SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Calponin-homology domain, CH-domain alignments in Canis familiaris 69_3.1

These alignments are sequences aligned to the 0044393 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1ujoa_               gssgs.........................................................................
ENSCAFP00000031764  y.............................................................................
ENSCAFP00000035137  y.............................................................................
ENSCAFP00000011696  y.............................................................................
ENSCAFP00000023786  eldndnssarlfersrikaladerev....................................................
ENSCAFP00000004040  iqqqysdvnnrwdvddwdnenssarlfersrikaladere......................................
ENSCAFP00000018206  gqysdinnrwdlpdsdwdndsssarlfersrikaladere......................................
ENSCAFP00000007956  srikaladere...................................................................
ENSCAFP00000018519  wdrdllldp.....................................................................
ENSCAFP00000016032  ddeymiqeeewdrdllldp...........................................................
ENSCAFP00000024336  ndymqpeedwdrdllldp............................................................
ENSCAFP00000038823  atderdr.......................................................................
ENSCAFP00000004683  fleglnnl......................................................................
ENSCAFP00000003533  dfsdeddfsqksgsaspapgdtlpwnlpkherskrkihggsvldpaeravlria........................
ENSCAFP00000008756  drdllldp......................................................................
ENSCAFP00000008741  qeddwdrdllldp.................................................................
ENSCAFP00000028904  ekdlaedapwkkiqqn..............................................................
ENSCAFP00000002323  mpstekdlaedapwkkiqqn..........................................................
ENSCAFP00000000453  qnefsdiiksrsdehnd.............................................................
ENSCAFP00000011340  dlaedapwkkiqqn................................................................
ENSCAFP00000040658  dpllfsverenvq.................................................................
ENSCAFP00000023286  hislqaeqed....................................................................
ENSCAFP00000014488  sayemslvrklqaqhtr.............................................................
ENSCAFP00000025983  kqh...........................................................................
ENSCAFP00000016776  rraacrlftsekmvkaikkleieiearrlivrrdrhlwkdvgerqkvlnwllsynplwlrigletvfgellslednsd
ENSCAFP00000000744  plv...........................................................................
ENSCAFP00000025535  hfnrgpayglsaevkn..............................................................
ENSCAFP00000010844  mavnvystsvtsdnlsrhd...........................................................
ENSCAFP00000006909  mavnvystsvtsenlsrhd...........................................................
ENSCAFP00000029060  qfnkgpsyglsaevknrll...........................................................
ENSCAFP00000026490  mavnvystsitqetmsrh............................................................
ENSCAFP00000042920  mavnvystsvtsdnlsrh............................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  manrgpayglsrevqq..............................................................
ENSCAFP00000005642  mavnlystsvtsvnlsqhd...........................................................
ENSCAFP00000011694  evselqeegmnainlplspipfeldpedtmleenevrtmvdpnsrsdp..............................
ENSCAFP00000015262  manrgpsyglsrevqe..............................................................
ENSCAFP00000029793  i.............................................................................
ENSCAFP00000030423  mavniysmsvtsdnlsqh............................................................
ENSCAFP00000031289  nlnltki.......................................................................
ENSCAFP00000038555  fnkgpwyrlsaevknrll............................................................
ENSCAFP00000018867  rqnv..........................................................................
ENSCAFP00000024510  rqnv..........................................................................
ENSCAFP00000023883  hqllvalvgdsllepfwpmgtgiargflaamdsawmvrswslgtsplevlaeresiyrllpqttpenvsknfsqysid
ENSCAFP00000011648  hqllvalvgdsllepfwpmgtgcargflaafdtawmvkswdqgtpplellaereslyrllpqttpeninknfeqytld
ENSCAFP00000013676  rqnm..........................................................................
ENSCAFP00000014399  mksglpkpvhsaapilhvpparagpqpcylklgskvevskttypsqiplksqalqepageglplrksgsvengfdt..
ENSCAFP00000008618  yssrpleltetessmlscqltlkstcefgekkplqekaket.....................................
ENSCAFP00000019079  aavqrstsfgvpnansikqmlldwcraktrg...............................................
ENSCAFP00000022544  aklkrsqsfgvasassikqll.........................................................
