  vy............................................................................
ENSMGAP00000010056  dpa...........................................................................
ENSMGAP00000011434  clkkany.......................................................................
ENSMGAP00000006435  v.............................................................................
ENSMGAP00000001668  lpnvctnheeiiarieaaftefe.......................................................
ENSMGAP00000011498  ssanp.........................................................................
ENSMGAP00000004753  ldqaigllvatfhkysgke...........................................................
ENSMGAP00000005636  gip...........................................................................
ENSMGAP00000015905  t.............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  aqlq..........................................................................
ENSMGAP00000007021  kevweeadgldp..................................................................
ENSMGAP00000017212  tlekale.......................................................................
ENSMGAP00000002213  mav...........................................................................
ENSMGAP00000013577  p.............................................................................
ENSMGAP00000000632  shfldsvst.....................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  wrk...........................................................................
ENSMGAP00000004749  telewavqvlvnnfdkyssrcccrkp....................................................
ENSMGAP00000014571  q.............................................................................
ENSMGAP00000014702  wrk...........................................................................
ENSMGAP00000015629  iakiektfsqfpne................................................................
ENSMGAP00000010757  kpesem........................................................................
ENSMGAP00000012156  sklfrn........................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  dqye..........................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  eedsep........................................................................
ENSMGAP00000004752  tdlelalecai...................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  vs............................................................................
ENSMGAP00000002845  t.............................................................................
ENSMGAP00000013352  mtdv..........................................................................
ENSMGAP00000011218  y.............................................................................
ENSMGAP00000008109  q.............................................................................
ENSMGAP00000013184  kfhksfqelqgkhkvcsrislasilndkiailemqkilpfsalslfihiyvy..........................
ENSMGAP00000007241  ta............................................................................
ENSMGAP00000007078  pe............................................................................
ENSMGAP00000016033  gkeklryseffrfmenlqtevqemefiqfskgl.............................................
ENSMGAP00000009321  sdleka........................................................................
ENSMGAP00000011486  nkhir.........................................................................
ENSMGAP00000008771  kral..........................................................................
ENSMGAP00000009284  eledvqve......................................................................
ENSMGAP00000012705  egymfvwngevs..................................................................
ENSMGAP00000008188  t.............................................................................
ENSMGAP00000015472  epr...........................................................................
ENSMGAP00000008783  ckliihlaqlkglqksqilptddyeeamemiei.............................................
ENSMGAP00000001658  skdrnvgekmalrkll..............................................................
ENSMGAP00000012256  dltss.........................................................................
ENSMGAP00000013520  mkviqkylnehnl.................................................................
ENSMGAP00000004374  m.............................................................................
ENSMGAP00000000986  ivvl..........................................................................
ENSMGAP00000001945  ff............................................................................
ENSMGAP00000002062  lteeemyslmetlrqckiipet........................................................
ENSMGAP00000016033  kk............................................................................
ENSMGAP00000012862  vspkpdpktvskh.................................................................
ENSMGAP00000005519  me............................................................................
ENSMGAP00000015047  papgtskqeldeliarvqeelkl.......................................................
ENSMGAP00000005432  qhdilkleferhdpv...............................................................
ENSMGAP00000013736  er............................................................................
ENSMGAP00000011175  si............................................................................
ENSMGAP00000012508  d.............................................................................
ENSMGAP00000008257  idtaklypil....................................................................
ENSMGAP00000013184  hpkmtdlfqsladlnnvrfsayrtaik...................................................
ENSMGAP00000010402  nwdcefi.......................................................................
ENSMGAP00000000248  d.............................................................................
ENSMGAP00000007611  fnfteveeanrilgpiyfttfvffmffillnmflaiindtysevksdmaqqkaemelsdlirkgynkamvklklkktt
ENSMGAP00000005594  ll............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  q.............................................................................
ENSMGAP00000006995  s.............................................................................
ENSMGAP00000003057  de............................................................................
ENSMGAP00000007897  g.............................................................................
ENSMGAP00000004556  k.............................................................................
ENSMGAP00000014571  iektllpryftylgd...............................................................
ENSMGAP00000008494  tdveraietvinqfhcy.............................................................
ENSMGAP00000007615  mrlklkkerisdvqkal.............................................................
ENSMGAP00000003099  er............................................................................
ENSMGAP00000008028  malvap........................................................................
ENSMGAP00000013774  gdsppaa.......................................................................
ENSMGAP00000012335  efra..........................................................................
ENSMGAP00000006327  lyd...........................................................................
ENSMGAP00000013157  eelqnlwflldkhqtspmigee........................................................
ENSMGAP00000015686  kq............................................................................
ENSMGAP00000006220  kaalatqfkewttdvsgripvaliqsalkifldfllaacerkleitdmwgenvnadefiecvhsytenfpndafqevl
ENSMGAP00000007527  s.............................................................................
ENSMGAP00000012156  dttl..........................................................................
ENSMGAP00000004008  nr............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  pv............................................................................
ENSMGAP00000015504  qehnnl........................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  vddi..........................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  khlsqctadfqeairsdtcrqmfidlflhcdrgqvgvldrpqilglleqfyerssvcarrrfcnpkewpivdlqevsl
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  edlwgdledledyeeprevlglsqpeisegealarepagvnrqgsdgtstivrglveqmdvsetetggipkeenqaae
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  sggaeieyteaqcvhrgrreeaedetesdkqagdqnapeatnkmskdkavadtdviaskqdimaaeameepperkegl
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  trqhsnwseqqtssgtalqdkdrlqepdqlqehitagpalsdgpgsaaadsqereepwpgtarvrsshlhsvcvcnss
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  hkscilglfinllslqavfclssgdllpfdlsyrhgshgekipedwgcenrfpgiwpqscaftehtvtgrgcgcaavq
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  hsrqlavthgahclsdlrptmadiqsrsaarvgspfdgsclnlprfaqlmetflgegialpavkgliafikeeykqte
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                          10        20         30                                   
                                           |         |          |                                   
d1bjfa_               ............NSKLRPEVMQDLLESTDFTEHEIQE.WYKGF...........LRDCP.S.................
ENSMGAP00000013771  ............-----------------LTEEQIAE.FKEAFsl.........FDKDG.D.................
ENSMGAP00000010818  ............----------------QLTEEQIAE.FKEAFsl.........FDKDG.D.................
ENSMGAP00000014820  ............NSKLRPEVLQDLRENTEFTDHELQE.WYKGF...........LKDCP.T.................
ENSMGAP00000012925  ............NSKLRPEVMQDLLESTDFTEHEIQE.WYKGF...........LRDCP.S.................
ENSMGAP00000006499  ............-------------------------.-----...........-----.-.................
ENSMGAP00000006483  ............-------------------------.-----...........-----.-.................
ENSMGAP00000014837  ............NSKLAPEVMEDLVKSTEFNEHELKQ.WYKGF...........LKDCP.S.................
ENSMGAP00000007665  ............-------------------------.-----...........-----.-.................
ENSMGAP00000015504  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012038  ............--------------------EEETQ.FRNIFr..........QIAGD.D.................
ENSMGAP00000017351  ............--------------------EEETQ.FRNIFr..........QIAGD.D.................
ENSMGAP00000005416  ............-SKLAPEMLDDLVRSTEFSEQELKQ.WYKGF...........LKDCP.S.................
ENSMGAP00000010422  ............-----PEGLEQLQEQTKFTRKELQV.LYRGF...........KNECP.S.................
ENSMGAP00000010973  ............----------------ELTEEQKQE.IREAFdl.........FDTDG.S.................
ENSMGAP00000011986  ............-----------------------QW.IRDWFqk.........ADKNK.D.................
ENSMGAP00000003311  ............-------------------------.-----...........-----.-.................
ENSMGAP00000013173  ............----RPEALELLEAQSKFTKKELQI.LYRGF...........KNECP.S.................
ENSMGAP00000008329  ............----------------FLSEEMIAE.FKAAFdm.........FDADG.G.................
ENSMGAP00000001399  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005345  ............----------------ELTEEQKQE.IREAFdl.........FDTDG.T.................
ENSMGAP00000009666  ............------MKLRRVQKALRLDMVTLAT.ALEIFne.........HDLQPsD.................
ENSMGAP00000001336  ............---------EQLEAQTNFTKRELQV.LYRGF...........KNECP.S.................
ENSMGAP00000007710  ............-------------------------.-----...........-DKDR.S.................
ENSMGAP00000011308  ............-----------------ITEDDIEDgFKSMFq..........QLAGE.D.................
ENSMGAP00000008667  ............-------------------------.LYGYFa..........AVAGQ.D.................
ENSMGAP00000017345  ............------------------------W.VKQTFee.........ADKNG.D.................
ENSMGAP00000001713  ............------------------------W.LKQTFde.........ADKNG.D.................
ENSMGAP00000008800  ............-----------------------DE.FKTLFq..........KLSGE.D.................
ENSMGAP00000017221  ............------------------------S.FKKLFg..........QLAGS.D.................
ENSMGAP00000003113  ............-------------------------.-----...........ADKNK.D.................
ENSMGAP00000002095  ............---------------------EIHH.WYKKF...........MTECP.S.................
ENSMGAP00000003256  ............---LSPAEFAQLQQYTDYSTKKLKD.VLEEFhgdgvl.....SRYNP.E.................
ENSMGAP00000005178  ............-------------------------.--KGF...........IKDCP.S.................
ENSMGAP00000004306  ............-------------MCSHFDADEIKR.LGKRFkk.........LDLDN.S.................
ENSMGAP00000003741  ............-------------------PEEIEE.LKQAFke.........FDKDR.D.................
ENSMGAP00000012748  ............-----------------QETEEEKQ.FRALFe..........QISGK.D.................
ENSMGAP00000018907  ............-------------------------.-FSWFqa.........VDADR.S.................
ENSMGAP00000004316  ............-----------------LSATECHQ.WYKKF...........MTECP.S.................
ENSMGAP00000004292  ............--------------QTEIDVAELQE.WYKKF...........VVECP.S.................
ENSMGAP00000018253  ............-----------------FDQSQIQE.FKEAFnm.........IDQNR.D.................
ENSMGAP00000011383  ............------------------------W.LSQMFse.........SDVDN.L.................
ENSMGAP00000000614  ............----------------QLTEEQKNE.FKAAFdif........VLGAE.D.................
ENSMGAP00000008865  ............-----------------LRPEEIEE.LREAFke.........FDKDK.D.................
ENSMGAP00000009812  ............-----------------FDQSQIQE.FKEAFnm.........IDQNR.D.................
ENSMGAP00000015231  ............---------------------EMHH.YYSKF...........MRECP.S.................
ENSMGAP00000003121  ............------------------------W.ISSVFdl.........ADLEK.C.................
ENSMGAP00000004318  ............-------------------------.-----...........-----.-.................
ENSMGAP00000002012  ............-------------------------.-----...........-----.-.................
ENSMGAP00000014898  ............-------KLRFVQKRCNLHLVDIWN.MIEAFrdngl......NTLDH.N.................
ENSMGAP00000003792  ............-----------------FSKEQQDD.FKEAFll.........FDKTG.D.................
ENSMGAP00000007259  ............----------------------FAW.LKTVFea.........ADVDG.N.................
ENSMGAP00000000101  ............-------------------------.-----...........ADKDK.D.................
ENSMGAP00000004099  ............-----------ISKKLNLKWNHVRE.QLDTFaai........ASASK.G.................
ENSMGAP00000011104  ............-------KLRFVQKKCNLHLVDIWN.VIEALrenal......NNLDP.S.................
ENSMGAP00000015217  ............-------------------------.-----...........-----.-.................
ENSMGAP00000015504  ............-------------------------.-----...........-----.-.................
ENSMGAP00000014359  ............-------------------------.-----...........-----.N.................
ENSMGAP00000001935  ............-------------------------.-----...........-----.-.................
ENSMGAP00000003079  ............-----------------FEQTQIQE.FKEAFti.........MDQNR.D.................
ENSMGAP00000002363  ............-----------------FTPDQIEE.FKEAFsl.........FDRTP.K.................
ENSMGAP00000011677  ............------EEIEEIKKETGFSHSQITR.LYSRFts.........LDKGE.N.................
ENSMGAP00000009004  ............--------------------DEVEC.LIRLFdtl........MSASH.S.................
ENSMGAP00000008132  ............-------------------------.-----...........-----.-.................
ENSMGAP00000019273  ............-----------------------QE.LEESFrkfaiy.....GDTKA.T.................
ENSMGAP00000001471  ............--------------------EQIEE.FKEAFsl.........FDRTP.T.................
ENSMGAP00000010396  ............--------------------NHRAE.FKECFsl.........YDKNH.K.................
ENSMGAP00000005510  ............-------------------------.--KHFe..........QVVSQ.N.................
ENSMGAP00000005093  ............-----------------FEQAQIQE.FKEAFti.........MDQNR.D.................
ENSMGAP00000014898  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012414  ............---------------------EERV.VHWYFsq.........LDNNS.S.................
ENSMGAP00000003667  ............---FTDEQLDAYQDCTFFTRKEILR.LHGRYhemapnvvpmdYTKDP.D.................
ENSMGAP00000009666  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005687  ............---FTPEQLDAYQDCTFFTRKEILR.LFYRYrdlapqlvpldYTSRP.D.................
ENSMGAP00000011104  ............-------------------------.-----...........-----.-.................
ENSMGAP00000015388  ............-------------------------.-----...........-----.-.................
ENSMGAP00000000479  ............-------------------------.-----...........-----.-.................
ENSMGAP00000013677  ............--------------PWKITDEQRQY.YVNQFkt.........IQPDL.N.................
ENSMGAP00000011946  ............------------------------K.ITEAFev.........FDRDG.N.................
ENSMGAP00000011948  ............------------------------K.ITEAFev.........FDRDG.N.................
ENSMGAP00000015556  ............--------------PWRITEEQRDY.YVNQFks.........LQPDL.N.................
ENSMGAP00000003279  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005348  ............-----------------------SS.YKAIFl..........KYAKQ.G.................
ENSMGAP00000012873  ............-------------------------.-----...........-----.-.................
ENSMGAP00000006199  ............-------------------------.-----...........-----.-.................
ENSMGAP00000014876  ............-------------------------.-----...........-----.-.................
ENSMGAP00000007897  ............-----PTFYQTLAGVTHLEESDIID.LEKRYwll........KAQSR.T.................
ENSMGAP00000010932  ............-------------------------.-----...........-----.-.................
ENSMGAP00000006099  ............------------------TERCIES.LLAVFqry........AGREG.D.................
ENSMGAP00000000986  ............-------------------------.-----...........-----.-.................
ENSMGAP00000018863  ............-------------------------.-----...........-----.-.................
ENSMGAP00000010191  ............-------------------------.LISAFkl.........YDKDN.T.................
ENSMGAP00000011498  ............-----------------------I-.-----...........-----.-.................
ENSMGAP00000005636  ............-------------------VEEKAK.FDGIFe..........SLLPV.N.................
ENSMGAP00000014876  ............--------------IWAITAEERAK.HDKQFd..........SLKPT.G.................
ENSMGAP00000013745  ............-------------------------.---VFev.........CDEGN.K.................
ENSMGAP00000005636  ............-------------------------.-----...........-----.-.................
ENSMGAP00000019260  ............-----------------------ET.LINVFh..........HYSGK.E.................
ENSMGAP00000010308  ............-----------------------ET.LINVFh..........HYSGK.E.................
ENSMGAP00000015629  ............--------------TEYFSYEHFYV.IYCKFwe.........LDTDH.D.................
ENSMGAP00000007270  ............-----------------LKPETLED.DLNKYatr........AMKMK.K.................
ENSMGAP00000015388  ............--------------------EERAK.HDQQFh..........SLKPT.S.................
ENSMGAP00000001784  ............-----------------------AE.IREAFrv.........LDRDG.N.................
ENSMGAP00000015545  ............-----------------------QK.LMDTFak.........YDCNN.T.................
ENSMGAP00000010427  ............-------------------------.-----...........-----.-.................
ENSMGAP00000000998  ............-----------------------IA.IIDAFh..........QYSGK.E.................
ENSMGAP00000012493  ............------------------------D.FMQTWrk.........YDSDH.S.................
ENSMGAP00000001668  ............-------------ITDYFSYEHFYV.IYCKFwe.........LDTDH.D.................
ENSMGAP00000011498  ............-------------------LEDKAK.YDAIFd..........SLNPV.N.................
ENSMGAP00000010185  ............------------------------E.IREAFkv.........FDRDG.N.................
ENSMGAP00000017513  ............-------------NTTGVTEEALKE.FSMMFkh.........FDKDK.S.................
ENSMGAP00000013797  ............-----------------------ET.LMFTFh..........KYAGD.K.................
ENSMGAP00000000945  ............-------------------------.-----...........-----.-.................
ENSMGAP00000002904  ............-------------------QEVLDN.LKDRWyqa........DNPPP.D.................
ENSMGAP00000008628  ............-------------------------.----Ffe.........FYAVP.D.................
ENSMGAP00000014571  ............-------------------------.----Cqe.........KDVSK.I.................
ENSMGAP00000003057  ............-------------------------.--KRFek.........ANRDD.D.................
ENSMGAP00000010332  ............---------RALGEQHSFTSEQIEQ.LHRRFk..........QLSHN.R.................
ENSMGAP00000019524  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005528  ............-------------------------.--EIFy..........TLSPV.D.................
ENSMGAP00000010575  ............-----------------------RW.VTERFq..........SIAGQ.G.................
ENSMGAP00000001307  ............------------------------E.FMEAWrr.........YDTDR.S.................
ENSMGAP00000017273  ............-------------------------.-----...........-----.-.................
ENSMGAP00000017264  ............------------PEEKEMKPACIKA.LTRIFri.........SDQDN.D.................
ENSMGAP00000012328  ............--------------AKGITQEQMND.FRASFnh.........FDRRK.N.................
ENSMGAP00000010402  ............------------------------E.LRSIFlqyas......VEKDG.E.................
ENSMGAP00000011891  ............-------------------------.-----...........-----.N.................
ENSMGAP00000008022  ............-------------------------.FMRIWrs.........YDADS.S.................
ENSMGAP00000011257  ............-------------------------.--KYFrh.........IDKNG.N.................
ENSMGAP00000008628  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012468  ............--------------AKGISQEQMNE.FRASFnh.........FDRDH.S.................
ENSMGAP00000010049  ............-----------------LRPACSRA.LTRIFnl.........SDQDN.N.................
ENSMGAP00000010311  ............---------------------AIDV.IIDVFhqfs.......RREGD.K.................
ENSMGAP00000013157  ............-------------ETNWFSAPSALR.VYGQYln.........LDKDH.N.................
ENSMGAP00000006617  ............---------------RELSPEELDE.LLDAFke.........FDTDQ.D.................
ENSMGAP00000004752  ............-------------------------.MVSTFh..........KYSGK.E.................
ENSMGAP00000003256  ............-------------------------.-----...........-----.-.................
ENSMGAP00000010056  ............------------------------E.LKTIFlkyas......VEKNG.E.................
ENSMGAP00000011434  ............-------------------------.-----...........-----.-.................
ENSMGAP00000006435  ............---------------TTISREELEE.LREAFnk.........IDIDN.S.................
ENSMGAP00000001668  ............-------------------------.-----...........-----.D.................
ENSMGAP00000011498  ............-------------------------.VYEKFyrq........VDSAN.T.................
ENSMGAP00000004753  ............-------------------------.-----...........---GD.K.................
ENSMGAP00000005636  ............-------------------------.LYETYykq........VDPTY.T.................
ENSMGAP00000015905  ............---------------AHFSEEEMAE.LREAFsk.........VDVCG.N.................
ENSMGAP00000019081  ............-------------------------.-----...........-----.-.................
ENSMGAP00000000625  ............--------------------ENING.IITTFyty........ASSDG.D.................
ENSMGAP00000007021  ............-------------------------.-----...........-----.-.................
ENSMGAP00000017212  ............------------------------S.IVNIFhqys.......IREGQ.L.................
ENSMGAP00000002213  ............--------------TMQISKDELEE.LKEAFak.........VDLNS.N.................
ENSMGAP00000013577  ............--------------------SDIER.YKKRFhm.........FDKDK.K.................
ENSMGAP00000000632  ............-------------------------.IITVFhqh........AKEDG.D.................
ENSMGAP00000005432  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005269  ............-------------------------.-----...........-----.-.................
ENSMGAP00000004749  ............-------------------------.-----...........-----.-.................
ENSMGAP00000014571  ............------------------------D.FKKAFhk.........MDKNN.D.................
ENSMGAP00000014702  ............-------------------------.-----...........-----.-.................
ENSMGAP00000015629  ............-------------------------.-----...........-----.-.................
ENSMGAP00000010757  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012156  ............-------------------------.-----...........-----.-.................
ENSMGAP00000001384  ............-------------------------.-----...........YDSGR.D.................
ENSMGAP00000014541  ............-----------------------AR.LKELFds.........FDSTG.T.................
ENSMGAP00000001307  ............-------------------------.-----...........----G.N.................
ENSMGAP00000002904  ............-------------------------.-----...........-----.-.................
ENSMGAP00000004752  ............------------------------N.IYHHYa..........IRNPM.D.................
ENSMGAP00000012493  ............-------------------------.-----...........----G.N.................
ENSMGAP00000009006  ............-------------------------.-----...........-----.-.................
ENSMGAP00000002845  ............----KRNVVRTIVTETSFTIDELEE.LYALFkaeh.......LTSCY.W.................
ENSMGAP00000013352  ............-------------------------.-----...........-----.-.................
ENSMGAP00000011218  ............-------------------------.-----...........-----.-.................
ENSMGAP00000008109  ............-------------------------.-----...........-----.-.................
ENSMGAP00000013184  ............-------------------------.-----...........FPQNH.N.................
ENSMGAP00000007241  ............----KKSVVRAVSGDIGFSIEELEE.LYVVFkaky.......LMSCY.W.................
ENSMGAP00000007078  ............-------------------------.-----...........-----.-.................
ENSMGAP00000016033  ............-------------------------.-----...........-----.-.................
ENSMGAP00000009321  ............-------------------------.----Fataalvyn...NSADP.E.................
ENSMGAP00000011486  ............-------------------------.-----...........-----.-.................
ENSMGAP00000008771  ............-------------------------.-----...........-----.-.................
ENSMGAP00000009284  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012705  ............-------------------------.-----...........-----.-.................
ENSMGAP00000008188  ............---TKQNVLRVVSQDVKFSPNDLDE.LYELFkreh.......FLSCY.Wnvyspvlehhdaslpyl
ENSMGAP00000015472  ............-------------------------.-----...........-----.-.................
ENSMGAP00000008783  ............-------------------------.-----...........-----.-.................
ENSMGAP00000001658  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012256  ............-------------------------.-----...........-----.-.................
ENSMGAP00000013520  ............------------------------R.-----...........-----.-.................
ENSMGAP00000004374  ............-------------------------.-----...........-----.-.................
ENSMGAP00000000986  ............-------------------------.-----...........-----.-.................
ENSMGAP00000001945  ............-------------------------.-----...........-----.-.................
ENSMGAP00000002062  ............-------------------------.-----...........-----.-.................
ENSMGAP00000016033  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012862  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005519  ............-------------------------.-----...........-----.-.................
ENSMGAP00000015047  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005432  ............-------------------------.-----...........-----.D.................