ENSCAFP00000005691  glvgdclvepfwplgtgvargflaafdaawmvkrwaegagplevlaereslyqllsqtspenmhrnvaqyeldpatry
ENSCAFP00000001248  ppaeeelpqgekkkylpptsrgdpkfeelqkvlmewinakllpehivvrsleedifdglilhhlflreavraqaevke
ENSCAFP00000020741  fmf...........................................................................
ENSCAFP00000020373  gskrnallkwcq..................................................................
ENSCAFP00000014859  sr............................................................................
ENSCAFP00000026721  ggskrnallkwc..................................................................
ENSCAFP00000011591  ggvknmll......................................................................
ENSCAFP00000042487  hfnqgpayrlsveaknkl............................................................
ENSCAFP00000010246  r.............................................................................
ENSCAFP00000038424  r.............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  vsssqsllewcqe.................................................................
ENSCAFP00000004624  kpnasqsllvwckevtkn............................................................
ENSCAFP00000018733  qr............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ss............................................................................
ENSCAFP00000026940  er............................................................................
ENSCAFP00000042098  ek............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ev............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  llkqlpcipl....................................................................
ENSCAFP00000029192  ppyfpll.......................................................................
ENSCAFP00000002080  dfdslskdnvfen.................................................................
ENSCAFP00000038602  dfdslskdnvfen.................................................................
ENSCAFP00000029565  s.............................................................................
ENSCAFP00000009287  deealhql......................................................................
ENSCAFP00000019405  mankgpsygmsrevqs..............................................................
ENSCAFP00000020391  perillnwmn....................................................................
ENSCAFP00000027014  l.............................................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  ..............................................................................
ENSCAFP00000035137  ..............................................................................
ENSCAFP00000011696  ..............................................................................
ENSCAFP00000023786  ..............................................................................
ENSCAFP00000004040  ..............................................................................
ENSCAFP00000018206  ..............................................................................
ENSCAFP00000007956  ..............................................................................
ENSCAFP00000018519  ..............................................................................
ENSCAFP00000016032  ..............................................................................
ENSCAFP00000024336  ..............................................................................
ENSCAFP00000038823  ..............................................................................
ENSCAFP00000004683  ..............................................................................
ENSCAFP00000003533  ..............................................................................
ENSCAFP00000008756  ..............................................................................
ENSCAFP00000008741  ..............................................................................
ENSCAFP00000028904  ..............................................................................
ENSCAFP00000002323  ..............................................................................
ENSCAFP00000000453  ..............................................................................
ENSCAFP00000011340  ..............................................................................
ENSCAFP00000040658  ..............................................................................
ENSCAFP00000023286  ..............................................................................
ENSCAFP00000014488  ..............................................................................
ENSCAFP00000025983  ..............................................................................
ENSCAFP00000016776  vtglavfilnrllwnpdiaaeyrhptvphlyrdgheealskftlkkllllvcfldyakisklidhdpclfckdaefkt
ENSCAFP00000000744  ..............................................................................
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  ..............................................................................
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  pvtrypnininflrpsqvrhlyntgetrdihlemenlvnsrttpkltrnesvarsskllgwcqrqtdgya........
ENSCAFP00000011648  pgtrypnlnsncvrphqvkhlyitkelhqcplerlgsvrrsmslsrreldirpsklltwcqqqtegy...........
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ptlnlravtphqvqdlydvmakeprrrpsdkpdagkpatgpagtq.................................
ENSCAFP00000001248  maltapsqrrklevvleavngslqvgeqqlkwsvatifskdllatlhllvalakrfqpdlplptnvqvevitmestks
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  ..............................................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  ..............................................................................
ENSCAFP00000035137  ..............................................................................
ENSCAFP00000011696  ..............................................................................
ENSCAFP00000023786  ..............................................................................
ENSCAFP00000004040  ..............................................................................
ENSCAFP00000018206  ..............................................................................
ENSCAFP00000007956  ..............................................................................
ENSCAFP00000018519  ..............................................................................
ENSCAFP00000016032  ..............................................................................
ENSCAFP00000024336  ..............................................................................
ENSCAFP00000038823  ..............................................................................
ENSCAFP00000004683  ..............................................................................
ENSCAFP00000003533  ..............................................................................
ENSCAFP00000008756  ..............................................................................
ENSCAFP00000008741  ..............................................................................