ENSMGAP00000013736  ............------------------------W.LRKQFdg.........MDRSR.E.................
ENSMGAP00000011175  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012508  ............-------------------------.-----...........-----.D.................
ENSMGAP00000008257  ............-------------------------.-----...........-----.-.................
ENSMGAP00000013184  ............----------------------I--.-----...........-----.-.................
ENSMGAP00000010402  ............-------------------------.-----...........-----.-.................
ENSMGAP00000000248  ............-------------------------.-----...........-----.-.................
ENSMGAP00000007611  ............-------------------------.-----...........-----.-.................
ENSMGAP00000005594  ............-----------------------KS.IWYAFta.........LDVEK.S.................
ENSMGAP00000008022  ............-------------------------.-----...........-----.-.................
ENSMGAP00000010056  ............----------------------LEH.AKQAFvq.........RDNTQ.A.................
ENSMGAP00000006995  ............-------------------------.-----...........-----.-.................
ENSMGAP00000003057  ............-------------------------.-----...........-----.-.................
ENSMGAP00000007897  ............-------------------------.-----...........-----.-.................
ENSMGAP00000004556  ............-------------------------.-----...........-----.-.................
ENSMGAP00000014571  ............-------------------------.-----...........-----.-.................
ENSMGAP00000008494  ............-------------------------.-----...........AVKGQ.K.................
ENSMGAP00000007615  ............-------------------------.-----...........-----.-.................
ENSMGAP00000003099  ............------------------------W.LRKQFyt.........LDRNR.E.................
ENSMGAP00000008028  ............-------------------------.-----...........-----.-.................
ENSMGAP00000013774  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012335  ............-------------------------.-----...........-----.-.................
ENSMGAP00000006327  ............-----------------WSLEHQTT.LLQAFe..........AVDQG.D.................
ENSMGAP00000013157  ............-------------------------.-----...........-----.-.................
ENSMGAP00000015686  ............------NVLRVVIPDVSILPEDLEE.LYDLFkrehlircy..WDTAG.Paaerhdpsrpyaeq...
ENSMGAP00000006220  eekvkqlekahl-------------------------.-----...........-----.-.................
ENSMGAP00000007527  ............-------------------------.-----...........-----.-.................
ENSMGAP00000012156  ............-------------------------.-----...........-----.-.................
ENSMGAP00000004008  ............-------------------------.-----...........-----.-.................


                                             40        50                                           
                                              |         |                                           
d1bjfa_               ..G...................HLSMEEFKKIYGN.........F............F....PYG.......DASK..
ENSMGAP00000013771  ..G...................TITTKELGTVMRS.........L............G....QNP.......TEAE..
ENSMGAP00000010818  ..G...................TITTKELGTVMRS.........L............G....QNP.......TEAE..
ENSMGAP00000014820  ..G...................HLTVEEFKKIYAN.........F............F....PYG.......DASK..
ENSMGAP00000012925  ..G...................HLSMEEFKKIYGN.........F............F....PYG.......DASK..
ENSMGAP00000006499  ..-...................-------ETALEA.........C............N....LP-.......----..
ENSMGAP00000006483  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000014837  ..G...................RLNLEEFQQLYVK.........F............F....PYG.......DASK..
ENSMGAP00000007665  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000015504  ..-...................-------------.........V............N....VPL.......CVDM..
ENSMGAP00000012038  ..M...................EINAEELRNVLNNvvkkhkd..L............K....TEG.......FELE..
ENSMGAP00000017351  ..M...................EINAEELRNVLNNvvkkhkd..L............K....TEG.......FELE..
ENSMGAP00000005416  ..G...................ILNLEEFQQLYIK.........F............F....PYG.......DASK..
ENSMGAP00000010422  ..G...................IVNEENFKQIYSQ.........F............F....PQG.......DSST..
ENSMGAP00000010973  ..G...................SIDIKELKVAMRA.........L............G....FEP.......KKEE..
ENSMGAP00000011986  ..G...................RMNFKEVQRLLKM.........M............N....VDM.......NEDH..
ENSMGAP00000003311  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000013173  ..G...................VVNEETFKEIYSQ.........F............F....PQG.......DSTT..
ENSMGAP00000008329  ..G...................DISTKELGTVMRM.........L............G....QNP.......TKEE..
ENSMGAP00000001399  ..-...................---------LCKDcqvi.....D............G....KNV.......TITD..
ENSMGAP00000005345  ..G...................NIDVKELKVAMRA.........L............G....FEP.......KKEE..
ENSMGAP00000009666  ..R...................AMDVVEVIHCLTS.........LyerleeergilvN....VPL.......CVDM..
ENSMGAP00000001336  ..G...................VVNEETFKQIYAQ.........F............F....PHG.......DASM..
ENSMGAP00000007710  ..G...................VISDTELQQALSN.........G............T....WTP.......FNPA..
ENSMGAP00000011308  ..M...................EISVFELKTILNRviarhkd..L............K....TDG.......FSLD..
ENSMGAP00000008667  ..G...................QIDADELQRCLTQ.........S............GiagaYKP.......FNLE..
ENSMGAP00000017345  ..G...................LLNIEEIHQLMHK.........L............N....VNL.......PRRK..
ENSMGAP00000001713  ..G...................CLSINEVLQLMHK.........L............N....VNL.......PRQK..
ENSMGAP00000008800  ..C...................EVTATELQTILNR.........Vlakrkdirsd..G....FNI.......N---..
ENSMGAP00000017221  ..A...................EISAFELRSILNKilakrqd..I............K....SDG.......FSIE..
ENSMGAP00000003113  ..N...................KMSFKELKNFLKE.........V............N....IEV.......DDYH..
ENSMGAP00000002095  ..G...................QLTEHEFKQFFGL.........R............G....LDP.......QANE..
ENSMGAP00000003256  ..Q...................PIDYEGFRLFMKTy........L............E....VEV.......PEEL..
ENSMGAP00000005178  ..G...................QLDAAGFQKIYKQ.........F............F....PFG.......DPTK..
ENSMGAP00000004306  ..G...................SLSVEEFMSL---.........-............-....PEL.......QQNP..
ENSMGAP00000003741  ..G...................YISYKDLGECMRT.........M............G....YMP.......TEME..
ENSMGAP00000012748  ..M...................EVAAEELEYVLNAvlkntkd..Ik...........F....KKL.......SLI-..
ENSMGAP00000018907  ..G...................YISVKELKQALLN.........S............N....WSA.......FNDE..
ENSMGAP00000004316  ..G...................QLTLYEFKQFFGL.........K............N....LSP.......SANK..
ENSMGAP00000004292  ..G...................TLFMHEFKRFFGV.........Q............D....NHE.......AAEY..
ENSMGAP00000018253  ..G...................FIDKEDLHDMLAS.........M............G....KNP.......TDEY..
ENSMGAP00000011383  ..G...................HIPLCNAVQFIKD.........L............N....PGL.......KTNK..
ENSMGAP00000000614  ..G...................CISTKELGKVMRM.........L............G....QNP.......TPEE..
ENSMGAP00000008865  ..G...................FINCRDLGNCMRT.........M............G....YMP.......TEME..
ENSMGAP00000009812  ..G...................FIDKEDLHDMLASl........V............G....KNP.......TDEY..
ENSMGAP00000015231  ..G...................QLSLHEFKKLLDL.........Q............G....LDP.......QGDL..
ENSMGAP00000003121  ..G...................RIPVSRAVQLIKA.........L............N....PGM.......KVST..
ENSMGAP00000004318  ..-...................-MTGKNFSKMCKEcgvm.....D............G....KAV.......TSTD..
ENSMGAP00000002012  ..-...................IVPWKSFRQALHE.........V............H....PIS.......SGLE..
ENSMGAP00000014898  ..T...................EINVSRLETIISS.........I............Y....YQL.......NKRLps
ENSMGAP00000003792  ..A...................KITLSQVGDIVRA.........L............G....QNP.......TNAE..
ENSMGAP00000007259  ..G...................IMLEDTSVELIKK.........L............N....PTL.......KESK..
ENSMGAP00000000101  ..N...................RMCFQEVQIMLRM.........A............N....IHM.......DNAY..
ENSMGAP00000004099  ..G...................RIGIEEFAEY---.........-............-....LKL.......PISD..
ENSMGAP00000011104  ..I...................ELNVARLEAVIST.........I............F....YQL.......NKRMpt
ENSMGAP00000015217  ..-...................IVPWKVFRQCLHE.........V............H....QIS.......SGLE..
ENSMGAP00000015504  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000014359  ..G...................KIDLDSTIKLLEK.........L............H....MPF.......NLAH..
ENSMGAP00000001935  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000003079  ..G...................FIDKADLRDTFAA.........L............G....RLN.......VKNE..
ENSMGAP00000002363  ..Sem.................KITYAQCGDVLRA.........L............G....QNP.......TQAE..
ENSMGAP00000011677  ..G...................TLSREDFQRI---.........-............-....PEL.......AINP..
ENSMGAP00000009004  ..Rfaav...............GFDRNVFRDTLHR.........A............F....GMT.......DDVL..
ENSMGAP00000008132  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000019273  ..Gq..................EMNGKNWAKLCKDckvi.....D............G....KSV.......TGTD..
ENSMGAP00000001471  ..Gam.................QISYAQCGDVLRA.........L............G....HNP.......TNAE..
ENSMGAP00000010396  ..G...................KIRAADLLAVMRC.........L............G....VSP.......TPAE..
ENSMGAP00000005510  ..P...................EINAVQLQRILNNvswrrkr..F............H....LNF.......SLDA..
ENSMGAP00000005093  ..G...................FIDKADLRDTFAA.........L............G....RLN.......VKNE..
ENSMGAP00000014898  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000012414  ..N...................DINKRELKPFKRY.........V............K....KKA.......KPKK..
ENSMGAP00000003667  ..V...................KLPMQLIINM---.........-............-....PEL.......KENP..
ENSMGAP00000009666  ..-...................-----------H-.........-............-....---.......----..
ENSMGAP00000005687  ..V...................ALPYELIGSM---.........-............-....PEL.......KDNP..
ENSMGAP00000011104  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000015388  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000000479  ..-...................-LSRAEFAEA---.........L............G....LKA.......NSMF..
ENSMGAP00000013677  ..G...................FIPGSAAKEFFTK.........S............K....LPI.......LE--..
ENSMGAP00000011946  ..E...................NVDVREIGSIVRS.........L............G....CFP.......TEAE..
ENSMGAP00000011948  ..E...................NVDVREIGSIVRS.........L............G....CFP.......TEAE..
ENSMGAP00000015556  ..S...................FISGSVAKNFFTK.........S............K....LPI.......PE--..
ENSMGAP00000003279  ..-...................-----QWKQA---.........-............-....---.......----..
ENSMGAP00000005348  ..S...................AIDALQLQQLLNDmvlqdemtsL............G....GEF.......SFDS..
ENSMGAP00000012873  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000006199  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000014876  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000007897  ..G...................RFDLETFAPL---.........V............S....PPI.......HPSL..
ENSMGAP00000010932  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000006099  ..Nl..................KLSKKEFLAFMNTelas.....F............T....KNQ.......KDPA..
ENSMGAP00000000986  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000018863  ..-...................---------AMRA.........L............G....FDV.......KKAD..
ENSMGAP00000010191  ..G...................KITLSNWATAVESv........L............R....LGL.......PWRM..
ENSMGAP00000011498  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000005636  ..G...................LLSGDKVKPVLMN.........S............K....LPL.......DI--..
ENSMGAP00000014876  ..G...................YITGDQARTFFLQ.........S............G....LPS.......SV--..
ENSMGAP00000013745  ..G...................YLNREDFEVAVVMl........F............G....YNL.......SEVE..
ENSMGAP00000005636  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000019260  ..Gdky................KLSKKELKELLQSelgcf....L............E....TQK.......DTGA..
ENSMGAP00000010308  ..Gdky................KLSKKELKELLQSelgcf....L............E....TQK.......DTGA..
ENSMGAP00000015629  ..L...................YIDRKDLARH---.........N............D....HAI.......SSRM..
ENSMGAP00000007270  ..D...................KADLKEFSAY---.........-............-....LEF.......PVSH..
ENSMGAP00000015388  ..G...................FITGDQARNFFFQ.........S............G....LPQ.......PV--..
ENSMGAP00000001784  ..G...................FISKQELGMAMRS.........L............G....YMP.......SEVE..
ENSMGAP00000015545  ..G...................RISVSDWAAVMESv........L............Q....LKL.......PWRT..
ENSMGAP00000010427  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000000998  ..Gdkh................KLKKSELKELINNelth.....F............L....GEI.......KDQE..
ENSMGAP00000012493  ..G...................FIDSEELKSFLKD.........L............L....QKA.......NKQIed
ENSMGAP00000001668  ..L...................YISQKDLARY---.........S............D....QAL.......SSRI..
ENSMGAP00000011498  ..G...................LLSGDKVKPVLLN.........S............K....LPV.......DI--..
ENSMGAP00000010185  ..G...................FISKQELGTAMRS.........L............G....YMP.......NEVE..
ENSMGAP00000017513  ..G...................RLNHQEFKSCLRS.........L............G....YDLpmveegePDPE..
ENSMGAP00000013797  ..N...................YLSKEDLRALMEK.........E............F....PGF.......LENQrd
ENSMGAP00000000945  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000002904  ..M...................LLNEEEFLSFLHP.........E............H....SRG.......MLKF..
ENSMGAP00000008628  ..Gkka................LITRSALRSLLTD.........L............N....QIP.......----..
ENSMGAP00000014571  ..G...................EIPVSDFPDIAEK.........F............H....LDL.......SKEE..
ENSMGAP00000003057  ..P...................DLNVDEFIAFEHP.........E............E....VEY.......MMDF..
ENSMGAP00000010332  ..K...................TIRKEDFDTI-PD.........L............E....FNP.......IRAR..
ENSMGAP00000019524  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000005528  ..G...................KITGANAKKEMVR.........S............K....LPN.......TV--..
ENSMGAP00000010575  ..E...................EIGVEEFKAA---.........-............-....LQV.......KESF..
ENSMGAP00000001307  ..G...................YIEANELKGFLSD.........L............L....KKA.......NRPYde
ENSMGAP00000017273  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000017264  ..G...................TLNDAELNFFQRI.........C............F....NTP.......LAPQ..
ENSMGAP00000012328  ..G...................LMDHDDFRACLIS.........M............G....YDL.......GEAE..
ENSMGAP00000010402  ..R...................YMTPEDFVQKYLG.........L............Y....TDPr......YNPK..
ENSMGAP00000011891  ..G...................KISGINAKKEMVT.........S............K....LPN.......SV--..
ENSMGAP00000008022  ..G...................FISAGELKDFLRD.........L............F....LQHnkvvtevKLEE..
ENSMGAP00000011257  ..G...................FLSQADFKEALKL.........F............H....LEV.......SEQD..
ENSMGAP00000008628  ..-...................---------M---.........-............-....---.......----..
ENSMGAP00000012468  ..G...................TLGPEEFKACLIS.........L............G....YDIgndaq..GEAE..
ENSMGAP00000010049  ..Q...................ILSDDELNYFQKS.........C............F....GNP.......LAPQ..
ENSMGAP00000010311  ..D...................TLTKKELKLLIEKqlany....L............K....HVK.......NQAS..
ENSMGAP00000013157  ..G...................MLSKEELSRY---.........-............G....TGT.......LTNI..
ENSMGAP00000006617  ..G...................FISYKDLGACMRT.........L............G....YMP.......TEME..
ENSMGAP00000004752  ..Gdkf................KLSKAELKELLTRelpsf....I............S....KRT.......DEA-..
ENSMGAP00000003256  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000010056  ..F...................FMSPNDFVTRYLKi........I............G....DGL.......PNAN..
ENSMGAP00000011434  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000006435  ..G...................YVSDYELQDLFKE.........A............S....LPLpgy....KVRE..
ENSMGAP00000001668  ..E...................KANICEMGKIAKI.........C............G....CPL.......YW--..
ENSMGAP00000011498  ..G...................RVLASDAAVFLKK.........S............G....LTD.......LV--..
ENSMGAP00000004753  ..N...................SLSKGELKELIQKelt......I............G....PKL.......KDAE..
ENSMGAP00000005636  ..G...................RVGASEAALFLKK.........S............G....LSD.......II--..
ENSMGAP00000015905  ..G...................FIDANDLTDVLKA.........A............N....LPL.......PGYK..
ENSMGAP00000019081  ..-...................--SKEQLTLVLQQ.........A............G....RNP.......SQKT..
ENSMGAP00000000625  ..Cs..................TLSRGELRQLIEQ.........E............F....EDVimda...RDPR..
ENSMGAP00000007021  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000017212  ..D...................LLNFNDFQTMLTE.........Q............A....PNF.......LKGRsr
ENSMGAP00000002213  ..G...................FICDYELHELFKE.........A............N....LPL.......PGYK..
ENSMGAP00000013577  ..G...................FITILDVQRVLES.........I............N....VQI.......DEKT..
ENSMGAP00000000632  ..Qs..................KFNRRKMKEFIQK.........E............FadaiVNP.......HDPQ..
ENSMGAP00000005432  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000005269  ..-...................--------KYMRW.........M............N....HKK.......SR--..
ENSMGAP00000004749  ..R...................RISKKDFRKMLSCelnhm....L............T....DTG.......NRR-..
ENSMGAP00000014571  ..G...................YVTACDPQRFLQE.........F............N....YHP.......DHDQ..
ENSMGAP00000014702  ..-...................--------KYMRW.........M............N....HKK.......SR--..
ENSMGAP00000015629  ..-...................RATLDDMGKVAKA.........C............D....CPL.......YW--..
ENSMGAP00000010757  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000012156  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000001384  ..G...................YIDLMELKLMMEK.........L............G....APQ.......THLG..
ENSMGAP00000014541  ..G...................SLGQEELTDLCHV.........L............H....LEE.......VAPA..
ENSMGAP00000001307  ..G...................YIEGKELENFFQE.........Lesarkgtgvds.K....RDS.......LGD-..
ENSMGAP00000002904  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000004752  ..D...................YLSRNEFATLLKEnakpfladtV............P....PNT.......SVDE..
ENSMGAP00000012493  ..G...................YMDGKELQNFIQE.........Lqqarkka.....G....LDL.......TPE-..
ENSMGAP00000009006  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000002845  ..GgnsnaidrhdpslpyleqyRIDFEQFKGMFAL.........L............F....PWAcgt....HSDV..
ENSMGAP00000013352  ..-...................-LSAEDIKKAVGA.........F............S....AAE.......SF--..
ENSMGAP00000011218  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000008109  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000013184  ..Kp..................EITVKQFIDWMHL.........-............-....---.......----..
ENSMGAP00000007241  ..GnnraaaarrdqslpyleqyRIDMEQFKELFIT.........L............T....PWScga....HTPV..
ENSMGAP00000007078  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000016033  ..N...................VMRKEDFAEWLLY.........F............T....DEE.......NNEI..
ENSMGAP00000009321  ..G...................KLSKAETKSLLQTqfsrf....I............Q....GQE.......NKPK..
ENSMGAP00000011486  ..-...................-------------.........-............-....---.......---K..
ENSMGAP00000008771  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000009284  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000012705  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000008188  eqY...................RIDCQQFRVLCHL.........L............S....PWAhca....NRDS..
ENSMGAP00000015472  ..-...................-------------.........-............-....---.......-SRE..
ENSMGAP00000008783  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000001658  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000012256  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000013520  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000004374  ..-...................YIPLEEIPSVMRA.........M............G....FYP.......SEEE..
ENSMGAP00000000986  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000001945  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000002062  ..-...................SLTLDDFLHYKHL.........V............H....KQQ.......FERPme
ENSMGAP00000016033  ..-...................-LTKKEVDAALLC.........V............T....KAK.......PGPT..
ENSMGAP00000012862  ..-...................-------------.........-............-....---.......-VQR..
ENSMGAP00000005519  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000015047  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000005432  ..G...................RITERQFGSMLLA.........Y............S....GVQ.......SKK-..
ENSMGAP00000013736  ..G...................SITVKDLKAMLPQ.........V............N....YRV.......PNMR..
ENSMGAP00000011175  ..-...................-------------.........-............-....---.......--ED..
ENSMGAP00000012508  ..G...................KLSFDEFKAYFAD.........G............V....LSG.......EE--..
ENSMGAP00000008257  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000013184  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000010402  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000000248  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000007611  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000005594  ..G...................KVSKSQLKVLSHNlytv.....L............C....IP-.......HDPV..
ENSMGAP00000008022  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000010056  ..G...................RVTAMDFRDIMVT.........I............R....PHM.......LTPF..
ENSMGAP00000006995  ..-...................-ISLRELKAILPQ.........V............N....FKV.......SSMK..
ENSMGAP00000003057  ..-...................------LSSWIQQ.........S............F....KHY.......VTQE..
ENSMGAP00000007897  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000004556  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000014571  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000008494  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000007615  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000003099  ..D...................RISAKDLKNMLSQ.........V............N....YRV.......PNMR..
ENSMGAP00000008028  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000013774  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000012335  ..-...................---------A---.........-............-....---.......----..
ENSMGAP00000006327  ..G...................TVAKDDFISVIQK.........R............C....SFV.......DTEQ..
ENSMGAP00000013157  ..A...................MINYENFLKVGEK.........A............G....LKC.......KQFF..
ENSMGAP00000015686  ..Y...................RIDAQQFTNLYKLvsp......W............T....CGE.......HTDI..
ENSMGAP00000006220  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000007527  ..-...................---MDEFKEMLLNflksn....L............G....DQT.......SLAA..
ENSMGAP00000012156  ..-...................-------------.........-............-....---.......----..
ENSMGAP00000004008  ..-...................-------------.........-............-....---.......----..


                                 60                70                                  80           
                                  |                 |                                   |           
d1bjfa_               ............FAEHVFRTF........DAN................G.....D.....GTIDFREFIIA.......
ENSMGAP00000013771  ............-LQDMINEV........DAD................G.....N.....GTIDFPEFLTM.......
ENSMGAP00000010818  ............-LQDMINEV........DAD................G.....N.....GTIDFPEFLTM.......
ENSMGAP00000014820  ............FAEHVFRTF........DTN................G.....D.....GTIDFREFIIA.......
ENSMGAP00000012925  ............FAEHVFRTF........DAN................G.....D.....GTIDFREFIIA.......
ENSMGAP00000006499  ............---------........-SS................R.....N.....DSIPQDDFTPD.......
ENSMGAP00000006483  ............---------........---................-.....-.....-AFTYEKFYEL.......
ENSMGAP00000014837  ............FAQHAFRTF........DKN................G.....D.....GTIDFREFICA.......
ENSMGAP00000007665  ............---------........---................-.....-.....-----------.......
ENSMGAP00000015504  ............CLNWLLNVY........DTG................R.....T.....GRIRVLSFKTG.......
ENSMGAP00000012038  ............SCRSMIALM........DTD................G.....S.....GKINFDEFRHL.......
ENSMGAP00000017351  ............SCRSMIALM........DTD................G.....S.....GKINFDEFRHL.......
ENSMGAP00000005416  ............FAQHAFRTF........DKN................S.....D.....GTIDFREFICA.......
ENSMGAP00000010422  ............YATFLFNAF........DTD................H.....D.....GSVSFEDFVSG.......
ENSMGAP00000010973  ............-IKKMIADI........DKE................G.....S.....GTIDFEDFLAM.......
ENSMGAP00000011986  ............-ALRLFQAA........DKS................E.....S.....GTLEGEEFVLF.......
ENSMGAP00000003311  ............------QMF........PADrkrveaalnachlpkgK.....N.....DAINPEDFPET.......
ENSMGAP00000013173  ............YAHFLFNAF........DTD................H.....N.....GSVSFEDFVMG.......
ENSMGAP00000008329  ............-LDAIIEEV........DED................G.....S.....GTIDFEEFLVM.......
ENSMGAP00000001399  ............-VDIVFSKI........KGK................S.....S.....RTISFEQFKEA.......
ENSMGAP00000005345  ............-IKKMISDI........DKE................G.....T.....GKISFNDFLAV.......
ENSMGAP00000009666  ............SLNWLLNVF........DSG................R.....S.....GKMRALSFKTG.......
ENSMGAP00000001336  ............YAHYLFNAF........DTA................Q.....N.....GSVKFEDFVMA.......
ENSMGAP00000007710  ............TVRSILGMF........DRE................N.....K.....GGVNFNEFTGV.......
ENSMGAP00000011308  ............SCRNMVNLM........DKD................G.....S.....ARLGLVEFQIL.......
ENSMGAP00000008667  ............TCRLMISML........DRD................L.....S.....GTLGFNEFKEL.......
ENSMGAP00000017345  ............-VRQMFQEA........DTD................E.....Nq....GTLNFEEFSVF.......
ENSMGAP00000001713  ............-VKQMFKEA........DTD................D.....Nq....GTLGFDEFCTF.......
ENSMGAP00000008800  ............TCREMISLL........DTN................G.....T.....GSLGLIEFKTL.......
ENSMGAP00000017221  ............TCKIMVDLL........DND................G.....S.....GKLGLKEFHTL.......
ENSMGAP00000003113  ............-AKEIFQYC........DKS................K.....T.....EALEDDEIEEF.......
ENSMGAP00000002095  ............YIEQMFRTF........DMN................K.....D.....GYIDFMEYVAA.......
ENSMGAP00000003256  ............-CQHLFTSF........KR-................-.....-.....-----------.......
ENSMGAP00000005178  ............FATFVFNVF........DEN................K.....D.....GRIEFSEFIQA.......
ENSMGAP00000004306  ............LVQRVIDIF........DTD................G.....N.....GEVDFKEFIEG.......
ENSMGAP00000003741  ............-LIELSQQI........SPS................A.....G.....GKVDFDDFVEL.......
ENSMGAP00000012748  ............SCRNIISLM........DTS................G.....N.....GKLEFSEFKVF.......
ENSMGAP00000018907  ............TCLLMINMF........DRS................R.....S.....GRMDVYGFSAL.......
ENSMGAP00000004316  ............YVEQMFETF........DFN................K.....D.....GYIDFMEYVAA.......
ENSMGAP00000004292  ............-IENMFRAF........DKN................G.....D.....NTIDFLEYVAA.......
ENSMGAP00000018253  ............-LEGMMSEA........P--................-.....-.....GPINFTMFLTM.......
ENSMGAP00000011383  ............-IELKFKEL........HRS................K.....Ektg..TEVTKEEFIEV.......
ENSMGAP00000000614  ............-LQEMIDEV........DED................G.....S.....GTVDFDEFLVM.......
ENSMGAP00000008865  ............-LIELSQQI........NMN................L.....G.....GHVDFEDFVEL.......
ENSMGAP00000009812  ............-LDAMMNEA........P--................-.....-.....GPINFTMFLTM.......
ENSMGAP00000015231  ............YIKRVFDIF........DLN................Q.....D.....GFIDFLEFIAA.......
ENSMGAP00000003121  ............-IELKFKEL........QKA................S.....Erpg..TEVACDLFVEA.......
ENSMGAP00000004318  ............-IDIVFNKV........NHR................T.....Kga...RTINFAEFQQA.......
ENSMGAP00000002012  ............-AMALKSTI........DLT................C.....N.....DYISVFEFDIF.......
ENSMGAP00000014898  thqisveqsislLLNFMIAAY........DSE................G.....H.....GKLTVFSVKAM.......
ENSMGAP00000003792  ............-MNKILGNP........SKE................Emn...A.....KKITFEEFLPM.......
ENSMGAP00000007259  ............-IRLKFKEI........QKS................K.....Eklt..TRVTEEEFCEA.......
ENSMGAP00000000101  ............-AHQLFKEC........DHS................G.....D.....GRLEDQELEDF.......
ENSMGAP00000004099  ............VLRELFLLF........DRN................G.....D.....GTIDFREYVIG.......
ENSMGAP00000011104  thqinveqsislLLNFLLAAF........DPE................G.....H.....GKISVFAVKMA.......
ENSMGAP00000015217  ............-AMALKSTI........DLT................C.....N.....DYISIFEFDIF.......
ENSMGAP00000015504  ............---------........---................-.....-.....-----------.......
ENSMGAP00000014359  ............-VKHVFKKTv.......DKR................K.....I.....HTINMEDFRAI.......
ENSMGAP00000001935  ............---------........---................-.....-.....-----------.......
ENSMGAP00000003079  ............ELEDMVKEA........P--................-.....-.....GPINFTVFLTM.......
ENSMGAP00000002363  ............-VMKVLGRPk.......QED................Mn....S.....KMIDFETFLPM.......
ENSMGAP00000011677  ............LGDRIINAF........FSE................G.....E.....DQVNFRGFMRT.......
ENSMGAP00000009004  ............-MDRVFRTF........DRD................N.....D.....NFISVMEWVEG.......
ENSMGAP00000008132  ............---------........---................-.....-.....-----------.......
ENSMGAP00000019273  ............-VDIVFSKV........KGK................T.....A.....RVINYEEFKKA.......
ENSMGAP00000001471  ............VLKVLGKPK........PED................M.....Nt....KMLDFETFLPI.......
ENSMGAP00000010396  ............-AQRHLHLH........KIE................R.....N.....AELDFSTFLNI.......
ENSMGAP00000005510  ............-CQNILALL........DLN................A.....T.....GTLSIQEFRVL.......
ENSMGAP00000005093  ............EIDEMIKEA........P--................-.....-.....GPINFTVFLTM.......
ENSMGAP00000014898  ............---------........---................-.....-.....-----------.......
ENSMGAP00000012414  ............CARRFTDYC........DLN................K.....D.....KSISLQELKGC.......
ENSMGAP00000003667  ............FKERIVESF........SED................G.....E.....GSLSFNDFVDM.......
ENSMGAP00000009666  ............---------........---................-.....-.....-----------.......
ENSMGAP00000005687  ............FRQRIAEVF........SES................G.....D.....GNMTLDDFLDM.......
ENSMGAP00000011104  ............---------........---................-.....-.....-----------.......
ENSMGAP00000015388  ............---------........---................-.....-.....-----------.......
ENSMGAP00000000479  ............-VDSMFSLA........DKD................G.....N.....GYISFREFLDI.......
ENSMGAP00000013677  ............-LSHIWELS........DFD................K.....D.....GALTLDEFCAA.......
ENSMGAP00000011946  ............-LHELLAKVe.......EEE................P.....T.....GYVHLEKFLPV.......
ENSMGAP00000011948  ............-LHELLAKVe.......EEE................P.....T.....GYVHLEKFLPV.......
ENSMGAP00000015556  ............-LSHIWELS........DVD................C.....D.....GALTLPEFCAA.......
ENSMGAP00000003279  ............-HKKIVKAG........DKD................L.....D.....GQLDFEEFVHY.......
ENSMGAP00000005348  ............-CRAILALM........DLN................S.....N.....GQLTLQEFGSL.......
ENSMGAP00000012873  ............---------........---................-.....-.....-----------.......
ENSMGAP00000006199  ............---KIFKAG........DTN................Q.....D.....GQLDFEEFMQY.......
ENSMGAP00000014876  ............---------........---................-.....-.....-----------.......
ENSMGAP00000007897  ............-SEGLFNAF........DEN................R.....D.....NHIDFKEISCG.......
ENSMGAP00000010932  ............---------........SVD................G.....D.....DSLSFEDFLDM.......
ENSMGAP00000006099  ............VVDRMMKRL........DIN................S.....D.....GQLDFQEFLNL.......
ENSMGAP00000000986  ............-LKKIVDRI........DEN................K.....D.....GYLTTEELKNW.......
ENSMGAP00000018863  ............-VLKILKDY........DRE................A.....T.....GKITFEDFNEV.......
ENSMGAP00000010191  ............LRPQLVRST........---................A.....D.....GMLEYKSWLDD.......
ENSMGAP00000011498  ............---------........---................-.....-.....-----------.......
ENSMGAP00000005636  ............-LGRVWDLS........DID................K.....D.....GHLDKDEFAVA.......
ENSMGAP00000014876  ............-LADIWALS........DLN................K.....D.....GKMDQQEFSIA.......
ENSMGAP00000013745  ............-VDSIMSSV........RPE................N.....S.....-GILFEKFLNL.......
ENSMGAP00000005636  ............---------........---................-.....-.....-----------.......
ENSMGAP00000019260  ............-VEKIMQDL........DEN................G.....D.....GEVDFQEYVVL.......
ENSMGAP00000010308  ............-VEKIMQDL........DEN................G.....D.....GEVDFQEYVVL.......
ENSMGAP00000015629  ............-IERIFSGAvtrlsrgrKAQ................K.....D.....GKISYADFVWF.......
ENSMGAP00000007270  ............TLESMFALF........DEN................E.....D.....GIIDVREFVIA.......
ENSMGAP00000015388  ............-LAQIWALA........DMN................N.....D.....GRMDQLEFSIA.......
ENSMGAP00000001784  ............-LAIIMQRL........DMD................G.....D.....GQVDFDEFMTI.......
ENSMGAP00000015545  ............LKSRLVK--........-TD................P.....D.....GNVDYMSCFYY.......
ENSMGAP00000010427  ............---------........---................-.....-.....--IQLKDIVCY.......
ENSMGAP00000000998  ............TVDKVMEAL........DSD................G.....D.....AECDFQEFVAF.......
ENSMGAP00000012493  .......sklteYTEIMLRMF........DAN................N.....D.....GKLELTELASL.......
ENSMGAP00000001668  ............-IERIFSGA........VVR................G.....NevqkeGRMSYADFVWL.......
ENSMGAP00000011498  ............-LGRVWELS........DID................R.....D.....GMLDRDEFAVA.......
ENSMGAP00000010185  ............-LEVIIQRL........DMD................G.....D.....GQVDFEEFVTL.......
ENSMGAP00000017513  ............-FESILDTV........DPN................R.....D.....GHVSLQEYMAF.......
ENSMGAP00000013797  ..........pmALDKIMKDL........DQC................R.....D.....GKVGFQSFFSL.......
ENSMGAP00000000945  ............---------........---................-.....-.....-----------.......
ENSMGAP00000002904  ............MVKEIIRDL........DQD................G.....D.....KKLTLSEFISL.......
ENSMGAP00000008628  ............---------........---................-.....-.....-----------.......
ENSMGAP00000014571  ............-ISQITTKY........DIK................K.....N.....GKFAYYDFFQScilllkp
ENSMGAP00000003057  ............VTEEALEEH........DKD................G.....D.....GFVSLEEFLGD.......
ENSMGAP00000010332  ............IVHAFFDKR........NLR................K.....ApaglaEEINFEDFLTI.......
ENSMGAP00000019524  ............---------........---................-.....-.....----------T.......
ENSMGAP00000005528  ............-LGKIWKLA........DID................K.....D.....GMLDDEEFALA.......
ENSMGAP00000010575  ............FAERFFALF........DVD................G.....S.....GTISLGELHGA.......
ENSMGAP00000001307  .......aklqeYTQTILRMF........DMN................G.....D.....GKLGLSEMSRL.......
ENSMGAP00000017273  ............---------........---................-.....-.....-----------.......
ENSMGAP00000017264  ............ALEDVKNVV........RKNvsdgv...........A.....D.....NGLTLKGFLFL.......
ENSMGAP00000012328  ............-FARIMSLV........DPN................G.....Q.....GTVTFQSFIDF.......
ENSMGAP00000010402  ............TVQLLAGVA........DQT................K.....D.....GLISFQEFLAF.......
ENSMGAP00000011891  ............-LGKIWKLA........DCD................G.....D.....GMLDEEEFALA.......
ENSMGAP00000008022  ............YTDTMMKIF........DKN................K.....D.....GRLDLNDLARI.......
ENSMGAP00000011257  ............-FESLWLIL........DDS................K.....S.....DKVDYGEFIHA.......
ENSMGAP00000008628  ............-LKELFERA........RLE................K.....P.....GQVDPRAAEFT.......
ENSMGAP00000012468  ............-FARIMSIV........DPN................R.....M.....GVVTFQAFIDF.......
ENSMGAP00000010049  ............ALEDVKMVV........WKN................TtdgvqD.....NGLTLNGFLFLntlfiqr
ENSMGAP00000010311  ............-IDQIFKDL........DGN................K.....D.....QQLSFGEVMLL.......
ENSMGAP00000013157  ............FLDRVFQEC........-LT................Y.....D.....GEMDYKTYLDF.......
ENSMGAP00000006617  ............-LIEISQHI........KMR................M.....G.....GRVDFEDFVQM.......
ENSMGAP00000004752  ............GFQKLMNNL........DSN................R.....D.....SEVDFHEYATF.......
ENSMGAP00000003256  ............---------........---................-.....-.....----LKDIVCY.......
ENSMGAP00000010056  ............TVQLLAGVV........DQT................K.....D.....GLISFQEFVAF.......
ENSMGAP00000011434  ............---------........---................-.....-.....-----------.......
ENSMGAP00000006435  ............IIEKIFTVT........DSN................K.....D.....GKINFEEFVSL.......
ENSMGAP00000001668  ............-KAPMFSAS........GGQ................R.....T.....GCVSVHSFVSL.......
ENSMGAP00000011498  ............-LGKIWDLA........DTD................S.....K.....GILNKQEFFVA.......
ENSMGAP00000004753  ............-IAGLMEDL........DRN................K.....D.....QEVNFQEYVTF.......
ENSMGAP00000005636  ............-LGKIWDLA........DPE................G.....K.....GYLDKQGFYVA.......
ENSMGAP00000015905  ............-ARELVQNL........TTT................E.....N.....GRISFDEFISI.......
ENSMGAP00000019081  ............-----VNKY........WTS................Q.....T.....TTLNFDDFCTI.......
ENSMGAP00000000625  ............TVEKVLLFL........DED................S.....S.....GKVDFSEFLNL.......
ENSMGAP00000007021  ............---------........---................-.....-.....-----------.......
ENSMGAP00000017212  ..........pgYLQKLFEET........DLN................K.....D.....KELTFEEFTIV.......
ENSMGAP00000002213  ............-VREIIQKLmids....DKN................K.....D.....GKISFEEFVYI.......
ENSMGAP00000013577  ............-LHDILHEV........DLN................K.....N.....GQVELIEFLQL.......
ENSMGAP00000000632  ............TIDKILQFL........EWD................G.....D.....GEIDFNEFLLL.......
ENSMGAP00000005432  ............---------........---................-.....-.....GLISFSDYIFL.......
ENSMGAP00000005269  ............-VMDFFRRI........DKD................Q.....D.....GKITRQEFIDG.......
ENSMGAP00000004749  ............AADKLICDL........DEN................K.....D.....GRISFEEYWTL.......
ENSMGAP00000014571  ............FSSLLNSLA........ISI................H.....D.....SKLSYFDFLRAiddgras
ENSMGAP00000014702  ............-VMDFFRRI........DKD................Q.....D.....GKITRQEFIDG.......
ENSMGAP00000015629  ............-KGPLFYCA........GGE................R.....T.....GYVSVHKFVAM.......
ENSMGAP00000010757  ............---------........---................-.....-.....-----------.......
ENSMGAP00000012156  ............---------........-LN................E.....K.....GVISYTEYLFL.......
ENSMGAP00000001384  ............-LKNMIKEV........DED................F.....D.....GKLSFREFLLI.......
ENSMGAP00000014541  ............LQQTLLQ--........---................G.....Nll...GRVHFDQFKEAlililsr
ENSMGAP00000001307  ............KMKEFMHKY........DKN................A.....D.....GKIEMAELAQI.......
ENSMGAP00000002904  ............---------........---................-.....-.....-----------.......
ENSMGAP00000004752  ............YIKQLFAKS........DSN................H.....D.....GRLKFTEFLTT.......
ENSMGAP00000012493  ............-MKAFVDQY........GKA................T.....D.....GKIGIVELAQV.......
ENSMGAP00000009006  ............---------........---................-.....D.....SNMTFVEFVEL.......
ENSMGAP00000002845  ............LAARLFRLL........DEN................G.....D.....LLINFREFVSG.......
ENSMGAP00000013352  ............---------........---................-.....-.....---NYKKFFEM.......
ENSMGAP00000011218  ............---------........GKE................G.....K.....GKIPPESTLIF.......
ENSMGAP00000008109  ............---------........---................-.....-.....-----------.......
ENSMGAP00000013184  ............---------........---................-.....-.....-----------.......
ENSMGAP00000007241  ............LAGRLFRLL........DEN................R.....D.....SLINFKEFVTG.......
ENSMGAP00000007078  ............---------........---................-.....-.....-----------.......
ENSMGAP00000016033  ............YWQNVKDRF........E--................A.....G.....ENISLEEFKTF.......
ENSMGAP00000009321  ............-YQEIISAL........DEE................P.....E.....KKIDFEDFMIS.......
ENSMGAP00000011486  ............LVDSVFRNY........DHD................H.....D.....GYISQEDFESI.......
ENSMGAP00000008771  ............---------........---................-.....-.....-----------.......
ENSMGAP00000009284  ............---------........---................-.....-.....-----------.......
ENSMGAP00000012705  ............---------........---................-.....-.....-----------.......
ENSMGAP00000008188  ............IALWTFRLM........DEN................C.....H.....GLINFKQFSCV.......
ENSMGAP00000015472  ............-IRQVFAAA........DPQ................H.....T.....KVIEYDPFRNL.......
ENSMGAP00000008783  ............---------........---................-.....-.....-----------.......
ENSMGAP00000001658  ............---------........---................-.....-.....-----------.......
ENSMGAP00000012256  ............---------........---................-.....-.....-----------.......
ENSMGAP00000013520  ............---------........---................-.....-.....-----------.......
ENSMGAP00000004374  ............-IEEMINEVkfsefv..DTG................E.....Qv....TKINLRDFIKL.......
ENSMGAP00000000986  ............---ETLEDI........DKN................E.....D.....GFVDQDEYIAD.......
ENSMGAP00000001945  ............---HIFRRA........DKN................D.....D.....GKLSFEEFKNY.......
ENSMGAP00000002062  .......eaqeeRATLQFSAL........DPD................K.....K.....GHIEWPDFLSHesiqllq
ENSMGAP00000016033  ............FFRELG---........---................D.....K.....GLISYAEYLFL.......
ENSMGAP00000012862  ............MVDSVFKNY........DHD................Q.....D.....GYISQEEFEKI.......
ENSMGAP00000005519  ............---------........---................-.....-.....-----------.......
ENSMGAP00000015047  ............---------........---................-.....-.....-----------.......
ENSMGAP00000005432  ............-LTVMLKQL........KKHfq..............D.....G.....EGLTFEEVENF.......
ENSMGAP00000013736  ............FLRDKLVE-........-VE................A.....R.....NEMTFSHFIQF.......
ENSMGAP00000011175  ............-LQDLFDKA........HED................A.....D.....GKLSFEDLQKL.......
ENSMGAP00000012508  ............-LHELFHTI........DTH................N.....T.....DNLDTEELCEY.......
ENSMGAP00000008257  ............---------........---................-.....-.....-----------.......
ENSMGAP00000013184  ............---------........---................-.....-.....-----------.......
ENSMGAP00000010402  ............-----RLHF........GHN................R.....K.....KHLNYTEFTQF.......
ENSMGAP00000000248  ............---------........---................-.....D.....GKLSLEEFQAF.......
ENSMGAP00000007611  ............-----SESL........-RQ................G.....G.....GKLNFDELRQD.......
ENSMGAP00000005594  ............ALEEHFRDD........---................D.....D.....GPVSSQGYMPY.......
ENSMGAP00000008022  ............---------........---................-.....-.....-----------.......
ENSMGAP00000010056  ............VEECLVAAA........GGT................T.....S.....HQVSFSYFNGF.......
ENSMGAP00000006995  ............FLKDKFAEI........GAH................K.....-.....EELSFEQFHLF.......
ENSMGAP00000003057  ............-AKQHFQDY........DKN................G.....D.....GLVSWKEY---.......
ENSMGAP00000007897  ............---------........---................-.....-.....--LHFNNLIVG.......
ENSMGAP00000004556  ............---------........---................-.....-.....-QLKFEELQCD.......
ENSMGAP00000014571  ............---------........---................-.....-.....-----------.......
ENSMGAP00000008494  ............---------........---................-.....-.....-----------.......
ENSMGAP00000007615  ............---------........-QN................G.....T.....KELGFEDFKKS.......
ENSMGAP00000003099  ............FLRERLTDM........-EQ................R.....N.....GDITYGQFAQL.......
ENSMGAP00000008028  ............---------........---................-.....-.....-----------.......
ENSMGAP00000013774  ............---------........---................G.....E.....NLISIAELINA.......
ENSMGAP00000012335  ............-LLDIFETI........DLD................G.....N.....GLLSLEEYNFF.......
ENSMGAP00000006327  ............-IQTIAEAH........EKP................D.....S.....EGINTEEFFKG.......
ENSMGAP00000013157  ............TAKIFAKLL........HND................P.....Y.....GRISIMQFFNY.......
ENSMGAP00000015686  ............LAERTFRLL........DDN................M.....D.....HLIEFKGLASC.......
ENSMGAP00000006220  ............---------........---................-.....-.....-----------.......
ENSMGAP00000007527  ............LVSQIITMA........DVN................R.....D.....GKVSLAE----.......
ENSMGAP00000012156  ............----LVHFF........GKK................G.....K.....AELNFEDFYRF.......
ENSMGAP00000004008  ............---------........---................-.....-.....-----------.......


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  qkstllqrviipkpqkpmspgpqsmlfyst................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  grhettwtilrrfgyddeleltddylypqfrlppg...........................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  kyqqrqkqatppasfaalsleqt.......................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  tlsneehfqepgasdchedvsaqeaemgallgrcsctdffssageretvtfwepleqlglnsalspgcvqmgnekrqk
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  klrppns.......................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  ..............................................................................
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                           90                                       
                                                            |                                       
d1bjfa_               .....................LS............VTSRG.....KL...............................
ENSMGAP00000013771  .....................MA............RKMKDt....DS...............................
ENSMGAP00000010818  .....................MA............RKMKDt....DS...............................
ENSMGAP00000014820  .....................LS............VTSRG.....KL...............................
ENSMGAP00000012925  .....................LS............VTSRG.....KL...............................
ENSMGAP00000006499  .....................VYr...........VFLNNl....CP...............................
ENSMGAP00000006483  .....................TQ............KICP-.....--...............................
ENSMGAP00000014837  .....................LS............ITSRG.....SF...............................
ENSMGAP00000007665  .....................--............-----.....--...............................