ENSCAFP00000028904  ..............................................................................
ENSCAFP00000002323  ..............................................................................
ENSCAFP00000000453  ..............................................................................
ENSCAFP00000011340  ..............................................................................
ENSCAFP00000040658  ..............................................................................
ENSCAFP00000023286  ..............................................................................
ENSCAFP00000014488  ..............................................................................
ENSCAFP00000025983  ..............................................................................
ENSCAFP00000016776  skdillafsrdflsgegdlsrhlsllglpvnhvqtpfdefdfavtnlavdlqcgvrlvrimelltrdwnlskklrmpa
ENSCAFP00000000744  ..............................................................................
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  ..............................................................................
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  ..............................................................................
ENSCAFP00000011648  ..............................................................................
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ..............................................................................
ENSCAFP00000001248  glkseksveqltecstekdqptkdvfdelfkla.............................................
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  ..............................................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  ..............................................................................
ENSCAFP00000035137  ..............................................................................
ENSCAFP00000011696  ..............................................................................
ENSCAFP00000023786  ..............................................................................
ENSCAFP00000004040  ..............................................................................
ENSCAFP00000018206  ..............................................................................
ENSCAFP00000007956  ..............................................................................
ENSCAFP00000018519  ..............................................................................
ENSCAFP00000016032  ..............................................................................
ENSCAFP00000024336  ..............................................................................
ENSCAFP00000038823  ..............................................................................
ENSCAFP00000004683  ..............................................................................
ENSCAFP00000003533  ..............................................................................
ENSCAFP00000008756  ..............................................................................
ENSCAFP00000008741  ..............................................................................
ENSCAFP00000028904  ..............................................................................
ENSCAFP00000002323  ..............................................................................
ENSCAFP00000000453  ..............................................................................
ENSCAFP00000011340  ..............................................................................
ENSCAFP00000040658  ..............................................................................
ENSCAFP00000023286  ..............................................................................
ENSCAFP00000014488  ..............................................................................
ENSCAFP00000025983  ..............................................................................
ENSCAFP00000016776  isrlqkmhnvdivlqilrsqgiqlndehgnailskdivdrhrektlallwkiafafqvdislnldqlkeeidflkhtq
ENSCAFP00000000744  ..............................................................................
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  ..............................................................................
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  ..............................................................................
ENSCAFP00000011648  ..............................................................................
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ..............................................................................
ENSCAFP00000001248  ..............................................................................
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  ..............................................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                                                            10        20                   30       
                                                             |         |                    |       
d1ujoa_               ..............................-----SGEELEERLVEWIVVQCGPDVG...........RPDRGRLGFQ
ENSCAFP00000031764  ..............................------SEEEKYAFVNWINKALENDPDcrhvi......PMNPNTDDLF
ENSCAFP00000035137  ..............................------SEEEKYAFVNWINKALENDPDcrhvi......PMNPNTNDLF
ENSCAFP00000011696  ..............................------SEEEKVAFVNWINKALEDDPDckhll......PMNPSDGSLF
ENSCAFP00000023786  ..............................--------VQKKTFTKWVNSNLARVPC...........----RITDLY
ENSCAFP00000004040  ..............................-------AVQKKTFTKWVNSHLARVSC...........----RITDLY
ENSCAFP00000018206  ..............................-------AVQKKTFTKWVNSHLARVTC...........----RVGDLY
ENSCAFP00000007956  ..............................-------AVQKKTFTKWVNSHLARVGC...........----HIADLY
ENSCAFP00000018519  ..............................----AWEKQQRKTFTAWCNSHLRKAGT...........----QIENIE
ENSCAFP00000016032  ..............................----AWEKQQRKTFTAWCNSHLRKAGT...........----QIENIE
ENSCAFP00000024336  ..............................----AWEKQQRKTFTAWCNSHLRKAGT...........----QIENIE
ENSCAFP00000038823  ..............................--------VQKKTFTKWVNKHLIKHWRa..........EAQRHISDLY
ENSCAFP00000004683  ..............................--RDERDRVQKKTFTKWVNKHLMKVRK...........----HINDLY
ENSCAFP00000003533  ..............................---DERDKVQKKTFTKWINQHLMKVRK...........----HVNDLY
ENSCAFP00000008756  ..............................----AWEKQQRKTFTAWCNSHLRKAGT...........----QIENID
ENSCAFP00000008741  ..............................----AWEKQQRKTFTAWCNSHLRKAGT...........----QIENID
ENSCAFP00000028904  ..............................------------TFTRWCNEHLKCVSK...........----RIANLQ
ENSCAFP00000002323  ..............................------------TFTRWCNEHLKCVGK...........----RLTDLQ
ENSCAFP00000000453  ..............................--------VQKKTFTKWINARFSKSGK...........P---PINDMF
ENSCAFP00000011340  ..............................------------TFTRWCNEHLK----...........CVNKRIGNLQ
ENSCAFP00000040658  ..............................----------KRTFTRWVNLHLEKCNP...........--PLEVKDLF
ENSCAFP00000023286  ..............................--------TQKKTFTCWINSQLAKHIP...........--PSVVSDLF
ENSCAFP00000014488  ..............................--------MQEKTFTNWINNIFWHGRV...........--GIKIRNLY
ENSCAFP00000025983  ..............................---------------------------...........-----IENLF
ENSCAFP00000016776  smkkmsaqschsdviinkkkdnrnsgsfeq------YSESIKLLMEWVNAVCAFYNK...........----KVENFT