ENSMGAP00000015504  .....................VV............SLCK-.....--...............................
ENSMGAP00000012038  .....................WD............KIKS-.....--...............................
ENSMGAP00000017351  .....................WD............KIKS-.....--...............................
ENSMGAP00000005416  .....................LS............VTSRG.....TF...............................
ENSMGAP00000010422  .....................LS............IILRG.....TI...............................
ENSMGAP00000010973  .....................MT............QKMSEk....DS...............................
ENSMGAP00000011986  .....................YK............ALTE-.....--...............................
ENSMGAP00000003311  .....................VYkt..........FLMNL.....CP...............................
ENSMGAP00000013173  .....................LS............ILLRG.....TV...............................
ENSMGAP00000008329  .....................MV............RQMKEdakg.KS...............................
ENSMGAP00000001399  .....................LQ............ELSKKrfkekSD...............................
ENSMGAP00000005345  .....................MT............QKMAEk....DS...............................
ENSMGAP00000009666  .....................IA............CLC--.....--...............................
ENSMGAP00000001336  .....................LS............ILLRG.....TV...............................
ENSMGAP00000007710  .....................WK............YITD-.....--...............................
ENSMGAP00000011308  .....................WN............KIRS-.....--...............................
ENSMGAP00000008667  .....................WA............VING-.....--...............................
ENSMGAP00000017345  .....................YK............MMSL-.....--...............................
ENSMGAP00000001713  .....................YK............MMST-.....--...............................
ENSMGAP00000008800  .....................WM............KIQM-.....--...............................
ENSMGAP00000017221  .....................WT............KIQK-.....--...............................
ENSMGAP00000003113  .....................YK............ILTE-.....--...............................
ENSMGAP00000002095  .....................LS............LVLRG.....KM...............................
ENSMGAP00000003256  .....................--............-----.....--...............................
ENSMGAP00000005178  .....................LS............VTSRG.....TL...............................
ENSMGAP00000004306  .....................VS............QFSVKg....DK...............................
ENSMGAP00000003741  .....................MG............PKMLA.....ETadmig..........................
ENSMGAP00000012748  .....................WE............KLKK-.....--...............................
ENSMGAP00000018907  .....................LR............FIQQ-.....--...............................
ENSMGAP00000004316  .....................LS............LVLKG.....KV...............................
ENSMGAP00000004292  .....................LN............LVLRG.....KL...............................
ENSMGAP00000018253  .....................FG............EKLNGt....DP...............................
ENSMGAP00000011383  .....................FH............ELCT-.....--...............................
ENSMGAP00000000614  .....................MV............RCMKDdskg.KT...............................
ENSMGAP00000008865  .....................MG............PKLLA.....ETadmig..........................
ENSMGAP00000009812  .....................FG............EKLNGt....DP...............................
ENSMGAP00000015231  .....................IN............LVIRG.....KI...............................
ENSMGAP00000003121  .....................YC............ELCT-.....--...............................
ENSMGAP00000004318  .....................MK............EICVKrfkgkSP...............................
ENSMGAP00000002012  .....................TR............LFQP-.....--...............................
ENSMGAP00000014898  .....................LA............TMCG-.....--...............................
ENSMGAP00000003792  .....................LQ............AAANNkdq..GT...............................
ENSMGAP00000007259  .....................FC............ELCT-.....--...............................
ENSMGAP00000000101  .....................CR............RLLRR.....PE...............................
ENSMGAP00000004099  .....................LS............ILCNPa....NT...............................
ENSMGAP00000011104  .....................LA............TLCG-.....--...............................
ENSMGAP00000015217  .....................TR............LFQP-.....--...............................
ENSMGAP00000015504  .....................--............-----.....-L...............................
ENSMGAP00000014359  .....................YR............AIVH-.....--...............................
ENSMGAP00000001935  .....................--............-----.....-C...............................
ENSMGAP00000003079  .....................FG............EKLKGt....DP...............................
ENSMGAP00000002363  .....................LQ............HIAKTkdt..GT...............................
ENSMGAP00000011677  .....................LA............HFRPI.....EDnekskdqngpeplnsr...............
ENSMGAP00000009004  .....................LS............VFLRG.....TL...............................
ENSMGAP00000008132  .....................--............-----.....IC...............................
ENSMGAP00000019273  .....................LE............ELASK.....RF...............................
ENSMGAP00000001471  .....................LQ............HFTRTreq..GT...............................
ENSMGAP00000010396  .....................MY............RQMKQe....EP...............................
ENSMGAP00000005510  .....................WK............RLLF-.....--...............................
ENSMGAP00000005093  .....................FG............EKLKGa....DP...............................
ENSMGAP00000014898  .....................--............-----.....--...............................
ENSMGAP00000012414  .....................L-............-----.....--...............................
ENSMGAP00000003667  .....................FS............VLSEMa....PR...............................
ENSMGAP00000009666  .....................--............-----.....--...............................
ENSMGAP00000005687  .....................FS............VLSEMa....PR...............................
ENSMGAP00000011104  .....................--............-----.....-I...............................
ENSMGAP00000015388  .....................--............----Q.....SS...............................
ENSMGAP00000000479  .....................LV............VFMKG.....SS...............................
ENSMGAP00000013677  .....................FH............LVVA-.....--...............................
ENSMGAP00000011946  .....................MT............KILLDrsyrpIP...............................
ENSMGAP00000011948  .....................MT............KILLDrsyrpIP...............................
ENSMGAP00000015556  .....................FH............LVVA-.....--...............................
ENSMGAP00000003279  .....................LQ............DH---.....--...............................
ENSMGAP00000005348  .....................WR............SVTNL.....CS...............................
ENSMGAP00000012873  .....................--............-----.....--...............................
ENSMGAP00000006199  .....................LK............DHE--.....--...............................
ENSMGAP00000014876  .....................--............-----.....-S...............................
ENSMGAP00000007897  .....................LS............ACCRG.....PL...............................
ENSMGAP00000010932  .....................LS............AFSDAa....TS...............................
ENSMGAP00000006099  .....................IG............G----.....--...............................
ENSMGAP00000000986  .....................IK............RVQKR.....YI...............................
ENSMGAP00000018863  .....................VTd...........WILDR.....DP...............................
ENSMGAP00000010191  .....................LA............MEQRSq....EHiqsslleviyrn...................
ENSMGAP00000011498  .....................--............-----.....--...............................
ENSMGAP00000005636  .....................MH............LVYR-.....--...............................
ENSMGAP00000014876  .....................MK............LIK--.....--...............................
ENSMGAP00000013745  .....................MS............AKKFAq....LF...............................
ENSMGAP00000005636  .....................--............-----.....SE...............................
ENSMGAP00000019260  .....................VA............ALT--.....--...............................
ENSMGAP00000010308  .....................VA............ALT--.....--...............................
ENSMGAP00000015629  .....................LI............SEEDK.....KT...............................
ENSMGAP00000007270  .....................LS............VVCKPs....KT...............................
ENSMGAP00000015388  .....................MK............LIK--.....--...............................
ENSMGAP00000001784  .....................LG............PKLVS.....SEgrdgfl.........................
ENSMGAP00000015545  .....................MD............TARPM.....HQvqptlvetlcky...................
ENSMGAP00000010427  .....................LS............LLERG.....RP...............................
ENSMGAP00000000998  .....................IA............MVTS-.....--...............................
ENSMGAP00000012493  .....................QR............LLPVQ.....ENflikfqgvkmc....................
ENSMGAP00000001668  .....................LI............SEEDK.....RN...............................
ENSMGAP00000011498  .....................MF............L----.....--...............................
ENSMGAP00000010185  .....................LG............PKLSTs....GI...............................
ENSMGAP00000017513  .....................MI............SRETEnv...KS...............................
ENSMGAP00000013797  .....................VA............GL---.....--...............................
ENSMGAP00000000945  .....................--............---SK.....KS...............................
ENSMGAP00000002904  .....................PV............GTVENqqaq.DIdddwv..........................
ENSMGAP00000008628  .....................--............-----.....--...............................
ENSMGAP00000014571  .....................ML............RIQPQil...HC...............................
ENSMGAP00000003057  .....................YR............RDPTA.....KE...............................
ENSMGAP00000010332  .....................MS............YFRPI.....EMdmdeerlesfr....................
ENSMGAP00000019524  .....................VG............LSS--.....KT...............................
ENSMGAP00000005528  .....................NH............-----.....--...............................
ENSMGAP00000010575  .....................LR............LLLHG.....TA...............................
ENSMGAP00000001307  .....................LPvqenfll.....KFQGMk....LS...............................
ENSMGAP00000017273  .....................--............-----.....--...............................
ENSMGAP00000017264  .....................HT............LFIQR.....GR...............................
ENSMGAP00000012328  .....................MT............RETADt....DT...............................
ENSMGAP00000010402  .....................ES............VLCT-.....-P...............................
ENSMGAP00000011891  .....................--............-----.....--...............................
ENSMGAP00000008022  .....................LAlqenfllqfkmdACSTE.....ER...............................
ENSMGAP00000011257  .....................IA............GEMNE.....YR...............................
ENSMGAP00000008628  .....................LS............LLEA-.....--...............................
ENSMGAP00000012468  .....................MS............RETADt....DT...............................
ENSMGAP00000010049  .....................CS............TELNH.....LG...............................
ENSMGAP00000010311  .....................IM............RVTAA.....--...............................
ENSMGAP00000013157  .....................VL............ALENR.....KE...............................
ENSMGAP00000006617  .....................MG............PKLR-.....--...............................
ENSMGAP00000004752  .....................LA............CVA--.....--...............................
ENSMGAP00000003256  .....................LS............LLERG.....RA...............................
ENSMGAP00000010056  .....................ES............VLCA-.....-P...............................
ENSMGAP00000011434  .....................--............-----.....EN...............................
ENSMGAP00000006435  .....................IQ............ELKS-.....--...............................
ENSMGAP00000001668  .....................WR............KILRN.....CH...............................
ENSMGAP00000011498  .....................LR............-----.....--...............................
ENSMGAP00000004753  .....................LG............ALA--.....--...............................
ENSMGAP00000005636  .....................LR............-----.....--...............................
ENSMGAP00000015905  .....................FQ............NLKSD.....DV...............................
ENSMGAP00000019081  .....................LK............EETP-.....AA...............................
ENSMGAP00000000625  .....................VF............RVAK-.....--...............................
ENSMGAP00000007021  .....................--............-----.....-N...............................
ENSMGAP00000017212  .....................LA............KVTDD.....--...............................
ENSMGAP00000002213  .....................FQ............EVKSS.....DI...............................
ENSMGAP00000013577  .....................MS............AIQK-.....--...............................
ENSMGAP00000000632  .....................VF............RVA--.....--...............................
ENSMGAP00000005432  .....................TT............VLST-.....-P...............................
ENSMGAP00000005269  .....................IL............ASKFP.....TT...............................
ENSMGAP00000004749  .....................IG............G----.....--...............................
ENSMGAP00000014571  .....................LI............KIKEIva...SS...............................
ENSMGAP00000014702  .....................IL............SSKFP.....TS...............................
ENSMGAP00000015629  .....................WR............KILQ-.....TC...............................
ENSMGAP00000010757  .....................--............-----.....SP...............................
ENSMGAP00000012156  .....................LC............ILTK-.....-P...............................
ENSMGAP00000001384  .....................F-............-----.....--...............................
ENSMGAP00000014541  lieaqgqlrfwnpddlnasqgTS............LPTPE.....WV...............................
ENSMGAP00000001307  .....................LPteenfll.....CFRQHv....GS...............................
ENSMGAP00000002904  .....................--............----R.....KN...............................
ENSMGAP00000004752  .....................LS............LV---.....--...............................
ENSMGAP00000012493  .....................LPteenfllff...RCQQL.....KS...............................
ENSMGAP00000009006  .....................FK............SFSV-.....RS...............................
ENSMGAP00000002845  .....................LS............AACHG.....DL...............................
ENSMGAP00000013352  .....................VG............LKKK-.....-S...............................
ENSMGAP00000011218  .....................NI............DLLEI.....RN...............................
ENSMGAP00000008109  .....................--............-----.....--...............................
ENSMGAP00000013184  .....................--............-----.....--...............................
ENSMGAP00000007241  .....................MS............GMYHG.....DL...............................
ENSMGAP00000007078  .....................--............-----.....--...............................
ENSMGAP00000016033  .....................CK............FTNN-.....--...............................
ENSMGAP00000009321  .....................LV............-----.....--...............................
ENSMGAP00000011486  .....................AA............NFP--.....--...............................
ENSMGAP00000008771  .....................--............-----.....--...............................
ENSMGAP00000009284  .....................--............-----.....-M...............................
ENSMGAP00000012705  .....................--............-----.....--...............................
ENSMGAP00000008188  .....................LD............TMYNG.....SF...............................
ENSMGAP00000015472  .....................II............SITDG.....AFseheimtlgrhyrekeeyemdhyfllakaqe
ENSMGAP00000008783  .....................--............-----.....--...............................
ENSMGAP00000001658  .....................--............-----.....--...............................
ENSMGAP00000012256  .....................--............-----.....--...............................
ENSMGAP00000013520  .....................--............-----.....--...............................
ENSMGAP00000004374  .....................YI............NHRPAfg...LS...............................
ENSMGAP00000000986  .....................MF............ANEEG.....GP...............................
ENSMGAP00000001945  .....................FA............---DGi....LS...............................
ENSMGAP00000002062  .....................LL............RLLTV.....KE...............................
ENSMGAP00000016033  .....................LT............ILTK-.....-P...............................
ENSMGAP00000012862  .....................AA............S----.....--...............................
ENSMGAP00000005519  .....................--............-----.....--...............................
ENSMGAP00000015047  .....................--............--HNY.....LN...............................
ENSMGAP00000005432  .....................FT............FLKNI.....ND...............................
ENSMGAP00000013736  .....................YK............NLMFDa....QK...............................
ENSMGAP00000011175  .....................LG............SAAQ-.....--...............................
ENSMGAP00000012508  .....................FS............QHLGE.....YEnvlsvl.........................
ENSMGAP00000008257  .....................--............-----.....--...............................
ENSMGAP00000013184  .....................--............-----.....--...............................
ENSMGAP00000010402  .....................LQ............ELQA-.....--...............................
ENSMGAP00000000248  .....................FS............D---Gt....LN...............................
ENSMGAP00000007611  .....................LK............GKG--.....HT...............................
ENSMGAP00000005594  .....................LN............KYILD.....KVee.............................
ENSMGAP00000008022  .....................--............-----.....--...............................
ENSMGAP00000010056  .....................NS............LLNN-.....--...............................
ENSMGAP00000006995  .....................YK............KIMFEqqk..SX...............................
ENSMGAP00000003057  .....................--............-----.....--...............................
ENSMGAP00000007897  .....................LV............LLTRG.....KE...............................
ENSMGAP00000004556  .....................VS............VEED-.....--...............................
ENSMGAP00000014571  .....................--............-----.....--...............................
ENSMGAP00000008494  .....................--............-----.....--...............................
ENSMGAP00000007615  .....................LK............ELGH-.....-E...............................
ENSMGAP00000003099  .....................YR............SLMFS.....--...............................
ENSMGAP00000008028  .....................--............----E.....AP...............................
ENSMGAP00000013774  .....................MK............QIQK-.....IP...............................
ENSMGAP00000012335  .....................EL............RTSGEt....CD...............................
ENSMGAP00000006327  .....................FK............YLQK-.....--...............................
ENSMGAP00000013157  .....................VM............RKV--.....-W...............................
ENSMGAP00000015686  .....................LD............VMYNG.....EM...............................
ENSMGAP00000006220  .....................IS............RLTR-.....-R...............................
ENSMGAP00000007527  .....................--............-----.....--...............................
ENSMGAP00000012156  .....................MD............NLQT-.....--...............................
ENSMGAP00000004008  .....................--............-----.....--...............................


                                        100                                            110       120
                                          |                                              |         |
d1bjfa_               .........EQKL.....KWAFSMY............DL.......................D.G.NGYISKAEMLEI
ENSMGAP00000013771  .........EEEI.....REAFRVF............DK.......................D.G.NGYISAAELRHV
ENSMGAP00000010818  .........EEEI.....REAFRVF............DK.......................D.G.NGYISAAELRHV
ENSMGAP00000014820  .........EQKL.....KWAFSMY............DL.......................D.G.NGYISRGEMLEI
ENSMGAP00000012925  .........EQKL.....KWAFSMY............DL.......................D.G.NGYISKSEMLEI
ENSMGAP00000006499  .........RPEI.....DHIFSEF............GA.......................K.S.KPYLTVDQMMEF
ENSMGAP00000006483  .........RTDI.....EDLFKKI............NG.......................D.K.TDYLTVDQLVSF
ENSMGAP00000014837  .........EQKL.....NWAFNMY............DL.......................D.G.DGKITRVEMLEI
ENSMGAP00000007665  .........----.....HWQFYQL............DQ.......................H.PiDRSLTHSELAPL
ENSMGAP00000015504  .........----.....-------............--.......................-.-.------------
ENSMGAP00000012038  .........---W.....QKIFKHY............DA.......................D.H.SGTINSYEMRNA
ENSMGAP00000017351  .........---W.....QKIFKHY............DA.......................D.H.SGTINSYEMRNA
ENSMGAP00000005416  .........EQKL.....NWAFEMY............DL.......................D.G.DGKITRLEMLEI
ENSMGAP00000010422  .........DDRL.....NWAFNLY............DL.......................N.K.DGCITKEEMLDI
ENSMGAP00000010973  .........KEEI.....LKAFRLF............DD.......................D.G.TGKISFKNLKRV
ENSMGAP00000011986  .........RKEV.....QSLFQEF............SE.......................D.G.-KKLTLLELVDF
ENSMGAP00000003311  .........RPEI.....DEIFTSH............HF.......................K.A.KPYMTKEHLAKF
ENSMGAP00000013173  .........QEKL.....NWAFNLY............DI.......................N.K.DGYITKEEMLDI
ENSMGAP00000008329  .........EEEL.....ANCFRIF............DK.......................N.A.DGFIDIEELGEI
ENSMGAP00000001399  .........EEAI.....QEIYKLI............--.......................-.-.------------
ENSMGAP00000005345  .........KEEI.....LKAFKLF............DD.......................D.E.TGKISFKNLKRV
ENSMGAP00000009666  .........----.....-------............--.......................-.-.------------
ENSMGAP00000001336  .........HEKL.....RWTFNLY............DI.......................N.K.DGYINKEEMMDI
ENSMGAP00000007710  .........---W.....QNVFRTY............DR.......................D.N.SGMIDKNELKQA
ENSMGAP00000011308  .........---W.....LTIFRQY............DL.......................D.K.SGTMSSYEMRMA
ENSMGAP00000008667  .........---W.....KQHFVSF............DS.......................D.R.SGTVDRQELEKA
ENSMGAP00000017345  .........RRDL.....YLLLLSY............-S.......................D.K.KDHLTVEELAQF
ENSMGAP00000001713  .........RRDL.....YLLMLTY............-S.......................N.H.KDFLDTDDLRRF
ENSMGAP00000008800  .........---Y.....LAIYRKV............DR.......................D.Y.SGTIDSHEMRNA
ENSMGAP00000017221  .........---Y.....QKIYREI............DV.......................D.R.SGTMNSYEMRRA
ENSMGAP00000003113  .........RKEI.....DTIFQKY............-S.......................D.A.EGLMSCQNLVRF
ENSMGAP00000002095  .........EQKL.....RWYFKLY............DV.......................D.G.NGCIDRHELLNI
ENSMGAP00000003256  .........----.....-------............--.......................-.-.------------
ENSMGAP00000005178  .........DEKL.....RWAFKLY............DL.......................D.N.DGYITRNEMLDI
ENSMGAP00000004306  .........EQKL.....RFAFRIY............DM.......................D.K.DGYISNGELFQV
ENSMGAP00000003741  .........IKEL.....RDAFREF............DT.......................N.G.DGQISMAELREA
ENSMGAP00000012748  .........---W.....INIFLRF............DF.......................D.K.SGSMSSYELRSA
ENSMGAP00000018907  .........---W.....KNLFQQY............DR.......................D.Q.SGSISFSELQQA
ENSMGAP00000004316  .........DQKL.....RWYFKLY............DV.......................D.G.NGCIDRGELLNI
ENSMGAP00000004292  .........EHKL.....RWTFKVY............DK.......................D.G.NGCIDKPELLEI
ENSMGAP00000018253  .........EDVI.....RNAFACF............DE.......................E.A.SGFIHEDHLREL
ENSMGAP00000011383  .........RPEI.....YFLLVQF............-S.......................S.N.KEFLDTKDLMMF
ENSMGAP00000000614  .........EEEL.....SDLFRMF............DK.......................N.A.DGYIDLEELKIM
ENSMGAP00000008865  .........VKEL.....RDAFREF............DT.......................N.G.DGEISTSELREA
ENSMGAP00000009812  .........EDVI.....RNAFACF............DE.......................E.A.TGFIQEDYLREL
ENSMGAP00000015231  .........DQKL.....KWYFKLY............DA.......................D.G.NGCIDKKELLSI
ENSMGAP00000003121  .........RPEI.....FFLLVQF............-S.......................S.N.KEYLGLKDLLTF
ENSMGAP00000004318  .........EEAL.....QA-----............--.......................-.-.------------
ENSMGAP00000002012  .........----.....-------............--.......................-.-.------------
ENSMGAP00000014898  .........----.....-------............--.......................-.-.------------
ENSMGAP00000003792  .........YEDF.....VEGLRVF............DK.......................E.G.NGTVMGAELRHV
ENSMGAP00000007259  .........RPEV.....YFLLVQI............-S.......................K.N.KEYLDANDLMLF
ENSMGAP00000000101  .........EE--.....--LFGHY............-S.......................G.E.DCVLSAEELRDF
ENSMGAP00000004099  .........EETI.....HMAFKLF............DQ.......................D.D.DGTITEKEFACI
ENSMGAP00000011104  .........----.....-------............--.......................-.-.------------
ENSMGAP00000015217  .........----.....-------............--.......................-.-.------------
ENSMGAP00000015504  .........EDKY.....RYLFKQV............-A.......................S.S.TGFCDQRRLGLL
ENSMGAP00000014359  .........RNEF.....HEIFCAY............-S.......................Q.N.RKYLADTELTEF