ENSCAFP00000000744  ..............................---------------------------...........-----VDDLF
ENSCAFP00000025535  ..............................KLAQKYDHQREQELREWIEGVTGRRIG...........------NNFM
ENSCAFP00000010844  ..............................-------------MLAWINESLQLNLT...........K--------I
ENSCAFP00000006909  ..............................-------------MLAWVNDSLHLNYT...........K--------I
ENSCAFP00000029060  ..............................---SKYDPQKEAELRSWIEGLTGLSIG...........------PDFQ
ENSCAFP00000026490  ..............................------------DIIAWVNDIVSLNYT...........K--------V
ENSCAFP00000042920  ..............................------------DTLAWINESLQLNLI...........K--------I
ENSCAFP00000027443  ..............................--------ELWRQCTHWLIQCRVLPPShrvt.......WDGAQVCELA
ENSCAFP00000017397  ..............................KIEKQYDADLEQILIQWITTQCRKDVG...........RPQPGRENFQ
ENSCAFP00000005642  ..............................-------------MLAWINESLQLNLT...........K--------I
ENSCAFP00000011694  ..............................-----KLQELMKVLIDWINDVLVGERI...........----IVKDLA
ENSCAFP00000015262  ..............................KIEQKYDADLENKLVDWIILQCAEDIA...........HPPPGRAHFQ
ENSCAFP00000029793  ..............................--ASKYDHQAEEDLRNWIEEVTGMSIG...........------TNFQ
ENSCAFP00000030423  ..............................------------DMLTWINESLQLNLT...........K--------I
ENSCAFP00000031289  ..............................---------------------------...........----------
ENSCAFP00000038555  ..............................---SKYDPQKEAELRSWIEGLMGLSIR...........------PDFQ
ENSCAFP00000018867  ..............................---AYEYLCHLEEAKRWMEACLGEDLP...........----PTTELE
ENSCAFP00000024510  ..............................---AYQYLCRLEEAKRWMEACLKEELP...........----SPVELE
ENSCAFP00000023883  ..............................---------------------------...........--GVNVTDLT
ENSCAFP00000011648  ..............................---------------------------...........-QHVNVTDLT
ENSCAFP00000013676  ..............................---AYEYLCHLEEAKRWMEVCLVEELP...........----PTTELE
ENSCAFP00000014399  ..............................-----------QIYTDWANHYLAKSGH...........--KRLIKDLQ
ENSCAFP00000008618  ..............................--------EDSKIYTDWANHYLAKSGH...........--KRLIKDLQ
ENSCAFP00000019079  ..............................---------------------------...........YEHVDIQNFS
ENSCAFP00000022544  ..............................-----------------LEWCRKKTVG...........YQHVDLQNFS
ENSCAFP00000005691  ..............................-----------EELLRWCREQTAGYPG...........---VHVTDLS
ENSCAFP00000001248  ..............................-------PEKVNMVKEAIVNFVNQKLD...........RLGLSVQNLD
ENSCAFP00000020741  ..............................------LMQQLQAYVAWVNAQLKKRPA...........--VKPVQDLR
ENSCAFP00000020373  ..............................----------------------KKTEG...........YQNIDITNFS
ENSCAFP00000014859  ..............................--HEANLLPMKEDLALWLTNLLGKEIT...........A-----ETFM
ENSCAFP00000026721  ..............................---------------------QKKTEG...........YANIDITNFS
ENSCAFP00000011591  ..............................------------------EWCRAMTRN...........YEHVDIQNFS
ENSCAFP00000042487  ..............................---QKYDHQCEQEIRECIEEVTGHCIS...........------NNLM
ENSCAFP00000010246  ..............................--HEATLLPMQEDLSIWLSGLLGTEVK...........A-----ERLL
ENSCAFP00000038424  ..............................--HEATLLPMQEDLSIWLSGLLGTEVK...........A-----ERLL
ENSCAFP00000019405  ..............................---------------------------...........----------
ENSCAFP00000019828  ..............................-----------------------VTAG...........YRGVRVTNFT
ENSCAFP00000004624  ..............................---------------------------...........YRGVKITNFT
ENSCAFP00000018733  ..............................----EEELELIDQLRKHIEYRLKVSLP...........------CDLG
ENSCAFP00000042257  ..............................-------MNPEERIVTWLISLGVLDSPkk.........TICDPEEFLK
ENSCAFP00000018018  ..............................---EAYVEAMKEDLAEWLNALYGLGLP...........---SGGDGFL
ENSCAFP00000026940  ..............................--------EQIRQLRNNLESRLKVILP...........------DDIG
ENSCAFP00000042098  ..............................--------ELLDQLRESIEMRLKVSLH...........------EDLG
ENSCAFP00000007545  ..............................------------EAQRWVEAVTEKNFE...........-----TKDFR
ENSCAFP00000039939  ..............................----------MAQLRQVLESRLQRPLP...........------EDLA
ENSCAFP00000002604  ..............................------------EAQKWIEQVTGRSFG...........-----DKDFR
ENSCAFP00000016342  ..............................---------------------------...........-----VENLL
ENSCAFP00000029192  ..............................---------------------------...........------EDLM
ENSCAFP00000002080  ..............................---------------------------...........----------
ENSCAFP00000038602  ..............................---------------------------...........----------
ENSCAFP00000029565  ..............................---------------------------...........----------
ENSCAFP00000009287  ..............................--------------YLWV------DNI...........PLSRPKRNLS
ENSCAFP00000019405  ..............................KIEKKYDEELEERLVEWIVMQCGSDVG...........RPDRGRLGFQ
ENSCAFP00000020391  ..............................-------------------TNYENARHiiwknchkgviPSERWIVNFD
ENSCAFP00000027014  ..............................---------------------------...........----------


                       40        50                       60                              70        
                        |         |                        |                               |        
d1ujoa_               VWLKNGVILSKLVNSLY............PE...GSKPVKVPE......N.......PP.........SMVFKQMEQV
ENSCAFP00000031764  KAVGDGIVLCKMINLSV............PD...TIDERAIN-......K.......KK.........LTPFIIQENL
ENSCAFP00000035137  SAVGDGIVLCKMINLSV............PD...TIDERTIN-......K.......KK.........LTPFTIQENL
ENSCAFP00000011696  KSLADGILLCKMINLSE............PD...TIDERAIN-......K.......KK.........LTPFTISENL
ENSCAFP00000023786  KDLRDGRMLIKLLEVLS............GE...ILPKP----......T.......KG.........KMRIHCLENV
ENSCAFP00000004040  TDLRDGRMLIKLLEVLS............GE...RLPKP----......T.......KG.........RMRIHCLENV
ENSCAFP00000018206  SDLRDGRNLLRLLEVLS............GE...TLPKP----......T.......KG.........RMRIHCLENV
ENSCAFP00000007956  ADLRDGFVLTRLLEVLS............GE...QLPRP----......T.......RG.........RMRIHSLENV
ENSCAFP00000018519  EDFRNGLKLMLLLEVIS............GE...RLPRP----......D.......KG.........KMRFHKIANV
ENSCAFP00000016032  EDFRNGLKLMLLLEVIS............GE...RLPKP----......D.......RG.........KMRFHKIANV
ENSCAFP00000024336  EDFRDGLKLMLLLEVIS............GE...RLAKP----......E.......RG.........KMRVHKISNV
ENSCAFP00000038823  EDLRDGHNLISLLEVLS............GD...SLPRE----......-.......KG.........RMRFHKLQNV
ENSCAFP00000004683  EDLRDGHNLISLLEVL-............--...--SGIKLPR......E.......KG.........RMRFHRLQNV
ENSCAFP00000003533  EDLRDGHNLISLLEVLS............GD...TLPRERDFL......KtlrlpreKG.........RMRFHRLQNV
ENSCAFP00000008756  EDFRDGLKLMLLLEVIS............GE...RLPKP----......E.......RG.........KMRVHKINNV
ENSCAFP00000008741  EDFRDGLKLMLLLEVIS............GE...RLPKP----......E.......RG.........KMRVHKINNV
ENSCAFP00000028904  TDLSDGLRLIALLEVLS............QK...KMHRK---H......Nq......RP.........TFRQMQLENV
ENSCAFP00000002323  RDLSDGLRLIALLEVLS............QK...RMYRKF--H......P.......RP.........NFRQMKLENV
ENSCAFP00000000453  TDLKDGRKLLDLLEGLT............GT...SLPKE----......-.......RG.........STRVHALNNV
ENSCAFP00000011340  TDLSDGLRLIALLEVLS............QKr..MYRKY---H......Q.......RP.........TFRQMQLENV