ENSMGAP00000001935  .........KDSL.....GWMFNRL............DT.......................N.Y.DLLLDQSELGSI
ENSMGAP00000003079  .........EETI.....LNAFKIF............DP.......................E.G.KGHIKADYIKEM
ENSMGAP00000002363  .........YEDF.....VEGLRVF............DK.......................E.G.NGTVMGAELRHV
ENSMGAP00000011677  .........SNKL.....HFAFRLY............DL.......................D.K.DDKISRDELLQV
ENSMGAP00000009004  .........EERI.....KYCFEVY............DL.......................N.G.DGYISREEMFQM
ENSMGAP00000008132  .........KDSL.....GWMFNKL............DM.......................N.Y.DLLLDPSEISAI
ENSMGAP00000019273  .........KD--.....-------............--.......................-.-.------------
ENSMGAP00000001471  .........FEDF.....VEGLRVF............DK.......................E.G.NGLVMGAELRHV
ENSMGAP00000010396  .........EKEI.....LTALAMI............DR.......................E.K.RGLISAAELRAK
ENSMGAP00000005510  .........---Y.....LEVFQKR............DT.......................N.R.SGKLDLVELRAA
ENSMGAP00000005093  .........EETI.....LNAFKVF............DP.......................E.G.KG-LKSAYIKEM
ENSMGAP00000014898  .........LDKL.....RYIFSQI............-S.......................D.S.NGLMIFSKFDQF
ENSMGAP00000012414  .........----.....-------............--.......................-.-.------------
ENSMGAP00000003667  .........ELKA.....IYAFKIY............DF.......................N.T.DNFICKADLEKT
ENSMGAP00000009666  .........----.....-------............--.......................-.-.------------
ENSMGAP00000005687  .........DLKA.....YYAFKIY............DF.......................N.N.DDYICKSDLEKT
ENSMGAP00000011104  .........MDKL.....RYIFSMI............-S.......................D.S.SGVMVYGKYDLF
ENSMGAP00000015388  .........RLKY.....RQLFNSH............DK.......................T.M.SGHLTGPQARTI
ENSMGAP00000000479  .........EEKS.....KLMFRMY............DI.......................D.E.NGFLSKEEFLRM
ENSMGAP00000013677  .........----.....-------............--.......................-.-.------------
ENSMGAP00000011946  .........EDVL.....LHAFEAL............DE.......................K.K.SGYITKEELVKH
ENSMGAP00000011948  .........EDVL.....LHAFEAL............DE.......................K.K.SGYITKEELVKH
ENSMGAP00000015556  .........----.....-------............--.......................-.-.------------
ENSMGAP00000003279  .........EKKL.....RLVFKSL............DK.......................K.N.DGRIDAQEIVQS
ENSMGAP00000005348  .........E---.....-DLFKRE............DR.......................N.R.SGFLDVSELKSA
ENSMGAP00000012873  .........ERVV.....HWYFKQL............DK.......................N.S.SGDIGKKEIKPF
ENSMGAP00000006199  .........-KKM.....KLAFKSL............DK.......................N.N.DGKIEPSEVVQS
ENSMGAP00000014876  .........RLKY.....RQKFNSL............DK.......................S.M.SGYLSGFQARNA
ENSMGAP00000007897  .........AERQ.....KFCFKVF............DI.......................D.R.DGVLSRTELKEM
ENSMGAP00000010932  .........DIKS.....NYAFRIF............DF.......................N.D.DGVLDRKDLEEL
ENSMGAP00000006099  .........----.....-------............--.......................-.-.------------
ENSMGAP00000000986  .........YENV.....AKVWKDY............DT.......................N.K.DNKITWEEYKQA
ENSMGAP00000018863  .........QEEI.....LKAFKLF............DD.......................D.D.SGKISLRNLRRV
ENSMGAP00000010191  .........RSNL.....ETIFRII............DR.......................D.H.SGLISFEEFHQT
ENSMGAP00000011498  .........--KY.....DEIFVKT............DK.......................D.M.DGFVSGVEAREL
ENSMGAP00000005636  .........----.....-------............--.......................-.-.------------
ENSMGAP00000014876  .........----.....-------............--.......................-.-.------------
ENSMGAP00000013745  .........SDET.....REIFTAF............DV.......................Q.D.RGFLTFEDFKKT
ENSMGAP00000005636  .........KVRY.....DDIFLKT............DT.......................D.M.DGFVSGQEVKDI
ENSMGAP00000019260  .........----.....-------............--.......................-.-.------------
ENSMGAP00000010308  .........----.....-------............--.......................-.-.------------
ENSMGAP00000015629  .........PTSI.....EYWFRCM............DL.......................D.G.DGALSMYELEYF
ENSMGAP00000007270  .........LETI.....QLAFQLY............-Q.......................S.E.NGTITEEDLAHI
ENSMGAP00000015388  .........----.....-------............--.......................-.-.------------
ENSMGAP00000001784  .........GNTI.....DSIFWQF............DM.......................Q.-.--RITLEELKHI
ENSMGAP00000015545  .........RKDL.....QVIFNII............DE.......................D.E.SGLISPDEFRKT
ENSMGAP00000010427  .........EDKL.....EFMFRLY............DT.......................D.G.NGYLDSSELENI
ENSMGAP00000000998  .........----.....-------............--.......................-.-.------------
ENSMGAP00000012493  .........AKEF.....NKAFEMY............DQ.......................D.G.NGYIDENELDAL
ENSMGAP00000001668  .........ATSI.....EYWFRCM............DL.......................D.G.DGVLSMYELEYF
ENSMGAP00000011498  .........----.....-------............--.......................-.-.------------
ENSMGAP00000010185  .........PEKFhgtdfDTVFWKC............DM.......................Q.K.---LTVDELKRL
ENSMGAP00000017513  .........SEEI.....ESAFRAL............SS.......................E.G.KPYVTKEELYQN
ENSMGAP00000013797  .........----.....-------............--.......................-.-.------------
ENSMGAP00000000945  .........SSQL.....KEIFRIL............DN.......................D.Q.SGFIEEDELKYF
ENSMGAP00000002904  .........KDRR.....KEFEEVI............DA.......................N.H.DGIVTMEELEEY
ENSMGAP00000008628  .........----.....-------............--.......................-.-.------------
ENSMGAP00000014571  .........WRPM.....KRTFKSY............DE.......................S.R.TGLLNVADFRQV
ENSMGAP00000003057  .........DPEWilvekDRFVNDY............DK.......................D.N.DGKLNPQELLSW
ENSMGAP00000010332  .........KEKL.....KFLFHMY............DA.......................D.Y.DGIITLQEYKNV
ENSMGAP00000019524  .........PDQI.....KKVFGIL............DQ.......................D.K.SGFIEEEELQLF
ENSMGAP00000005528  .........----.....-------............--.......................-.-.------------
ENSMGAP00000010575  .........ADKL.....RFLFQVY............DVdvlpnqragegamaslwvgtavpS.G.SGSIDAAELLLV
ENSMGAP00000001307  .........SEEF.....NAIFAFY............DK.......................D.G.SGFIDEHELDAL
ENSMGAP00000017273  .........----.....-------............--.......................-.-.------------
ENSMGAP00000017264  .........HETT.....WTVLRRF............GY.......................D.D.DLELTPEYLFPL
ENSMGAP00000012328  .........AEQV.....IASFRIL............-A.......................S.D.KPYILADELRRE
ENSMGAP00000010402  .........DAIF.....VVAFQLF............DK.......................N.G.NGEVTFANVKEV
ENSMGAP00000011891  .........----.....-------............--.......................-.-.------------
ENSMGAP00000008022  .........KRDF.....EKIFAHY............DV.......................S.K.TGALEGPEVDGF
ENSMGAP00000011257  .........KAFV.....RKAYMKL............DF.......................N.K.TGSVPMVDIRKC
ENSMGAP00000008628  .........----.....-----MY............DR.......................S.G.TGYIKTRSAAAA
ENSMGAP00000012468  .........ADQV.....MASFKIL............-A.......................G.D.KNYITVDELRRE
ENSMGAP00000010049  .........YQFL.....QRLFEKH............DK.......................D.Q.DGALSPAELQNF
ENSMGAP00000010311  .........----.....-------............--.......................-.-.------------
ENSMGAP00000013157  .........PAAL.....QYIFKLL............DI.......................E.N.KGYLNVFSLNYF
ENSMGAP00000006617  .........----.....-------............--.......................-.-.------------
ENSMGAP00000004752  .........----.....-------............--.......................-.-.------------
ENSMGAP00000003256  .........EDKL.....EFMFRLY............DT.......................D.G.NGILDSSELDRI
ENSMGAP00000010056  .........DALF.....IVAFQLF............DK.......................T.G.KGEVTFEDAKQV
ENSMGAP00000011434  .........FDML.....LEAFRHY............DK.......................N.G.DGMIDKNDLRKS
ENSMGAP00000006435  .........----.....-------............--.......................-.-.------------
ENSMGAP00000001668  .........DDAS.....RFAYLVA............-K.......................P.S.CGYLEQEDFIPL
ENSMGAP00000011498  .........----.....-------............--.......................-.-.------------
ENSMGAP00000004753  .........----.....-------............--.......................-.-.------------
ENSMGAP00000005636  .........----.....-------............--.......................-.-.------------
ENSMGAP00000015905  .........A---.....-KSFRKQ............--.......................-.-.---INKKEGICA
ENSMGAP00000019081  .........RTEL.....LEAFGKI............DT.......................D.N.TGYILHDELYKL
ENSMGAP00000000625  .........----.....-------............--.......................-.-.------------
ENSMGAP00000007021  .........EFDP.....KTFFKLH............DV.......................N.N.DRFLDEQELEAL
ENSMGAP00000017212  .........----.....-------............--.......................-.-.------------
ENSMGAP00000002213  .........AKTF.....RKA----............--.......................-.-.---INRKEGICA
ENSMGAP00000013577  .........----.....-------............--.......................-.-.-GYVSGSRLAVL
ENSMGAP00000000632  .........----.....-------............--.......................-.-.------------
ENSMGAP00000005432  .........QRNF.....EIAFKMF............DL.......................N.G.DGEVDMEEFEQV
ENSMGAP00000005269  .........KLEM.....TAVADIF............DR.......................D.G.DGYIDYYEFVAA
ENSMGAP00000004749  .........----.....-------............--.......................-.-.------------
ENSMGAP00000014571  .........CDLL.....YKAFSLV............DK.......................G.D.TRVIKTLEFQQV
ENSMGAP00000014702  .........RLEM.....SAVADIF............DR.......................D.G.DGYIDYYEFVAA
ENSMGAP00000015629  .........YDDA.....AKFVHLL............MN.......................P.G.CNYLVQEDFIPF
ENSMGAP00000010757  .........QELQ.....LHYFKMH............DY.......................D.G.NNLLDGLELATA
ENSMGAP00000012156  .........HAGF.....RIAFNMF............DT.......................D.G.NEMVDKKEFLVL
ENSMGAP00000001384  .........----.....-------............--.......................-.-.------------
ENSMGAP00000014541  .........EEKL.....QEVCEHL............GI.......................T.R.DGHLNRKKLISI
ENSMGAP00000001307  .........SSEF.....MEAWRRY............DT.......................D.R.SGYIEANELKGF
ENSMGAP00000002904  .........RKKL.....MVIFSKV............DI.......................D.N.DKKISAKEMQRW
ENSMGAP00000004752  .........----.....-------............--.......................-.-.------------
ENSMGAP00000012493  .........SEDF.....MQTWRKY............DS.......................D.H.SGFIDSEELKSF
ENSMGAP00000009006  .........RKDL.....KDLFDVY............AV.......................P.C.N-----------
ENSMGAP00000002845  .........TEKL.....KLLYKMH............--.......................-.-.------------
ENSMGAP00000013352  .........PEDV.....KKVFHIL............DK.......................D.R.SGFIEEEELK--
ENSMGAP00000011218  .........GPRS.....HESFQEM............DL.......................N.D.DWKLSKQEVKIY
ENSMGAP00000008109  .........----.....-----HF............DP.......................D.N.TGYISTEKFRSL
ENSMGAP00000013184  .........----.....-------............--.......................-.-.------------
ENSMGAP00000007241  .........TDKL.....KVLYKLH............--.......................-.-.------------
ENSMGAP00000007078  .........----.....-NLFEQM............DL.......................N.K.DGQIPADEFSTF
ENSMGAP00000016033  .........LEDF.....SIAMQMF............-T.......................V.A.NRPVKRAEFKRA
ENSMGAP00000009321  .........----.....-------............--.......................-.-.------------
ENSMGAP00000011486  .........---F.....LDSFCVL............DK.......................D.Q.DGLISKEEMMAY
ENSMGAP00000008771  .........---V.....EELFQHL............DA.......................N.R.DGHLSSSELAQV
ENSMGAP00000009284  .........LEKA.....RELFQLC............DK.......................D.E.KGFITKVDMQRL
ENSMGAP00000012705  .........----.....PNLFEEI............DQ.......................N.H.DGEVLLEEFSEY
ENSMGAP00000008188  .........TDKL.....KLLFKLH............--.......................-.-.------------
ENSMGAP00000015472  qlkknsfenFEQL.....SIVLGYN............DH.......................E.K.CGVLPYETCRTI
ENSMGAP00000008783  .........--SQ.....MDFFNLL............DH.......................N.Q.DGQLQLKEVLTH
ENSMGAP00000001658  .........---V.....DQMFHYF............DS.......................D.S.NGLVDTNELSQV
ENSMGAP00000012256  .........----.....-DAFKEY............DP.......................D.G.KGIISKRDFHKA
ENSMGAP00000013520  .........---L.....WDFFRKI............DK.......................D.G.NMKIPVSDFRRA
ENSMGAP00000004374  .........MKTI.....RQAFQVLgye.........NE.......................N.G.DKVIDRGDLLSL
ENSMGAP00000000986  .........EPDWvtte.REQFSDFr...........DL.......................N.K.DGKMDKEEIQHW
ENSMGAP00000001945  .........SEEL.....WELFSGI............DR.......................R.H.SDNVDTEKLCDY
ENSMGAP00000002062  .........RERA.....RAAFLAL............DQ.......................D.G.SGFIGEGECHKA
ENSMGAP00000016033  .........QTGF.....QIAFKML............DT.......................D.G.NEQVEKKEFFKM
ENSMGAP00000012862  .........---F.....PFSFCVM............AK.......................D.S.EGLISRDEITAY
ENSMGAP00000005519  .........----.....------F............DL.......................N.N.QGEIDLMSVKRM
ENSMGAP00000015047  .........YSNI.....REALLRC............DK.......................D.E.SGFLNKAKFLSV
ENSMGAP00000005432  .........VDTA.....LSFYHMA............G-.......................-.-.-ASLDKVTMQQV
ENSMGAP00000013736  .........SLEL.....SFPLRNV............DR.......................P.E.LCQVSLYDFQKF
ENSMGAP00000011175  .........---D.....SQIFKKF............DT.......................D.G.DEKYSLEELRLA
ENSMGAP00000012508  .........EELN.....ITILKAM............DK.......................T.K.KDYQEASNLEQF
ENSMGAP00000008257  .........----.....-------............--.......................-.-.------------
ENSMGAP00000013184  .........----.....-------............--.......................-.-.------------
ENSMGAP00000010402  .........-EHA.....RQAFALK............DK.......................N.K.SGMITGLDFSDV
ENSMGAP00000000248  .........EEEL.....ENLFHTI............DS.......................D.N.TNNVDTKELCDY
ENSMGAP00000007611  .........DAEI.....EAIFTKY............DQ.......................D.G.DQELTEHE----
ENSMGAP00000005594  .........GAFV.....KENFDELcwtltakknykpDR.......................N.G.NSVVSHQDAFKL
ENSMGAP00000008022  .........----.....-------............--.......................-.-.NGYIEGKELDNF
ENSMGAP00000010056  .........MELI.....RKIYSTL............AG.......................NrK.DVEVTKEEFVLA
ENSMGAP00000006995  .........LDEFkkdssVFILGNT............DR.......................P.D.ASAVHLHDFQRF
ENSMGAP00000003057  .........--NL.....QMYDRVI............DF.......................D.E.NTVLEDQE----
ENSMGAP00000007897  .........EEKT.....KYIFSLF............SN.......................E.S.GSYVVRDEMEKM
ENSMGAP00000004556  .........-NRQ.....EWTFTLY............DF.......................D.N.NGRVTREDITSL
ENSMGAP00000014571  .........----.....---FKDI............DS.......................S.K.DNTISKEVFWNI
ENSMGAP00000008494  .........----.....-------............--.......................-.-.-EYLTPNEMREL
ENSMGAP00000007615  .........EHEI.....TAAFSRF............DK.......................D.G.NRILDEEEQQQM
ENSMGAP00000003099  .........----.....-------............--.......................-.-.------------
ENSMGAP00000008028  .........SEQA.....RRVFQTY............DP.......................E.D.NGFIPDTLLEDV
ENSMGAP00000013774  .........EEKL.....TRIAEAL............DE.......................N.K.DGKIDIDNVVKV
ENSMGAP00000012335  .........EEVW.....AICKENF............DM.......................-.-.------------
ENSMGAP00000006327  .........----.....-------............--.......................-.-.------------
ENSMGAP00000013157  .........LHQT.....RIGLSLY............DV.......................A.G.QGYLRESDLENY
ENSMGAP00000015686  .........NEKI.....KFLYKLH............--.......................-.-.------------
ENSMGAP00000006220  .........ELLL.....EALFEKW............DI.......................N.A.SGFLEMKEVEAA
ENSMGAP00000007527  .........----.....-------............--.......................-.-.------------
ENSMGAP00000012156  .........-EVL.....EIEFLSY............-S.......................N.G.MNTISEEDFAHI
ENSMGAP00000004008  .........--DL.....LMAFVYF............DQ.......................S.H.CGYLLEKDMEEI


                             130                                                                    
                               |                                                                    
d1bjfa_               VQAIYKMVSSVMK.................................................................
ENSMGAP00000013771  MT-----------.................................................................
ENSMGAP00000010818  MT-----------.................................................................
ENSMGAP00000014820  VQAIYKMVSSVMK.................................................................
ENSMGAP00000012925  VQAIYKMVSSVMK.................................................................
ENSMGAP00000006499  IN--LKQRDPRLN.................................................................
ENSMGAP00000006483  LNEH--QRDPRLN.................................................................
ENSMGAP00000014837  IEAIYKMVGTVIM.................................................................
ENSMGAP00000007665  RA-----------.................................................................
ENSMGAP00000015504  -------------.................................................................
ENSMGAP00000012038  VK-----------.................................................................
ENSMGAP00000017351  VK-----------.................................................................
ENSMGAP00000005416  IEAIYKMVGTVIM.................................................................
ENSMGAP00000010422  MKSIYDMMGKYTY.................................................................
ENSMGAP00000010973  AK-----------.................................................................
ENSMGAP00000011986  LRQE---------.................................................................
ENSMGAP00000003311  IN-----------.................................................................
ENSMGAP00000013173  MKAIYDMMGKCTY.................................................................
ENSMGAP00000008329  LR-----------.................................................................
ENSMGAP00000001399  -------------.................................................................
ENSMGAP00000005345  AK-----------.................................................................
ENSMGAP00000009666  -------------.................................................................
ENSMGAP00000001336  VKAIYDMMGKYTY.................................................................
ENSMGAP00000007710  LT-----------.................................................................
ENSMGAP00000011308  LE-----------.................................................................
ENSMGAP00000008667  LT-----------.................................................................
ENSMGAP00000017345  LKVEQKMSN----.................................................................
ENSMGAP00000001713  LENEQKMTN----.................................................................
ENSMGAP00000008800  LS-----------.................................................................
ENSMGAP00000017221  LE-----------.................................................................
ENSMGAP00000003113  LYETQQEEDAV--.................................................................
ENSMGAP00000002095  IKAIRAING----.................................................................
ENSMGAP00000003256  -------------.................................................................
ENSMGAP00000005178  VDAIYQMVGNTVE.................................................................
ENSMGAP00000004306  LK-------MMVG.................................................................
ENSMGAP00000003741  MR-----------.................................................................
ENSMGAP00000012748  LK-----------.................................................................
ENSMGAP00000018907  FS-----------.................................................................
ENSMGAP00000004316  IKAIRAINRC---.................................................................
ENSMGAP00000004292  VESIYKLKKVCRS.................................................................
ENSMGAP00000018253  LT-----------.................................................................
ENSMGAP00000011383  LEAE---------.................................................................
ENSMGAP00000000614  LQ-----------.................................................................
ENSMGAP00000008865  MK-----------.................................................................
ENSMGAP00000009812  LT-----------.................................................................
ENSMGAP00000015231  FAAIQAINGQTNM.................................................................
ENSMGAP00000003121  LEVE---------.................................................................
ENSMGAP00000004318  -------------.................................................................
ENSMGAP00000002012  -------------.................................................................
ENSMGAP00000014898  -------------.................................................................
ENSMGAP00000003792  LA-----------.................................................................
ENSMGAP00000007259  LEAE---------.................................................................
ENSMGAP00000000101  LQ-----------.................................................................
ENSMGAP00000004099  IQ-----------.................................................................
ENSMGAP00000011104  -------------.................................................................
ENSMGAP00000015217  -------------.................................................................
ENSMGAP00000015504  LHDSIQIPRQL--.................................................................
ENSMGAP00000014359  LKKEQFKTEDAET.................................................................
ENSMGAP00000001935  YL-----------.................................................................
ENSMGAP00000003079  LM-----------.................................................................
ENSMGAP00000002363  LA-----------.................................................................
ENSMGAP00000011677  LR-------MMVG.................................................................
ENSMGAP00000009004  LKNSLLKQPSEED.................................................................
ENSMGAP00000008132  YL-----------.................................................................
ENSMGAP00000019273  -------------.................................................................
ENSMGAP00000001471  LV-----------.................................................................
ENSMGAP00000010396  LT-----------.................................................................
ENSMGAP00000005510  VQ-----------.................................................................
ENSMGAP00000005093  LM-----------.................................................................
ENSMGAP00000014898  LKEVL-KLPTAVF.................................................................
ENSMGAP00000012414  -------------.................................................................
ENSMGAP00000003667  LN-------KLTR.................................................................
ENSMGAP00000009666  -------------.................................................................
ENSMGAP00000005687  VN-------KLTR.................................................................
ENSMGAP00000011104  LREVL-KLPTAVF.................................................................
ENSMGAP00000015388  LM-----------.................................................................
ENSMGAP00000000479  LRSFIEISNN---.................................................................
ENSMGAP00000013677  -------------.................................................................
ENSMGAP00000011946  MT-----------.................................................................
ENSMGAP00000011948  MT-----------.................................................................
ENSMGAP00000015556  -------------.................................................................
ENSMGAP00000003279  LR-----------.................................................................
ENSMGAP00000005348  IQ-----------.................................................................
ENSMGAP00000012873  KRFLRKK------.................................................................
ENSMGAP00000006199  LK-----------.................................................................
ENSMGAP00000014876  LL-----------.................................................................
ENSMGAP00000007897  MVALLEVWKDNRT.................................................................
ENSMGAP00000010932  VN---CLTGQGEE.................................................................
ENSMGAP00000006099  -------------.................................................................
ENSMGAP00000000986  TYGYYLENPEEFQdatdrhsfkkmlprderrfktadldgdsaatreeftaflh.........................
ENSMGAP00000018863  AR-----------.................................................................
ENSMGAP00000010191  WK----LFSS---.................................................................
ENSMGAP00000011498  FL-----------.................................................................
ENSMGAP00000005636  -------------.................................................................
ENSMGAP00000014876  -------------.................................................................
ENSMGAP00000013745  FN-----------.................................................................
ENSMGAP00000005636  FM-----------.................................................................
ENSMGAP00000019260  -------------.................................................................
ENSMGAP00000010308  -------------.................................................................
ENSMGAP00000015629  YEEQCQKLDNMAI.................................................................
ENSMGAP00000007270  LK-----------.................................................................
ENSMGAP00000015388  -------------.................................................................
ENSMGAP00000001784  LY-----------.................................................................
ENSMGAP00000015545  WK----IFSS---.................................................................
ENSMGAP00000010427  IA---QMMHVAEY.................................................................
ENSMGAP00000000998  -------------.................................................................
ENSMGAP00000012493  LKDLCEKNKK---.................................................................