ENSCAFP00000040658  VDIQDGKILMALLEVLS............GR...NLLHE---Y......K.......SS.........SHRIFRLNNI
ENSCAFP00000023286  ADIKKGHVLLDLLEVLS............GQ...QLPR-----......D.......KG.........SNTFQCRINI
ENSCAFP00000014488  RELADGTHLLRLLELIS............GE...ALPPP----......S.......RG.........HMRAHFLENS
ENSCAFP00000025983  SDLQDGRRLLDLLEGLT............GQ...KLPKE----......-.......KG.........STRVHALNNV
ENSCAFP00000016776  VSFSDGRVLCYLIHHYH............PY...YVPFDAI-C......Q.......RT.........TQTIECTQTG
ENSCAFP00000000744  EDMKDGVKLLALLEVLS............GQ...KLPCE---Q......G.......RR.........MKRIHAVANI
ENSCAFP00000025535  DGLKDGIILCEFINKLQ............PG...SVKKV----......N.......ES.........TQNWHQLENI
ENSCAFP00000010844  EQLCSGAAYCQFMDMLF............PG...SIALKKVKF......Q.......A-.........KLEHEYIQNF
ENSCAFP00000006909  EQLCSGAAYCQFMDMLF............PG...CVHLRKVKF......Q.......A-.........KLEHEYIHNF
ENSCAFP00000029060  KGLKDGVILCTLMNKLQ............PG...SVPKI----......N.......RS.........LQNWHQLENL
ENSCAFP00000026490  EQLCSGAAYCQFMDMLF............PG...CISLKKVKF......Q.......AK.........-LEHEYIHNF
ENSCAFP00000042920  EQLCSGAAYCQFMDMLF............PG...SIALKKVKF......Q.......AK.........-LEHEYIQNF
ENSCAFP00000027443  QALRDGVLLCQLLNNLL............PH...AINLREVNL......R.......PQ.........MSQFLCLKNI
ENSCAFP00000017397  NWLKDGTVLCELINGLY............PEgqaPVKKI----......Q.......AS.........TMAFKQMEQI
ENSCAFP00000005642  EQLCSGAAYCQFMDMLF............PG...STALKKVKF......Q.......-A.........KLEHEYIQNL
ENSCAFP00000011694  EDLYDGQVLQKLFEKLE............SE...KLNVA----......E.......VT.........QSEIAQKQKL
ENSCAFP00000015262  QWLMDGTVLCKLINSLY............PPgqePIPKI----......S.......ES.........KMAFKQMEQI
ENSCAFP00000029793  LGLKDGIILCELINKLQ............PG...SVKKV----......N.......ES.........SLNWPQLENI
ENSCAFP00000030423  EQLCSGAAYCQFMDMLF............PG...SIALK----......-.......KA.........KLEHEYIQNF
ENSCAFP00000031289  EQLCSGAAYCQFMDMFF............PG...SIALKKVKF......Q.......A-.........KLEHEYIQNF
ENSCAFP00000038555  KGLKDGVFLCTLMSKLQ............PG...SVLKI----......N.......RS.........LQNWHQLENL
ENSCAFP00000018867  EGLRNGVYLAKLGNFFS............PK...VVSLKKIYD......R.......EQtrykat...GLHFRHTDNV
ENSCAFP00000024510  ESLRNGVLLAKLGHCFA............PA...VVPLKKIYDaeqlryQ.......AT.........GLHFRHTDNI
ENSCAFP00000023883  MSWKSGLALCAIIHRYR............PD...LIDFD----......-.......-S.........LDEQNVEKNN
ENSCAFP00000011648  TSWRSGLALCAIIHRFR............PE...LINFD----......-.......-S.........LNEDDAVENN
ENSCAFP00000013676  EGLRNGVYLAKLAKFFA............PK...MVSEKKIYDveqtryK.......KS.........GLHFRHTDNT
ENSCAFP00000014399  QDVTDGVLLAQIIQVVA............NE...KIEDI---N......G.......CP.........KNRSQMIENI
ENSCAFP00000008618  QDIADGVLLAEIIQIIA............NE...KVEDI---N......G.......CP.........RSQSQMIENV
ENSCAFP00000019079  SSWSDGMAFCALVHNFF............PE...AFDYG----......-.......-Q.........LSPQNRRQNF
ENSCAFP00000022544  SSWSDGMAFCALVHSFF............PD...AFDYG----......-.......-A.........LSPSQRQKNF
ENSCAFP00000005691  SSWADGRALCALVHRLR............PG...LLEPA----......-.......-E.........LRGVGALEAT
ENSCAFP00000001248  NQFADGVFLLLLIGQLE............GF...FLHLKEFY-......L.......TP.........TSPAEMLHNV
ENSCAFP00000020741  QDLRDGVILAYLIEIVA............GE...KLNGVQL--......-.......SP.........SNQQEMKNNV
ENSCAFP00000020373  SSWNDGLAFCALLHTYL............PA...HIPYQELN-......-.......--.........--SQDKRRNF
ENSCAFP00000014859  EKLDNGALLCQLAETVQekfkegmdankpPK...NLPLKKIPC......Kat.....AP.........SGSFFARDNT
ENSCAFP00000026721  SSWSDGLAFCALLHTYL............PA...HIPYQELNS......Q.......EK.........K------RNL
ENSCAFP00000011591  SSWSSGMAFCALIHKFF............PD...AFDYA----......-.......-A.........LEPTQRRHNF
ENSCAFP00000042487  DSLKDGIILCKCISKL-............PG...PMKKV----......S.......ES.........TQNGHQLENI
ENSCAFP00000010246  EELDNGVLLCQLIDVLQnmvkacnsee..LE...NFPMRKVPC......Kkd.....AA.........SGSFFARDNT