ENSMGAP00000001668  YEEQCERMEVMGI.................................................................
ENSMGAP00000011498  -------------.................................................................
ENSMGAP00000010185  LY-----------.................................................................
ENSMGAP00000017513  LT-----------.................................................................
ENSMGAP00000013797  -------------.................................................................
ENSMGAP00000000945  LQRFE--------.................................................................
ENSMGAP00000002904  MD-----------.................................................................
ENSMGAP00000008628  -------------.................................................................
ENSMGAP00000014571  LH-----------.................................................................
ENSMGAP00000003057  IV-----------.................................................................
ENSMGAP00000010332  LDELMSGNPHLEK.................................................................
ENSMGAP00000019524  LKNFS--------.................................................................
ENSMGAP00000005528  -------------.................................................................
ENSMGAP00000010575  LQACLRESEI---.................................................................
ENSMGAP00000001307  LKDLYEKNK----.................................................................
ENSMGAP00000017273  -------------.................................................................
ENSMGAP00000017264  LK----IPPDCT-.................................................................
ENSMGAP00000012328  LP-----------.................................................................
ENSMGAP00000010402  FEQTTIHHQI---.................................................................
ENSMGAP00000011891  -------------.................................................................
ENSMGAP00000008022  VKDMMELVKP---.................................................................
ENSMGAP00000011257  YC--AKKHPL---.................................................................
ENSMGAP00000008628  LI-----------.................................................................
ENSMGAP00000012468  LP-----------.................................................................
ENSMGAP00000010049  FS----VFPC---.................................................................
ENSMGAP00000010311  -------------.................................................................
ENSMGAP00000013157  FRAIQEQMKIHGQ.................................................................
ENSMGAP00000006617  -------------.................................................................
ENSMGAP00000004752  -------------.................................................................
ENSMGAP00000003256  IN---QMVHVAEY.................................................................
ENSMGAP00000010056  FGQTTIHQHIPFN.................................................................
ENSMGAP00000011434  CF-----------.................................................................
ENSMGAP00000006435  -------------.................................................................
ENSMGAP00000001668  LQDVVETHPGLTF.................................................................
ENSMGAP00000011498  -------------.................................................................
ENSMGAP00000004753  -------------.................................................................
ENSMGAP00000005636  -------------.................................................................
ENSMGAP00000015905  IGGTSEQSSAGTQ.................................................................
ENSMGAP00000019081  LT-----------.................................................................
ENSMGAP00000000625  -------------.................................................................
ENSMGAP00000007021  FTKELEKVYDPKN.................................................................
ENSMGAP00000017212  -------------.................................................................
ENSMGAP00000002213  IGGTSELSSEGTQ.................................................................
ENSMGAP00000013577  MK-----------.................................................................
ENSMGAP00000000632  -------------.................................................................
ENSMGAP00000005432  QSIIRSQTSMGMRhrdrsttgntlntlktgfnsalttyffgadlkgkltishfldfqrklqhdilkleferhdpvdgr
ENSMGAP00000005269  LH-----------.................................................................
ENSMGAP00000004749  -------------.................................................................
ENSMGAP00000014571  PD-----------.................................................................
ENSMGAP00000014702  LH-----------.................................................................
ENSMGAP00000015629  LQDVVNSHPGLSF.................................................................
ENSMGAP00000010757  ISHVHKEEGGENT.................................................................
ENSMGAP00000012156  QEIFRKKNEKRERkgdeekrtmlriqlygyhtptnsvlktegedlvprsywdtlrrstsqalfsdlaertddiassls
ENSMGAP00000001384  -------------.................................................................
ENSMGAP00000014541  CE-----------.................................................................
ENSMGAP00000001307  LS-----------.................................................................
ENSMGAP00000002904  IMEKT--------.................................................................
ENSMGAP00000004752  -------------.................................................................
ENSMGAP00000012493  LKDLL--------.................................................................
ENSMGAP00000009006  -----------RSgleptplytnlkidensigfqpdldlltrnvsdlglfiksrqqlsdnqrqisdaiaaasivtngt
ENSMGAP00000002845  -------------.................................................................
ENSMGAP00000013352  -------------.................................................................
ENSMGAP00000011218  LKKEFEKHGA---.................................................................
ENSMGAP00000008109  LQ-----------.................................................................
ENSMGAP00000013184  -------------.................................................................
ENSMGAP00000007241  -------------.................................................................
ENSMGAP00000007078  IKTQVAEGKGRLM.................................................................
ENSMGAP00000016033  VK-----------.................................................................
ENSMGAP00000009321  -------------.................................................................
ENSMGAP00000011486  FL----RAKSQFQ.................................................................
ENSMGAP00000008771  MKKE---------.................................................................
ENSMGAP00000009284  QS-----------.................................................................
ENSMGAP00000012705  IQAQVDSGKGKLA.................................................................
ENSMGAP00000008188  -------------.................................................................
ENSMGAP00000015472  CK-----------.................................................................
ENSMGAP00000008783  TR-----------.................................................................
ENSMGAP00000001658  IKRD---------.................................................................
ENSMGAP00000012256  ME-----------.................................................................
ENSMGAP00000013520  MM-----------.................................................................
ENSMGAP00000004374  LQ-----------.................................................................
ENSMGAP00000000986  IL-----------.................................................................
ENSMGAP00000001945  FSA----------.................................................................
ENSMGAP00000002062  QH-----------.................................................................
ENSMGAP00000016033  QRIIGKEDDLK--.................................................................
ENSMGAP00000012862  FM-----------.................................................................
ENSMGAP00000005519  ME-----------.................................................................
ENSMGAP00000015047  CD-----------.................................................................
ENSMGAP00000005432  AR-----------.................................................................
ENSMGAP00000013736  LL-----------.................................................................
ENSMGAP00000011175  L------------.................................................................
ENSMGAP00000012508  VTRF---------.................................................................
ENSMGAP00000008257  -M-----------.................................................................
ENSMGAP00000013184  -------------.................................................................
ENSMGAP00000010402  MV-----------.................................................................
ENSMGAP00000000248  FA-----------.................................................................
ENSMGAP00000007611  -------------.................................................................
ENSMGAP00000005594  WCLFNFLSED---.................................................................
ENSMGAP00000008022  FHHLLEKL-----.................................................................
ENSMGAP00000010056  AQ-----------.................................................................
ENSMGAP00000006995  LL-----------.................................................................
ENSMGAP00000003057  -------------.................................................................
ENSMGAP00000007897  LH-----------.................................................................
ENSMGAP00000004556  LHTIYEVVDASVN.................................................................
ENSMGAP00000014571  CN-----------.................................................................
ENSMGAP00000008494  VVQKLPHLGKCVG.................................................................
ENSMGAP00000007615  KH-----------.................................................................
ENSMGAP00000003099  -------------.................................................................
ENSMGAP00000008028  MK-----------.................................................................
ENSMGAP00000013774  VE-----------.................................................................
ENSMGAP00000012335  -------------.................................................................
ENSMGAP00000006327  -------------.................................................................
ENSMGAP00000013157  ILELIPTLPQLDG.................................................................
ENSMGAP00000015686  -------------.................................................................
ENSMGAP00000006220  MN-----------.................................................................
ENSMGAP00000007527  -------------.................................................................
ENSMGAP00000012156  LLRYT--------.................................................................
ENSMGAP00000004008  LY-----------.................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  iterqfgsmllaysgvqskkltvmlkqlkkhfqdgegltfeevenfftflknindvdtalsfyhmagasldkvtmqqv
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  dttllvhffgkkgkaelnfedfyrfmdnlqtevleieflsysngmntiseedfahillrytnventssylenmrcrip
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  gvestslgvfgvgiqqlndflv........................................................
ENSMGAP00000002845  ..............................................................................
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  ..............................................................................
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                               140                  
                                                                                 |                  
d1bjfa_               ...............................................M....PEDE..STPEKR.........TEKI.
ENSMGAP00000013771  ...............................................-....NLGE..KLTDEE.........VDEM.
ENSMGAP00000010818  ...............................................-....NLGE..KLTDEE.........VDEM.
ENSMGAP00000014820  ...............................................M....PEDE..STPEKR.........TDKI.
ENSMGAP00000012925  ...............................................M....PEDE..STPEKR.........TEKI.
ENSMGAP00000006499  ...............................................E....ILYP..PLKQEQ.........VQQL.
ENSMGAP00000006483  ...............................................E....ILFP..FYDTKR.........AMQI.
ENSMGAP00000014837  ...............................................M....KMNEdgLTPEQR.........VDKI.
ENSMGAP00000007665  ...............................................-....--SL..VPMEHC.........ITRF.
ENSMGAP00000015504  ...............................................-....----..------.........----.
ENSMGAP00000012038  ...............................................-....DAGF..RLNNQL.........YDII.
ENSMGAP00000017351  ...............................................-....DAGF..RLNNQL.........YDII.
ENSMGAP00000005416  ...............................................Mrm..NQDG..LTPQQR.........VDKI.
ENSMGAP00000010422  ...............................................P....AMRE..EAPREH.........VENF.
ENSMGAP00000010973  ...............................................-....ELGE..NLTDEE.........LQEM.
ENSMGAP00000011986  ...............................................-....QLEE..EGTEEL.........AMEL.
ENSMGAP00000003311  ...............................................-....----..------.........----.
ENSMGAP00000013173  ...............................................P....VLKE..DTPRQH.........VETF.
ENSMGAP00000008329  ...............................................-....ATGE..HVTEEE.........IEDL.
ENSMGAP00000001399  ...............................................-....----..------.........----.
ENSMGAP00000005345  ...............................................-....ELGE..NLTDEE.........LQEM.
ENSMGAP00000009666  ...............................................-....----..------.........----.
ENSMGAP00000001336  ...............................................P....VLKE..DAPRQH.........VEVF.
ENSMGAP00000007710  ...............................................-....GFGY..RLSDQF.........YDTL.
ENSMGAP00000011308  ...............................................-....SAGF..KLNNKL.........HQVV.
ENSMGAP00000008667  ...............................................-....NMGF..RLSPQA.........VSAI.
ENSMGAP00000017345  ...............................................-....----..-VTPEY.........CLDI.
ENSMGAP00000001713  ...............................................-....----..-VTREH.........CLEI.
ENSMGAP00000008800  ...............................................-....EAGF..VLNNQV.........QQSI.
ENSMGAP00000017221  ...............................................-....AAGF..KLNGQL.........HQII.
ENSMGAP00000003113  ...............................................-....----..------.........----.
ENSMGAP00000002095  ...............................................-....GDHE..TSAEEF.........TNRV.
ENSMGAP00000003256  ...............................................-....----..------.........----.
ENSMGAP00000005178  ...............................................L....PEEE..NTPEKR.........VDRI.
ENSMGAP00000004306  ...............................................N....NLKD..TQLQQI.........VDKT.
ENSMGAP00000003741  ...............................................K....LLGQ..QLNYRE.........VDEI.
ENSMGAP00000012748  ...............................................-....AAGY..QLNNYL.........LQLI.
ENSMGAP00000018907  ...............................................-....QMGY..NLSPQF.........SQLL.
ENSMGAP00000004316  ...............................................-....-NEA..MTAEEF.........TNMV.
ENSMGAP00000004292  ...............................................XeveeRTPL..LTPEEV.........VDRI.
ENSMGAP00000018253  ...............................................-....TMGD..RFTDEE.........VDEM.
ENSMGAP00000011383  ...............................................-....QGMA..HVTEEI.........SLEI.
ENSMGAP00000000614  ...............................................-....ATGE..TITEDD.........IEEL.
ENSMGAP00000008865  ...............................................K....LLGQ..QVGHRD.........IEEI.
ENSMGAP00000009812  ...............................................-....TMGD..RFTDEE.........VDEL.
ENSMGAP00000015231  ...............................................-....----..-TAEEF.........TNMI.
ENSMGAP00000003121  ...............................................-....QGME..GVTEEK.........CLEI.
ENSMGAP00000004318  ...............................................-....----..------.........----.
ENSMGAP00000002012  ...............................................-....----..------.........----.
ENSMGAP00000014898  ...............................................-....----..------.........----.
ENSMGAP00000003792  ...............................................-....TLGE..KMTEEE.........VEEL.
ENSMGAP00000007259  ...............................................-....QGVT..HITEEM.........CLDI.
ENSMGAP00000000101  ...............................................-....DQGE..EGTLHQ.........ACAI.
ENSMGAP00000004099  ...............................................S....ALG-..-LPDLD.........VSNL.
ENSMGAP00000011104  ...............................................-....----..------.........----.
ENSMGAP00000015217  ...............................................-....----..------.........----.
ENSMGAP00000015504  ...............................................-....----..------.........----.
ENSMGAP00000014359  ...............................................T....ALEV..ILKYEP.........IDE-.
ENSMGAP00000001935  ...............................................-....----..DKNEPC.........TRAF.
ENSMGAP00000003079  ...............................................-....TQAD..RFSQEE.........INQM.
ENSMGAP00000002363  ...............................................-....TLGE..RLTEEE.........VDKL.
ENSMGAP00000011677  ...............................................V....NISD..EQLGSI.........ADRT.
ENSMGAP00000009004  ...............................................P....DEGI..K---DL.........VDIA.
ENSMGAP00000008132  ...............................................-....----..DKYEPC.........VKPL.
ENSMGAP00000019273  ...............................................-....----..------.........----.
ENSMGAP00000001471  ...............................................-....TLGE..KMTESE.........VEQL.
ENSMGAP00000010396  ...............................................-....RLGE..KLSEEE.........VDDL.
ENSMGAP00000005510  ...............................................-....ETGI..SLSNEV.........CNLM.
ENSMGAP00000005093  ...............................................-....TQGE..RFSQEE.........IDQM.
ENSMGAP00000014898  ...............................................E....GPSF..GYTEHS.........VRTC.
ENSMGAP00000012414  ...............................................-....----..------.........----.
ENSMGAP00000003667  ...............................................E....ELTA..EEITLV.........CEKV.
ENSMGAP00000009666  ...............................................-....----..------.........----.
ENSMGAP00000005687  ...............................................N....ELTP..EEVSLA.........CEKV.
ENSMGAP00000011104  ...............................................E....GPSF..GYTEQS.........AKSC.
ENSMGAP00000015388  ...............................................-....QSS-..-LPQAQ.........LATI.
ENSMGAP00000000479  ...............................................-....CLSR..EQAEQV.........TESM.
ENSMGAP00000013677  ...............................................-....----..------.........----.
ENSMGAP00000011946  ...............................................-....EEGE..PFTEEE.........MEEM.
ENSMGAP00000011948  ...............................................-....EEGE..PFTEEE.........MEEM.
ENSMGAP00000015556  ...............................................-....----..------.........----.
ENSMGAP00000003279  ...............................................-....DLGV..KISEQQ.........AEKI.
ENSMGAP00000005348  ...............................................-....TAGL..PVNEQI.........LRLM.
ENSMGAP00000012873  ...............................................-....----..SKPKKC.........VKKF.
ENSMGAP00000006199  ...............................................-....ILGI..NISEKQ.........AEKI.
ENSMGAP00000014876  ...............................................-....QSN-..-LSQTQ.........LATI.
ENSMGAP00000007897  ...............................................Dki..PELD..MDLSEI.........VEDI.
ENSMGAP00000010932  ...............................................A....RLSS..AEMEQL.........ICNV.
ENSMGAP00000006099  ...............................................-....----..------.........----.
ENSMGAP00000000986  ...............................................P....EEFE..HMKNIV.........VLET.
ENSMGAP00000018863  ...............................................-....ELGE..NMSDEE.........LRAM.
ENSMGAP00000010191  ...............................................-....HMNI..ELTDDG.........INDL.
ENSMGAP00000011498  ...............................................-....KTG-..-LPSAL.........LAHI.
ENSMGAP00000005636  ...............................................-....----..------.........----.
ENSMGAP00000014876  ...............................................-....----..------.........----.
ENSMGAP00000013745  ...............................................-....SVLP..KLSERI.........IIEA.
ENSMGAP00000005636  ...............................................-....HSG-..-LSQNL.........LAHI.
ENSMGAP00000019260  ...............................................-....----..------.........----.
ENSMGAP00000010308  ...............................................-....----..------.........----.
ENSMGAP00000015629  ...............................................E....PLPF..E---DC.........LCQM.
ENSMGAP00000007270  ...............................................T....AMG-..-VSQIN.........VTHL.
ENSMGAP00000015388  ...............................................-....----..------.........----.
ENSMGAP00000001784  ...............................................H....AFRD..HLTMKD.........IENI.
ENSMGAP00000015545  ...............................................-....YLGI..HSHDEA.........IDKL.
ENSMGAP00000010427  ...............................................L....EWDI..TELSPI.........LHEM.
ENSMGAP00000000998  ...............................................-....----..------.........----.
ENSMGAP00000012493  ...............................................-....----..------.........----.
ENSMGAP00000001668  ...............................................E....PLPF..Q---DL.........LCQM.
ENSMGAP00000011498  ...............................................-....----..------.........----.
ENSMGAP00000010185  ...............................................D....TFCE..HLSMKD.........IENI.
ENSMGAP00000017513  ...............................................-....----..------.........----.
ENSMGAP00000013797  ...............................................-....----..------.........----.
ENSMGAP00000000945  ...............................................-....CGAR..VLTASE.........TKTF.
ENSMGAP00000002904  ...............................................-....PMNE..YNALNE.........AKQM.
ENSMGAP00000008628  ...............................................-....----..------.........----.
ENSMGAP00000014571  ...............................................-....EYKI..NLSEEE.........LFNI.
ENSMGAP00000003057  ...............................................-....PNNQ..GIAQEE.........ALHL.
ENSMGAP00000010332  ...............................................Eslr.AIAE..GAMLEA.........ASAC.
ENSMGAP00000019524  ...............................................-....SSAR..VLTSAE.........TKAF.
ENSMGAP00000005528  ...............................................-....----..------.........----.
ENSMGAP00000010575  ...............................................-....SLPP..QRLHDM.........ARVL.
ENSMGAP00000001307  ...............................................-....----..------.........----.
ENSMGAP00000017273  ...............................................-....----..------.........----.
ENSMGAP00000017264  ...............................................-....TELN..HHAYLF.........LQSI.
ENSMGAP00000012328  ...............................................-....----..------.........----.
ENSMGAP00000010402  ...............................................-....PFN-..----WD.........CEFI.
ENSMGAP00000011891  ...............................................-....----..------.........----.
ENSMGAP00000008022  ...............................................-....SISG..VDLDKF.........RQIL.
ENSMGAP00000011257  ...............................................-....VLAG..KATEEE.........IKLS.
ENSMGAP00000008628  ...............................................-....----..------.........----.
ENSMGAP00000012468  ...............................................-....----..------.........----.
ENSMGAP00000010049  ...............................................M....PWGP..ELYNTV.........C---.
ENSMGAP00000010311  ...............................................-....----..------.........----.
ENSMGAP00000013157  ...............................................E....PVSF..Q---DV.........KDEI.
ENSMGAP00000006617  ...............................................-....----..------.........----.
ENSMGAP00000004752  ...............................................-....----..------.........----.
ENSMGAP00000003256  ...............................................L....EWDS..TELKPI.........LKAM.
ENSMGAP00000010056  ...............................................W....N---..------.........SEFV.
ENSMGAP00000011434  ...............................................-....QLNL..NLDSEL.........LDSL.
ENSMGAP00000006435  ...............................................-....----..------.........----.
ENSMGAP00000001668  ...............................................LkdapEFHS..RYITTV.........IQRI.
ENSMGAP00000011498  ...............................................-....----..------.........----.
ENSMGAP00000004753  ...............................................-....----..------.........----.
ENSMGAP00000005636  ...............................................-....----..------.........----.
ENSMGAP00000015905  ...............................................H....SYSE..EEKYAF.........VNWI.
ENSMGAP00000019081  ...............................................-....TEGE..KMTLDE.........VNAI.
ENSMGAP00000000625  ...............................................-....----..------.........----.
ENSMGAP00000007021  ...............................................E....EDDM..VEMEEErlrm.....REHV.
ENSMGAP00000017212  ...............................................-....----..------.........----.
ENSMGAP00000002213  ...............................................H....SYSE..EEKYAF.........VNWI.
ENSMGAP00000013577  ...............................................-....----..------.........----.
ENSMGAP00000000632  ...............................................-....----..------.........----.
ENSMGAP00000005432  .............................................arT....VAKV..ELSDHV.........CDVV.
ENSMGAP00000005269  ...............................................-....----..------.........----.
ENSMGAP00000004749  ...............................................-....----..------.........----.
ENSMGAP00000014571  ...............................................-....RFCF..KLSHKQ.........FRNL.
ENSMGAP00000014702  ...............................................-....----..------.........----.
ENSMGAP00000015629  ...............................................LkeasEFHS..RYITTV.........IQRI.
ENSMGAP00000010757  ...............................................Q....AMKE..EELISL.........IDDV.
ENSMGAP00000012156  eekgipfexfrsffqflnnledftiamqmynfasrsigqdefkravyV....ATGV..KLSPHL.........VNTV.
ENSMGAP00000001384  ...............................................-....----..------.........----.
ENSMGAP00000014541  ...............................................-....QFGL..QHIDGE.........VLEE.
ENSMGAP00000001307  ...............................................-....----..------.........----.
ENSMGAP00000002904  ...............................................-....DEHF..QEAVEE.........NKMH.
ENSMGAP00000004752  ...............................................-....----..------.........----.
ENSMGAP00000012493  ...............................................-....----..------.........----.
ENSMGAP00000009006  ...............................................N....CQGE..HCTYDE.........ILSI.
ENSMGAP00000002845  ...............................................-....----..------.........----.
ENSMGAP00000013352  ...............................................-....----..------.........----.
ENSMGAP00000011218  ...............................................-....VVND..TQHDAL.........VEDI.
ENSMGAP00000008109  ...............................................-....RHGS..ELDPHK.........LEVL.
ENSMGAP00000013184  ...............................................-....----..------.........----.
ENSMGAP00000007241  ...............................................-....----..------.........----.
ENSMGAP00000007078  ...............................................P....SSD-..--PEKV.........IADM.
ENSMGAP00000016033  ...............................................V....ATGQ..ELSDNI.........LDTI.
ENSMGAP00000009321  ...............................................-....----..------.........----.
ENSMGAP00000011486  ...............................................C....KMGP..------.........----.
ENSMGAP00000008771  ...............................................-....DLED..DLLDCT.........LEDL.
ENSMGAP00000009284  ...............................................-....ELP-..-LTLEQ.........LETV.
ENSMGAP00000012705  ...............................................P....GFDF..E---KI.........VKNM.
ENSMGAP00000008188  ...............................................-....----..------.........----.
ENSMGAP00000015472  ...............................................-....SFKL..PLSDDL.........LQTI.
ENSMGAP00000008783  ...............................................L....GNGR..WMTPEN.........IREM.
ENSMGAP00000001658  ...............................................-....ELGK..DLSDCS.........LFDL.
ENSMGAP00000012256  ...............................................-....-SHK..HYTQSE.........TEFL.
ENSMGAP00000013520  ...............................................Q....QSNI..QLDRVQ.........IVEL.
ENSMGAP00000004374  ...............................................-....CRGE..HMMEDE.........LALC.
ENSMGAP00000000986  ...............................................-....PQDY..DHALAE.........ARHL.
ENSMGAP00000001945  ...............................................-....----..------.........----.
ENSMGAP00000002062  ...............................................-....----..------.........----.
ENSMGAP00000016033  ...............................................-....TAGD..ETIFQEaelescdvnTMLL.
ENSMGAP00000012862  ...............................................-....----..------.........----.
ENSMGAP00000005519  ...............................................-....KMGV..PKTHLE.........LKKM.
ENSMGAP00000015047  ...............................................-....SLKV..PTSAVL.........VNKL.
ENSMGAP00000005432  ...............................................T....VAKV..ELSDHV.........CDVV.
ENSMGAP00000013736  ...............................................-....----..------.........----.
ENSMGAP00000011175  ...............................................-....----..------.........----.
ENSMGAP00000012508  ...............................................-....----..------.........----.
ENSMGAP00000008257  ...............................................-....SSG-..-LPRET.........LGQI.
ENSMGAP00000013184  ...............................................-....----..------.........----.
ENSMGAP00000010402  ...............................................-....TLHS..HMLTPF.........V---.
ENSMGAP00000000248  ...............................................-....----..------.........----.
ENSMGAP00000007611  ...............................................-....----..------.........----.
ENSMGAP00000005594  ...............................................-....KYPL..IMVPDE.........VEYL.
ENSMGAP00000008022  ...............................................-....RPDD..TITEEE.........VQRMk
ENSMGAP00000010056  ...............................................-....KFGQ..-VTPME.........VDIL.
ENSMGAP00000006995  ...............................................-....----..------.........----.
ENSMGAP00000003057  ...............................................-....EESF..RQLHLK.........EKKR.
ENSMGAP00000007897  ...............................................-....VVDG..K-VPES.........LKKC.
ENSMGAP00000004556  ...............................................H....S---..------.........----.
ENSMGAP00000014571  ...............................................-....QHFQ..HLTEEQ.........FERT.
ENSMGAP00000008494  ...............................................P....----..------.........LDEK.
ENSMGAP00000007615  ...............................................-....----..------.........----.
ENSMGAP00000003099  ...............................................-....----..------.........----.
ENSMGAP00000008028  ...............................................-....ALDL..VSDPEY.........VNLM.
ENSMGAP00000013774  ...............................................-....----..------.........----.
ENSMGAP00000012335  ...............................................-....----..------.........----.
ENSMGAP00000006327  ...............................................-....----..------.........----.
ENSMGAP00000013157  ...............................................L....EKSFysFYVCTA.........VRKF.
ENSMGAP00000015686  ...............................................-....----..------.........----.
ENSMGAP00000006220  ...............................................-....TFKE..GMEKEA.........VRKA.
ENSMGAP00000007527  ...............................................-....----..------.........----.
ENSMGAP00000012156  ...............................................-....--NV..ENTSSY.........LE--.
ENSMGAP00000004008  ...............................................-....TLGL..HLSRAQ.........VKKL.


                        150                   160       170       180                               
                          |                     |         |         |                               
d1bjfa_               ...FRQM....DTNR....DGK....LSLEEFIRGAKSDPSIVRLL--qc............................
ENSMGAP00000013771  ...IREA....DIDG....DGQ....VNYEEFVQMM------------..............................
ENSMGAP00000010818  ...IREA....DIDG....DGQ....VNYEEFVQMMT-----------..............................
ENSMGAP00000014820  ...FRQM....DTNN....DGK....LSLEEFIKGAKSDPSIVRLL--qc............................
ENSMGAP00000012925  ...FRQM....DTNR....DGK....LSLEEFIRGAKSDPSIVRLL--qc............................
ENSMGAP00000006499  ...IEKY....EPNSnlakKGQ....ISVDGFMRYLS-----------geengvvppekldl................
ENSMGAP00000006483  ...IETYepdeDLKS....KGL....ISSDGFCRYLMSDENAP-----vfldrlely.....................
ENSMGAP00000014837  ...FSKM....DKNK....DDQ....ITLDEFKEAAKSDPSIVLL---lq............................
ENSMGAP00000007665  ...FQEC....DGDQ....DKL....ITLKEWCHCF------------gikeedinesll..................
ENSMGAP00000015504  ...----....----....---....----------------------..............................
ENSMGAP00000012038  ...TMRY....-ADK....NMN....IDFDSFICCFVRLDAMFRAFH-afdkdgdgiiklnvlewlqltmy.......
ENSMGAP00000017351  ...TMRY....-ADK....NMN....IDFDSFICCFVRLDAMFRAFH-afdkdgdgiiklnvlewlqltmy.......
ENSMGAP00000005416  ...FTKM....DKDK....DDQ....ISLEEFKEAAKSDPS-------ivl...........................
ENSMGAP00000010422  ...FQKM....DRNK....DGV....VTIEEFLESCQKDENIMRSMQ-lfdn..........................
ENSMGAP00000010973  ...IDEA....DRDG....DGE....VSEQEFLRIMK-----------k.............................
ENSMGAP00000011986  ...IDKY....EPSE....TARarhaLSADGFLMYL------------cspegsifnsqhral...............
ENSMGAP00000003311  ...----....----....---....----------------------kkqrdsrlndilfppakpeqvqsliekyep
ENSMGAP00000013173  ...FQKM....DKNK....DGV....VTIDEFIESCQKDENIMRSMQ-lf............................
ENSMGAP00000008329  ...MKDS....DKNN....DGR....IDFDEFLKMME-----------gv............................
ENSMGAP00000001399  ...----....----....---....----------------------egkapiisgvtkaissptvsrltdtskftg
ENSMGAP00000005345  ...IDEA....DRDG....DGE....VNEQEFLRIMK-----------k.............................
ENSMGAP00000009666  ...----....----....---....----------------------g.............................
ENSMGAP00000001336  ...FQKM....DKNK....DGV....VTLDEFIESCQEDDNIMRSL--qlfe..........................
ENSMGAP00000007710  ...IRKF....DRQG....RGQ....VAFDDFIQCCVVLQRLTDVFR-rydtdqdgwiqvsyeqylcmv.........
ENSMGAP00000011308  ...VARY....-ADA....ETG....VDFDNFVCCLVKLETMFRFFH-smdpdgtgtavmnlaewllltm........
ENSMGAP00000008667  ...TRRY....--ST....HGK....ITFDDYIACCVKLRALTECFK-rrdasqqgfvnfqyddfiqcvms.......
ENSMGAP00000017345  ...IQKF....EVSE....ENKeqnvLGIEGFTNFMR-----------spacdvfnplhcevh...............
ENSMGAP00000001713  ...INKFepclENKK....TGA....LGIDGFTNYMRS----------psgdifnpehyqvh................
ENSMGAP00000008800  ...AIRY....-ACS....KMT....IDFDGFVACMIRLETLFKVFH-lldkeksgvvqlslaewlcc..........
ENSMGAP00000017221  ...VARF....-ADE....DLI....IDFDNFVRCLIRLETLFKMFR-kldtektgtieln.................
ENSMGAP00000003113  ...----....----....---....----------------------vaappliqryepserakkrnamtkdgflmy
ENSMGAP00000002095  ...FNKI....DVNG....DGE....LSLDEFVEGARKDDEFMEVM--m.............................
ENSMGAP00000003256  ...----....----....---....----------------------kscqaapeaqrqspsisqlepksldagisi
ENSMGAP00000005178  ...FAMM....DKNA....DGK....LTLQEFQEGSKADPSIVQA---lslydg........................
ENSMGAP00000004306  ...IINA....DKDG....DGR....ISFEEFCA--------------v.............................
ENSMGAP00000003741  ...LKDV....DLNG....DGL....VDFEEFVRMM------------..............................
ENSMGAP00000012748  ...VLRY....-SDE....QFQ....IDFDDFLNCLIRLENASRVF--qalsvknkdfiklnigefinl.........
ENSMGAP00000018907  ...LSRYa...QRSS....NPS....IQLDRFIHICMQLQSLTEAFR-ekdtgmvgnvrlgyedfltmvm........
ENSMGAP00000004316  ...FDKI....DING....DGE....LSLEEFMEGVQKDEVLLDIL--tr............................
ENSMGAP00000004292  ...FQLV....DENG....DGQ....LSLDEFIDGARKDKWVMKMLQ-mdv...........................
ENSMGAP00000018253  ...YREA....PIDK....KGN....FNYVEFTRILK-----------h.............................
ENSMGAP00000011383  ...IQKY....EPAK....EGQekgwLSIDGFTNYLTS----------pdchifdpehkkvc................
ENSMGAP00000000614  ...MKDG....DKNN....DGR....IDYD------------------..............................
ENSMGAP00000008865  ...IRDV....DLNG....DGR....VDFEEFVRMM------------..............................
ENSMGAP00000009812  ...YREA....PIDK....KGN....FNYIEFTRILK-----------h.............................
ENSMGAP00000015231  ...FQKI....DVNN....DGE....LTLEEFITGVERDEDLMEL---it............................
ENSMGAP00000003121  ...VSKY....EPSKegreKGY....LAIDGFTRYLLSS---------dcsifdpqhrrvc.................
ENSMGAP00000004318  ...----....----....---....----------------------vygliegkepssvgttkvakvagverltdt
ENSMGAP00000002012  ...----....----....---....----------------------wssllrnwnslav.................
ENSMGAP00000014898  ...----....----....---....----------------------g.............................
ENSMGAP00000003792  ...MKGQ....-EDS....NGC....INYEAFVKHI------------m.............................
ENSMGAP00000007259  ...IRRY....ELSQ....EGRlkgfLAIDGFTQYL------------lspecdifdpehkk................
ENSMGAP00000000101  ...ICAH....ELNEkarqQGL....MTLDGFTMYLLS----------aagdilnqehtevh................
ENSMGAP00000004099  ...FKEI....DADE....TGK....LSYDEFKNFALEHPEYAKLF--ttylelqr......................
ENSMGAP00000011104  ...----....----....---....----------------------g.............................
ENSMGAP00000015217  ...----....----....---....----------------------wgsilrnwnflav.................
ENSMGAP00000015504  ...----....----....---....----------------------gevasfggsniepsvrscfqfvssspeiea
ENSMGAP00000014359  ...----....-VRK....RRQ....LSFEGFIRYMSSE---------dctvfkkehrtvy.................
ENSMGAP00000001935  ...FNSC....DTYK....DSL....ISNNEWCYCFQRQQ--------dppcqte.......................
ENSMGAP00000003079  ...FAAF....PPDV....SGN....LDYKNLCYVIT-----------hg............................
ENSMGAP00000002363  ...MAGQ....-EDA....NGC....INYEAFVKHI------------m.............................
ENSMGAP00000011677  ...IQEA....DQDG....DCA....ISFAEFVKVLEKV---------dveqkmsir.....................
ENSMGAP00000009004  ...LKKM....DHDH....DGK....LSFADFEEAVKNENLLLEAFG-pclpdvk.......................
ENSMGAP00000008132  ...FNSC....DSFK....DGK....LSNNEWCYCFQK----------pgglpcqne.....................
ENSMGAP00000019273  ...----....----....---....----------------------kgkeeayeaic...................
ENSMGAP00000001471  ...MAGQ....-EDA....NGC....INYEAFVKHI------------m.............................
ENSMGAP00000010396  ...LKEA....KIGP....NGT....IKYEEFTRT-------------i.............................
ENSMGAP00000005510  ...AIRY....-GDP....DLK....ISFESFMCFMLRVEIMGEAFR-nltqdgkgiylreseewvsl..........
ENSMGAP00000005093  ...FAAF....PPDV....SGN....LDYKNLVHVIT-----------hg............................
ENSMGAP00000014898  ...FPQQ....----....-KK....IMLNMFLDTLMADPPP------qclvwlplmhrlahven.............
ENSMGAP00000012414  ...----....----....---....----------------------gvskeg........................
ENSMGAP00000003667  ...IEEA....DMDG....DGK....LGFADFENMISKAPDFLSTFH-i.............................
ENSMGAP00000009666  ...----....----....---....----------------------eaiqvprqlgevaafggsnvepsirscfrf
ENSMGAP00000005687  ...IYEA....DLDN....DGK....LSLEDFQHMIIRAPDFLSTFH-i.............................
ENSMGAP00000011104  ...FSQQ....----....-KK....VTLNTFLDTLMSDPPP------qclvwlpllhrlanven.............
ENSMGAP00000015388  ...WNLS....DIDQ....DGK....LTAEEFILAMHLI---------dvamsgqplppvlppeyippsfr.......
ENSMGAP00000000479  ...FQAS....GFQD....RHE....LTWEDFHYMLRDHDN-------elrltqlcikgvpev...............
ENSMGAP00000013677  ...----....----....---....----------------------rkngydlpeklpeslmpkl...........
ENSMGAP00000011946  ...LSSA....LDPE....TNA....VHYRDYISMM------------..............................
ENSMGAP00000011948  ...LSSA....LDPE....TNA....VHYRDYISMM------------..............................
ENSMGAP00000015556  ...----....----....---....----------------------rkngyqlpetlpetllpdy...........
ENSMGAP00000003279  ...LKSM....DKNG....TMT....IDWNEWRDYHLLHP--------venipeiilywkhstifdvgenltvpdeft
ENSMGAP00000005348  ...ALRY....-GDV....YRR....MGFADFVSCMLRLETMTYAFQ-nlakggpqvlmtvmewltlvm.........
ENSMGAP00000012873  ...VEYC....DVNN....DKS....LSVQELMGCL------------gvtkeegkae....................
ENSMGAP00000006199  ...LQSI....DADG....TMS....VDWNEWRDHFMFNP--------atdieeiirywkhs................
ENSMGAP00000014876  ...WSLA....DIDG....DGQ....LKADEFVLAMHL----------tdmakagqplpltlplelvppsfr......
ENSMGAP00000007897  ...LNMH....DNTK....LGH....LTLEDYQIWSVK----------salaneflnl....................
ENSMGAP00000010932  ...LEES....DIDK....DGT....INLSEFQHVISRSPDFVSSFK-i.............................
ENSMGAP00000006099  ...----....----....---....----------------------iavachdallv...................
ENSMGAP00000000986  ...LEDI....DKNE....DGF....VDQDEYIA--------------dm............................
ENSMGAP00000018863  ...IEEF....DKDG....DG-....----------------------..............................
ENSMGAP00000010191  ...VRSI....DFNK....DGN....IDFNEFLEAF------------r.............................
ENSMGAP00000011498  ...WALC....DTKD....CGK....LSKEQFALAF------------ylinqkltkgidppqaltpemipp......
ENSMGAP00000005636  ...----....----....---....----------------------alekepvpsllppslippskr.........
ENSMGAP00000014876  ...----....----....---....----------------------lklqgqhlpmvlppvmkqt...........
ENSMGAP00000013745  ...FREV....DRDS....DGR....ISFKEFECAM------------k.............................
ENSMGAP00000005636  ...WALA....DTRQ....IGK....LSKDQFALAMY-----------liqqkvskgidppqvlspdmippter....
ENSMGAP00000019260  ...----....----....---....----------------------vacnt.........................
ENSMGAP00000010308  ...----....----....---....----------------------vacnt.........................
ENSMGAP00000015629  ...LDLV....KPQY....EGK....ITLHDLKRC-------------klt...........................
ENSMGAP00000007270  ...FRAV....DEEE....KGK....ITYDDFYRFAELQPH-------faedylypd.....................
ENSMGAP00000015388  ...----....----....---....----------------------lklqgyqlpsalppvmkqpp..........
ENSMGAP00000001784  ...----....----....---....----------------------i.............................
ENSMGAP00000015545  ...AQSI....DYNK....DGY....IDFSEFLEAF------------h.............................
ENSMGAP00000010427  ...MEEI....DYDH....DGT....VSLEEWIQGGMTTIPLL-----vllglennvkddgqhv..............
ENSMGAP00000000998  ...----....----....---....----------------------acheff........................
ENSMGAP00000012493  ...----....----....---....----------------------eldi..........................
ENSMGAP00000001668  ...LDLV....KPER....EGR....VTLRDLKRCRM-----------ah............................
ENSMGAP00000011498  ...----....----....---....----------------------vycalekepvpmslpaalvplskr......
ENSMGAP00000010185  ...----....----....---....----------------------i.............................
ENSMGAP00000017513  ...----....----....---....----------------------reqadycishm...................
ENSMGAP00000013797  ...----....----....---....----------------------tiacndyfvv....................
ENSMGAP00000000945  ...LAAA....DHDG....DGK....IGAEEFQEMV------------q.............................
ENSMGAP00000002904  ...IAVA....DENQ....NHH....LELEEILKY-------------seyftgsklmdyarn...............
ENSMGAP00000008628  ...----....----....---....----------------------avvgegctlscveiathscfhgvlnsgive
ENSMGAP00000014571  ...LEYY....DKTL....SSK....ISYNDFLRA-------------f.............................
ENSMGAP00000003057  ...IEEM....DLND....DKK....LSEAEILK--------------nqdlflnseatdygrqlh............
ENSMGAP00000010332  ...MART....GPDEv...YEG....ITFEDFLKVWKGI---------dietkmhvrfl...................
ENSMGAP00000019524  ...LAAG....DTDG....DGK....IGVEEFQSL-------------v.............................
ENSMGAP00000005528  ...----....----....---....----------------------likvkleghelpnelpshllppskr.....
ENSMGAP00000010575  ...LEAA....DKDG....NGS....ITFQELQQQLEAFPGLMENL--ti............................
ENSMGAP00000001307  ...----....----....---....----------------------k.............................
ENSMGAP00000017273  ...----....----....--N....----------------------lltekqklkvkkihenekrleagdhtvell
ENSMGAP00000017264  ...FDKH....DLDR....DCA....LSTDELKDLFKVFPY-------mpwgpdvnntvctnergwityqgflsqwtl
ENSMGAP00000012328  ...----....----....---....----------------------peqaqycikrmp..................
ENSMGAP00000010402  ...RLHF....GHNR....KKH....LNYTEFTQFL------------qe............................
ENSMGAP00000011891  ...----....----....---....----------------------khlikikldgyelpgtlpphlvppshr...
ENSMGAP00000008022  ...LNHC....DVNR....DGK....IQKSELALC-------------l.............................
ENSMGAP00000011257  ...FLETlge.SCSN....PEE....VSYSEFEDYY------------egl...........................
ENSMGAP00000008628  ...----....----....---....----------------------alsg..........................
ENSMGAP00000012468  ...----....----....---....----------------------pdqaeyciarm...................
ENSMGAP00000010049  ...----....-TTD....KGL....LSLHGFLC--------------qwtl..........................
ENSMGAP00000010311  ...----....----....---....----------------------thehlhfce.....................
ENSMGAP00000013157  ...FDMV....KPKD....PYR....ISLQDLIN--------------ssqgd.........................
ENSMGAP00000006617  ...----....----....---....----------------------ee............................
ENSMGAP00000004752  ...----....----....---....----------------------vmcndffqeypdkm................
ENSMGAP00000003256  ...MEEI....DYDH....DGN....VTLEEWIR--------------g.............................
ENSMGAP00000010056  ...QLHF....GKDR....KRH....LTYPEFTQFLL-----------e.............................
ENSMGAP00000011434  ...FDYC....DLDK....DGL....INYQEFANFL------------nw............................
ENSMGAP00000006435  ...----....----....---....----------------------kdv...........................
ENSMGAP00000001668  ...FYTV....NRSW....SGK....ITLTELRK--------------..............................
ENSMGAP00000011498  ...----....----....---....----------------------lvacaqngldvslsslnlpvppprftd...
ENSMGAP00000004753  ...----....----....---....----------------------miyneall......................
ENSMGAP00000005636  ...----....----....---....----------------------lvacaqnghevnlsslnltvpppkfhd...
ENSMGAP00000015905  ...NKAL....EKDP....D--....----------------------c.............................
ENSMGAP00000019081  ...TKLP....DFNC....SGK....LDYK------------------k.............................
ENSMGAP00000000625  ...----....----....---....----------------------achgqlqq......................
ENSMGAP00000007021  ...MNEV....DINK....DRL....VTLEEFLRA-------------t.............................
ENSMGAP00000017212  ...----....----....---....----------------------ahriihkdd.....................
ENSMGAP00000002213  ...NKAL....END-....---....----------------------ad............................
ENSMGAP00000013577  ...----....----....---....----------------------taeenlrq......................
ENSMGAP00000000632  ...----....----....---....----------------------kacywylq......................
ENSMGAP00000005432  ...FALF....DCDG....NGE....LSNKEFVAIMK-----------q.............................
ENSMGAP00000005269  ...----....----....---....----------------------pnkd..........................
ENSMGAP00000004749  ...----....----....---....----------------------iaspiahii.....................
ENSMGAP00000014571  ...LKNL....----....---....----------------------nllltlilhsknfiqnfisyss........
ENSMGAP00000014702  ...----....----....---....----------------------pnkd..........................
ENSMGAP00000015629  ...FYTV....NRSW....SGK....ITCNELRK--------------..............................
ENSMGAP00000010757  ...LRDD....DKNN....DGY....IDYAEFAK--------------..............................
ENSMGAP00000012156  ...FKIF....DVDR....DDQ....LSYKEFIGIM------------k.............................
ENSMGAP00000001384  ...----....----....---....----------------------hk............................
ENSMGAP00000014541  ...VLHN....-LEQ....DGT....MSVEDFF---------------yslf..........................
ENSMGAP00000001307  ...----....----....---....----------------------dl............................
ENSMGAP00000002904  ...FRAV....DPDG....DGH....VSWDEYK---------------i.............................
ENSMGAP00000004752  ...----....----....---....----------------------aidahnrshk....................
ENSMGAP00000012493  ...----....----....---....----------------------qk............................
ENSMGAP00000009006  ...IQKFepsvNMCQ....QGL....LSFEGFARFLMD----------kdnfa.........................
ENSMGAP00000002845  ...----....----....---....----------------------vlpdpspeqeepdsafeatqyffeditpec
ENSMGAP00000013352  ...----....----....---....----------------------..............................
ENSMGAP00000011218  ...FDKE....DEDS....DGF....ISAREF----------------t.............................
ENSMGAP00000008109  ...LALA....DSNS....EGR....ICYQDFVNLM------------..............................
ENSMGAP00000013184  ...----....----....---....----------------------epqsmvwlpvlhrvaaaet...........
ENSMGAP00000007241  ...----....----....---....----------------------lppgtalnpeete.................
ENSMGAP00000007078  ...FGNQ....DRNQ....DGR....ITAEEL----------------k.............................
ENSMGAP00000016033  ...FKIF....DLDG....DDC....LSHGEFLGVL------------k.............................
ENSMGAP00000009321  ...----....----....---....----------------------sla...........................
ENSMGAP00000011486  ...----....----....---....----------------------gfihnf........................
ENSMGAP00000008771  ...LRFD....DYNN....DGR....LTLQELYTAFQV----------vqlslpee......................
ENSMGAP00000009284  ...FDSL....EQNN....NGY....LTPVEFSM--------------gl............................
ENSMGAP00000012705  ...FTNQ....DRDG....NGK....VTVEEFK---------------..............................
ENSMGAP00000008188  ...----....----....---....----------------------ippafteveslspskgvdlskeelihfsql
ENSMGAP00000015472  ...LTMF....-EDD....LKQ....VEYKKFVDA-------------v.............................
ENSMGAP00000008783  ...YTAVka..DPDG....NGV....LSLEEFKRL-------------nirdf.........................
ENSMGAP00000001658  ...LKYD....DYNS....DKH....LGLEEFYRAFQV----------vql...........................
ENSMGAP00000012256  ...LSCA....ETDE....NET....LDYEEFVK--------------rf............................
ENSMGAP00000013520  ...VRKL....DQNQ....TGI....VDY-------------------s.............................
ENSMGAP00000004374  ...----....----....---....----------------------ls............................
ENSMGAP00000000986  ...VYES....DVDK....DQK....LTKEE-----------------..............................
ENSMGAP00000001945  ...----....----....---....----------------------ylgeyrnv......................
ENSMGAP00000002062  ...----....----....---....----------------------sw............................
ENSMGAP00000016033  ...VHFF....GKEG....KEK....LRYSEFFRFMENL---------qtevqeme......................
ENSMGAP00000012862  ...----....----....---....----------------------ra............................
ENSMGAP00000005519  ...ISEV....TGGV....SET....ISYQDFVNVM------------l.............................
ENSMGAP00000015047  ...IDLC....-CCG....DDK....INYRDFLRAF------------..............................
ENSMGAP00000005432  ...FALF....DCDG....NGE....LSNKEFVAIM------------k.............................
ENSMGAP00000013736  ...----....----....---....----------------------hdqkepwasdvgmvrdymcsylkdgsidaa
ENSMGAP00000011175  ...----....----....---....----------------------..............................
ENSMGAP00000012508  ...----....----....---....----------------------llketlnqlqsl..................
ENSMGAP00000008257  ...WALA....NRTT....PGK....LTKEELYAVL------------amiavtqrgipavsp...............
ENSMGAP00000013184  ...----....----....---....----------------------rrlqkalcykqflystsgreghklhnihni
ENSMGAP00000010402  ...----....----....---....----------------------eenlvsvaggtvsrqvsfsyfnafnallnn
ENSMGAP00000000248  ...----....----....---....----------------------nhmgdyedvlasletlnlsilkamdytkrv
ENSMGAP00000007611  ...----....----....---....----------------------hqqm..........................
ENSMGAP00000005594  ...LKKI....C---....---....----------------------tamnvelnscelddclsqepqgqggltvwq
ENSMGAP00000008022  eqfMSAY....DVTT....DGR....LQIQELANMV------------lp............................
ENSMGAP00000010056  ...FQLA....DL--....---....----------------------yeprgrmtlad...................
ENSMGAP00000006995  ...----....----....---....----------------------heqqeswaqdlskvrermtefvddtmreta
ENSMGAP00000003057  ...FEKA....NRDD....DPD....LNVDEFI---------------a.............................
ENSMGAP00000007897  ...FSEG....----....-EK....VNYEKFRIWLLHNKDAFTF---srwlls........................
ENSMGAP00000004556  ...----....----....---....----------------------ps............................
ENSMGAP00000014571  ...SDKI....PLCP....QGE....LKYQEFSK--------------kf............................
ENSMGAP00000008494  ...IECM....GDPD....EAK....LEFGEY----------------wdmmgda.......................
ENSMGAP00000007615  ...----....----....---....----------------------dle...........................
ENSMGAP00000003099  ...----....----....---....----------------------aqktmdvpfldsfspcalrggersehfrvs
ENSMGAP00000008028  ...KTKL....DPEG....LGI....ILLGPFL---------------qe............................
ENSMGAP00000013774  ...----....----....---....----------------------lidkedvdigtsqvaeimall.........
ENSMGAP00000012335  ...----....----....---....----------------------kkneltrqgfmdlnl...............
ENSMGAP00000006327  ...----....----....---....----------------------n.............................
ENSMGAP00000013157  ...FFFL....DPLR....TGK....IKIQDI----------------la............................
ENSMGAP00000015686  ...----....----....---....----------------------..............................
ENSMGAP00000006220  ...KNHF....----....---....----------------------csrypqlgrvgklspkafqaflelv.....
ENSMGAP00000007527  ...----....----....---....----------------------..............................
ENSMGAP00000012156  ...----....----....---....----------------------nmrcripeekgipfexfrsffqflnnl...
ENSMGAP00000004008  ...LNKV....----....---....----------------------..............................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  sviniqrgqlspegmvwflcgpennvialdklvly...........................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  shker.........................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  llsddgnifntshrkvy.............................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  qtevacapvtvlekrlpfslrkshsalkaapqhppaplaqvvylkdivcylsllergraedklefm............
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  skytgshker....................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  alfldwmrlepqsmvwlxqsmvwlpvlhrvaaaet...........................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  shgkpaieaaqfewanlepqsmvwlavlhrvtmae...........................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ekflswlrsgpallqwlptcyrlsatem..................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ardfeknynmyifpvhwqfgqldqhpidg.................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  thayfvilsgvcvctprgpldctlqkhsqnnitegrnvfentskkssqenrnylrmwsqenkskaknskdlpklnqgq
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  svssagdslesdalksspekgkgkvdiqaylkqw............................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  epsfqldefltylfskenmvmdak......................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ni............................................................................
ENSMGAP00000010402  mdlirkiysniagtrkdvevtkeeft....................................................
ENSMGAP00000000248  yesgsnmdqfv...................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  fldmv.........................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  epflfvdefltylfakensiwdekydti..................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  lmefqkflleyqrelwaadslqvqefmfnflrdplreidepyfsldefltflfskensiwnsqld.............
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  ..............................................................................
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  fielcktmynmfsedpneqdlyhataavtsllleigevgklfsvqptkeadsssnncsktiqselfqkkdsqqypleq
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  ..............................................................................
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                                                    
                                                                                                    
d1bjfa_               ..............................................................................
ENSMGAP00000013771  ..............................................................................
ENSMGAP00000010818  ..............................................................................
ENSMGAP00000014820  ..............................................................................
ENSMGAP00000012925  ..............................................................................
ENSMGAP00000006499  ..............................................................................
ENSMGAP00000006483  ..............................................................................
ENSMGAP00000014837  ..............................................................................
ENSMGAP00000007665  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000012038  ..............................................................................
ENSMGAP00000017351  ..............................................................................
ENSMGAP00000005416  ..............................................................................
ENSMGAP00000010422  ..............................................................................
ENSMGAP00000010973  ..............................................................................
ENSMGAP00000011986  ..............................................................................
ENSMGAP00000003311  ..............................................................................
ENSMGAP00000013173  ..............................................................................
ENSMGAP00000008329  ..............................................................................
ENSMGAP00000001399  ..............................................................................
ENSMGAP00000005345  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000001336  ..............................................................................
ENSMGAP00000007710  ..............................................................................
ENSMGAP00000011308  ..............................................................................
ENSMGAP00000008667  ..............................................................................
ENSMGAP00000017345  ..............................................................................
ENSMGAP00000001713  ..............................................................................
ENSMGAP00000008800  ..............................................................................
ENSMGAP00000017221  ..............................................................................
ENSMGAP00000003113  ..............................................................................
ENSMGAP00000002095  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000005178  ..............................................................................
ENSMGAP00000004306  ..............................................................................
ENSMGAP00000003741  ..............................................................................
ENSMGAP00000012748  ..............................................................................
ENSMGAP00000018907  ..............................................................................
ENSMGAP00000004316  ..............................................................................
ENSMGAP00000004292  ..............................................................................
ENSMGAP00000018253  ..............................................................................
ENSMGAP00000011383  ..............................................................................
ENSMGAP00000000614  ..............................................................................
ENSMGAP00000008865  ..............................................................................
ENSMGAP00000009812  ..............................................................................
ENSMGAP00000015231  ..............................................................................
ENSMGAP00000003121  ..............................................................................
ENSMGAP00000004318  ..............................................................................
ENSMGAP00000002012  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000003792  ..............................................................................
ENSMGAP00000007259  ..............................................................................
ENSMGAP00000000101  ..............................................................................
ENSMGAP00000004099  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015217  ..............................................................................
ENSMGAP00000015504  ..............................................................................
ENSMGAP00000014359  ..............................................................................
ENSMGAP00000001935  ..............................................................................
ENSMGAP00000003079  ..............................................................................
ENSMGAP00000002363  ..............................................................................
ENSMGAP00000011677  ..............................................................................
ENSMGAP00000009004  ..............................................................................
ENSMGAP00000008132  ..............................................................................
ENSMGAP00000019273  ..............................................................................
ENSMGAP00000001471  ..............................................................................
ENSMGAP00000010396  ..............................................................................
ENSMGAP00000005510  ..............................................................................
ENSMGAP00000005093  ..............................................................................
ENSMGAP00000014898  ..............................................................................
ENSMGAP00000012414  ..............................................................................
ENSMGAP00000003667  ..............................................................................
ENSMGAP00000009666  ..............................................................................
ENSMGAP00000005687  ..............................................................................
ENSMGAP00000011104  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000000479  ..............................................................................
ENSMGAP00000013677  ..............................................................................
ENSMGAP00000011946  ..............................................................................
ENSMGAP00000011948  ..............................................................................
ENSMGAP00000015556  ..............................................................................
ENSMGAP00000003279  ..............................................................................
ENSMGAP00000005348  ..............................................................................
ENSMGAP00000012873  ..............................................................................
ENSMGAP00000006199  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000010932  ..............................................................................
ENSMGAP00000006099  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000018863  ..............................................................................
ENSMGAP00000010191  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000014876  ..............................................................................
ENSMGAP00000013745  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000019260  ..............................................................................
ENSMGAP00000010308  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000007270  ..............................................................................
ENSMGAP00000015388  ..............................................................................
ENSMGAP00000001784  ..............................................................................
ENSMGAP00000015545  ..............................................................................
ENSMGAP00000010427  ..............................................................................
ENSMGAP00000000998  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000010185  ..............................................................................
ENSMGAP00000017513  ..............................................................................
ENSMGAP00000013797  ..............................................................................
ENSMGAP00000000945  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000010332  ..............................................................................
ENSMGAP00000019524  ..............................................................................
ENSMGAP00000005528  ..............................................................................
ENSMGAP00000010575  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000017273  ..............................................................................
ENSMGAP00000017264  ..............................................................................
ENSMGAP00000012328  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000011891  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000011257  ..............................................................................
ENSMGAP00000008628  ..............................................................................
ENSMGAP00000012468  ..............................................................................
ENSMGAP00000010049  ..............................................................................
ENSMGAP00000010311  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000006617  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000003256  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000011434  ..............................................................................
ENSMGAP00000006435  ..............................................................................
ENSMGAP00000001668  ..............................................................................
ENSMGAP00000011498  ..............................................................................
ENSMGAP00000004753  ..............................................................................
ENSMGAP00000005636  ..............................................................................
ENSMGAP00000015905  ..............................................................................
ENSMGAP00000019081  ..............................................................................
ENSMGAP00000000625  ..............................................................................
ENSMGAP00000007021  ..............................................................................
ENSMGAP00000017212  ..............................................................................
ENSMGAP00000002213  ..............................................................................
ENSMGAP00000013577  ..............................................................................
ENSMGAP00000000632  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000005269  ..............................................................................
ENSMGAP00000004749  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000014702  ..............................................................................
ENSMGAP00000015629  ..............................................................................
ENSMGAP00000010757  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000001384  ..............................................................................
ENSMGAP00000014541  ..............................................................................
ENSMGAP00000001307  ..............................................................................
ENSMGAP00000002904  ..............................................................................
ENSMGAP00000004752  ..............................................................................
ENSMGAP00000012493  ..............................................................................
ENSMGAP00000009006  ..............................................................................
ENSMGAP00000002845  hkpfqgslvtndeeaictestlgmqmedikledssprdngacssmlisdddtkddssmssysvlsagsheeeklhced
ENSMGAP00000013352  ..............................................................................
ENSMGAP00000011218  ..............................................................................
ENSMGAP00000008109  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000007241  ..............................................................................
ENSMGAP00000007078  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000009321  ..............................................................................
ENSMGAP00000011486  ..............................................................................
ENSMGAP00000008771  ..............................................................................
ENSMGAP00000009284  ..............................................................................
ENSMGAP00000012705  ..............................................................................
ENSMGAP00000008188  ..............................................................................
ENSMGAP00000015472  ..............................................................................
ENSMGAP00000008783  ..............................................................................
ENSMGAP00000001658  ..............................................................................
ENSMGAP00000012256  ..............................................................................
ENSMGAP00000013520  ..............................................................................
ENSMGAP00000004374  ..............................................................................
ENSMGAP00000000986  ..............................................................................
ENSMGAP00000001945  ..............................................................................
ENSMGAP00000002062  ..............................................................................
ENSMGAP00000016033  ..............................................................................
ENSMGAP00000012862  ..............................................................................
ENSMGAP00000005519  ..............................................................................
ENSMGAP00000015047  ..............................................................................
ENSMGAP00000005432  ..............................................................................
ENSMGAP00000013736  ..............................................................................
ENSMGAP00000011175  ..............................................................................
ENSMGAP00000012508  ..............................................................................
ENSMGAP00000008257  ..............................................................................
ENSMGAP00000013184  ..............................................................................
ENSMGAP00000010402  ..............................................................................
ENSMGAP00000000248  ..............................................................................
ENSMGAP00000007611  ..............................................................................
ENSMGAP00000005594  ..............................................................................
ENSMGAP00000008022  ..............................................................................
ENSMGAP00000010056  ..............................................................................
ENSMGAP00000006995  ..............................................................................
ENSMGAP00000003057  ..............................................................................
ENSMGAP00000007897  ..............................................................................
ENSMGAP00000004556  ..............................................................................
ENSMGAP00000014571  ..............................................................................
ENSMGAP00000008494  ..............................................................................
ENSMGAP00000007615  ..............................................................................
ENSMGAP00000003099  ..............................................................................
ENSMGAP00000008028  ..............................................................................
ENSMGAP00000013774  ..............................................................................
ENSMGAP00000012335  ..............................................................................
ENSMGAP00000006327  ..............................................................................
ENSMGAP00000013157  ..............................................................................
ENSMGAP00000015686  ..............................................................................
ENSMGAP00000006220  ..............................................................................
ENSMGAP00000007527  ..............................................................................
ENSMGAP00000012156  ..............................................................................
ENSMGAP00000004008  ..............................................................................


                                                                      
                                                                      
d1bjfa_               ................................................
ENSMGAP00000013771  ................................................
ENSMGAP00000010818  ................................................
ENSMGAP00000014820  ................................................
ENSMGAP00000012925  ................................................
ENSMGAP00000006499  ................................................
ENSMGAP00000006483  ................................................
ENSMGAP00000014837  ................................................
ENSMGAP00000007665  ................................................
ENSMGAP00000015504  ................................................
ENSMGAP00000012038  ................................................
ENSMGAP00000017351  ................................................
ENSMGAP00000005416  ................................................
ENSMGAP00000010422  ................................................
ENSMGAP00000010973  ................................................
ENSMGAP00000011986  ................................................
ENSMGAP00000003311  ................................................
ENSMGAP00000013173  ................................................
ENSMGAP00000008329  ................................................
ENSMGAP00000001399  ................................................
ENSMGAP00000005345  ................................................
ENSMGAP00000009666  ................................................
ENSMGAP00000001336  ................................................
ENSMGAP00000007710  ................................................
ENSMGAP00000011308  ................................................
ENSMGAP00000008667  ................................................
ENSMGAP00000017345  ................................................
ENSMGAP00000001713  ................................................
ENSMGAP00000008800  ................................................
ENSMGAP00000017221  ................................................
ENSMGAP00000003113  ................................................
ENSMGAP00000002095  ................................................
ENSMGAP00000003256  ................................................
ENSMGAP00000005178  ................................................
ENSMGAP00000004306  ................................................
ENSMGAP00000003741  ................................................
ENSMGAP00000012748  ................................................
ENSMGAP00000018907  ................................................
ENSMGAP00000004316  ................................................
ENSMGAP00000004292  ................................................
ENSMGAP00000018253  ................................................
ENSMGAP00000011383  ................................................
ENSMGAP00000000614  ................................................
ENSMGAP00000008865  ................................................
ENSMGAP00000009812  ................................................
ENSMGAP00000015231  ................................................
ENSMGAP00000003121  ................................................
ENSMGAP00000004318  ................................................
ENSMGAP00000002012  ................................................
ENSMGAP00000014898  ................................................
ENSMGAP00000003792  ................................................
ENSMGAP00000007259  ................................................
ENSMGAP00000000101  ................................................
ENSMGAP00000004099  ................................................
ENSMGAP00000011104  ................................................
ENSMGAP00000015217  ................................................
ENSMGAP00000015504  ................................................
ENSMGAP00000014359  ................................................
ENSMGAP00000001935  ................................................
ENSMGAP00000003079  ................................................
ENSMGAP00000002363  ................................................
ENSMGAP00000011677  ................................................
ENSMGAP00000009004  ................................................
ENSMGAP00000008132  ................................................
ENSMGAP00000019273  ................................................
ENSMGAP00000001471  ................................................
ENSMGAP00000010396  ................................................
ENSMGAP00000005510  ................................................
ENSMGAP00000005093  ................................................
ENSMGAP00000014898  ................................................
ENSMGAP00000012414  ................................................
ENSMGAP00000003667  ................................................
ENSMGAP00000009666  ................................................
ENSMGAP00000005687  ................................................
ENSMGAP00000011104  ................................................
ENSMGAP00000015388  ................................................
ENSMGAP00000000479  ................................................
ENSMGAP00000013677  ................................................
ENSMGAP00000011946  ................................................
ENSMGAP00000011948  ................................................
ENSMGAP00000015556  ................................................
ENSMGAP00000003279  ................................................
ENSMGAP00000005348  ................................................
ENSMGAP00000012873  ................................................
ENSMGAP00000006199  ................................................
ENSMGAP00000014876  ................................................
ENSMGAP00000007897  ................................................
ENSMGAP00000010932  ................................................
ENSMGAP00000006099  ................................................
ENSMGAP00000000986  ................................................
ENSMGAP00000018863  ................................................
ENSMGAP00000010191  ................................................
ENSMGAP00000011498  ................................................
ENSMGAP00000005636  ................................................
ENSMGAP00000014876  ................................................
ENSMGAP00000013745  ................................................
ENSMGAP00000005636  ................................................
ENSMGAP00000019260  ................................................
ENSMGAP00000010308  ................................................
ENSMGAP00000015629  ................................................
ENSMGAP00000007270  ................................................
ENSMGAP00000015388  ................................................
ENSMGAP00000001784  ................................................
ENSMGAP00000015545  ................................................
ENSMGAP00000010427  ................................................
ENSMGAP00000000998  ................................................
ENSMGAP00000012493  ................................................
ENSMGAP00000001668  ................................................
ENSMGAP00000011498  ................................................
ENSMGAP00000010185  ................................................
ENSMGAP00000017513  ................................................
ENSMGAP00000013797  ................................................
ENSMGAP00000000945  ................................................
ENSMGAP00000002904  ................................................
ENSMGAP00000008628  ................................................
ENSMGAP00000014571  ................................................
ENSMGAP00000003057  ................................................
ENSMGAP00000010332  ................................................
ENSMGAP00000019524  ................................................
ENSMGAP00000005528  ................................................
ENSMGAP00000010575  ................................................
ENSMGAP00000001307  ................................................
ENSMGAP00000017273  ................................................
ENSMGAP00000017264  ................................................
ENSMGAP00000012328  ................................................
ENSMGAP00000010402  ................................................
ENSMGAP00000011891  ................................................
ENSMGAP00000008022  ................................................
ENSMGAP00000011257  ................................................
ENSMGAP00000008628  ................................................
ENSMGAP00000012468  ................................................
ENSMGAP00000010049  ................................................
ENSMGAP00000010311  ................................................
ENSMGAP00000013157  ................................................
ENSMGAP00000006617  ................................................
ENSMGAP00000004752  ................................................
ENSMGAP00000003256  ................................................
ENSMGAP00000010056  ................................................
ENSMGAP00000011434  ................................................
ENSMGAP00000006435  ................................................
ENSMGAP00000001668  ................................................
ENSMGAP00000011498  ................................................
ENSMGAP00000004753  ................................................
ENSMGAP00000005636  ................................................
ENSMGAP00000015905  ................................................
ENSMGAP00000019081  ................................................
ENSMGAP00000000625  ................................................
ENSMGAP00000007021  ................................................
ENSMGAP00000017212  ................................................
ENSMGAP00000002213  ................................................
ENSMGAP00000013577  ................................................
ENSMGAP00000000632  ................................................
ENSMGAP00000005432  ................................................
ENSMGAP00000005269  ................................................
ENSMGAP00000004749  ................................................
ENSMGAP00000014571  ................................................
ENSMGAP00000014702  ................................................
ENSMGAP00000015629  ................................................
ENSMGAP00000010757  ................................................
ENSMGAP00000012156  ................................................
ENSMGAP00000001384  ................................................
ENSMGAP00000014541  ................................................
ENSMGAP00000001307  ................................................
ENSMGAP00000002904  ................................................
ENSMGAP00000004752  ................................................
ENSMGAP00000012493  ................................................
ENSMGAP00000009006  ................................................
ENSMGAP00000002845  igedtvlvrsnhttslhrstsidrdwaitfeqflaslltepalvryfd
ENSMGAP00000013352  ................................................
ENSMGAP00000011218  ................................................
ENSMGAP00000008109  ................................................
ENSMGAP00000013184  ................................................
ENSMGAP00000007241  ................................................
ENSMGAP00000007078  ................................................
ENSMGAP00000016033  ................................................
ENSMGAP00000009321  ................................................
ENSMGAP00000011486  ................................................
ENSMGAP00000008771  ................................................
ENSMGAP00000009284  ................................................
ENSMGAP00000012705  ................................................
ENSMGAP00000008188  ................................................
ENSMGAP00000015472  ................................................
ENSMGAP00000008783  ................................................
ENSMGAP00000001658  ................................................
ENSMGAP00000012256  ................................................
ENSMGAP00000013520  ................................................
ENSMGAP00000004374  ................................................
ENSMGAP00000000986  ................................................
ENSMGAP00000001945  ................................................
ENSMGAP00000002062  ................................................
ENSMGAP00000016033  ................................................
ENSMGAP00000012862  ................................................
ENSMGAP00000005519  ................................................
ENSMGAP00000015047  ................................................
ENSMGAP00000005432  ................................................
ENSMGAP00000013736  ................................................
ENSMGAP00000011175  ................................................
ENSMGAP00000012508  ................................................
ENSMGAP00000008257  ................................................
ENSMGAP00000013184  ................................................
ENSMGAP00000010402  ................................................
ENSMGAP00000000248  ................................................
ENSMGAP00000007611  ................................................
ENSMGAP00000005594  ................................................
ENSMGAP00000008022  ................................................
ENSMGAP00000010056  ................................................
ENSMGAP00000006995  ................................................
ENSMGAP00000003057  ................................................
ENSMGAP00000007897  ................................................
ENSMGAP00000004556  ................................................
ENSMGAP00000014571  ................................................
ENSMGAP00000008494  ................................................
ENSMGAP00000007615  ................................................
ENSMGAP00000003099  ................................................
ENSMGAP00000008028  ................................................
ENSMGAP00000013774  ................................................
ENSMGAP00000012335  ................................................
ENSMGAP00000006327  ................................................
ENSMGAP00000013157  ................................................
ENSMGAP00000015686  ................................................
ENSMGAP00000006220  ................................................
ENSMGAP00000007527  ................................................
ENSMGAP00000012156  ................................................
ENSMGAP00000004008  ................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0035583 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
No