ENSCAFP00000038424  EELDNGVLLCQLIDVLQnmvkacnsee..LE...NFPMRKVPC......Kkd.....AA.........SGSFFARDNT
ENSCAFP00000019405  -------ILSKLVNSLY............PD...GSKPVKVPE......N.......PP.........SMVFKQMEQV
ENSCAFP00000019828  TSWRNGLAFCAILHRFH............PD...KIDYA----......-.......-S.........LDPLNIKQNN
ENSCAFP00000004624  TSWRNGLSFCAILHHFR............PD...LIDYK----......-.......-S.........LNPQDIKENN
ENSCAFP00000018733  AALTDGVVLCHLANHVR............PR...SVPSIHVPS......Pav.....PK.........LTMAKCRRNV
ENSCAFP00000042257  SSLKNGVVLCKLINRLR............PG...SLEKY---C......L.......EP.........QTEADCLNNI
ENSCAFP00000018018  TGLATGTTLCQHANAVT............EA...ARALAAARP......A.......RGvafqahsvaPGSFMARDNV
ENSCAFP00000026940  AALMDGVVLCHLANHIR............PR...SVASIHVPS......Pav.....PK.........LSMAKCRRNV
ENSCAFP00000042098  AALMDGVVLCHLVNHIR............PR...SVASIHVPS......Pav.....PK.........LSMAKCRRNV
ENSCAFP00000007545  ASLENGVLLCDLVNKLK............PG...VIKKI----......N.......RL.........STPIAGLDNI
ENSCAFP00000039939  EALANGVILCQLANQLR............PR...SVPFIHVPS......Pav.....PK.........LSTLKSRKNV
ENSCAFP00000002604  TGLENGILLCELLNAIK............PG...LVKKI----......N.......RL.........PTPIAGLDNI
ENSCAFP00000016342  KDGTDGCALAALIHFYC............PG...VVRLEDICL......K.......ET.........MSLADSLYNL
ENSCAFP00000029192  RDGSDGAALLAVVHYYC............PE...HMKLDDICL......K.......EV.........TSMADSLYNI
ENSCAFP00000002080  -----------------............--...---------......-.......--.........---------N
ENSCAFP00000038602  -----------------............--...---------......-.......--.........---------N
ENSCAFP00000029565  -----------------............--...---------......-.......--.........----------
ENSCAFP00000009287  RDFSDGVLVAEVIKFYF............PK...MVEMHNYVP......-.......--.........----------
ENSCAFP00000019405  VWLKNGVV---------............--...---------......-.......--.........----------
ENSCAFP00000020391  RDLLDGLVFATQLGAYC............PF...LIESHLVKM......Yt......QP.........KSSEQYLHNC
ENSCAFP00000027014  QDLASGAALAATIHCYC............PQ...LLRLEEVCL......K.......DP.........MSVADSLYNL


                      80           90       100                         110       120        130    
                       |            |         |                           |         |          |    
d1ujoa_               AQFLKAAED...YGVIKTDMFQTVDL..YE............GK..DM..AAVQRTLMALGSLAVTKN.DGNYRGDPN
ENSCAFP00000031764  NLALNSASA...IGCHVVNI-GAEDL..RA............G-..KP..HLVLGLLWQIIKIGLFA-.---------
ENSCAFP00000035137  NLALNSASA...IGCHVVNI-GAEDL..KE............G-..KP..YLVLGLLWQVIKIGLFA-.---------
ENSCAFP00000011696  NLALNSASA...IGCTVVNI-GAQDL..KE............G-..KP..HLVLGLLWQIIKVGLLAD.---------
ENSCAFP00000023786  DKALQFLKE...QRVHLENM-GSHDI..VD............G-..NH..RLVLGLIWTIILRFQIQD.---------
ENSCAFP00000004040  DKALQFLKE...QRVHLENM-GSHDI..VD............G-..NH..RLTLGLIWTIILRFQIQD.ISV------
ENSCAFP00000018206  DKALQFLKE...QKVHLENM-GSHDI..VD............G-..NH..RLTLGLVWTIILRFQIQD.ISV------
ENSCAFP00000007956  DKALQFLKE...QRVHLENV-GSHDI..VD............G-..NH..RLTLGLVWTIILRFQIQV.IK-------
ENSCAFP00000018519  NKALDFIAS...KGVKLVSI-GAEEI..VD............G-..NL..KMTLGMIWTIILRFAIQD.I--------
ENSCAFP00000016032  NKALDYIAS...KGVKLVSI-GAEEI..VD............G-..NV..KMTLGMIWTIILRFAIQD.I--------
ENSCAFP00000024336  NKALDFIAS...KGVKLVSI-GAEEI..VD............G-..NV..KMTLGMIWTIILRFAIQD.I--------
ENSCAFP00000038823  QIALDYLRH...RQVKLVNI-RNDDI..AD............G-..NP..KLTLGLIWTIILHFQISD.IQVSGQ---
ENSCAFP00000004683  QIALDFLKQ...RQVKLVNI-RNDDI..TD............G-..NP..KLTLGLIWTIILHFQISD.---------
ENSCAFP00000003533  QIALDYLKR...RQVKLVNI-RNDDI..TD............G-..NP..KLTLGLIWTIILHFQISD.IHVT-----
ENSCAFP00000008756  NKALDFIAS...KGVKLVSI-GAEEI..VD............G-..NA..KMTLGMIWTIILRFAIQD.I--------
ENSCAFP00000008741  NKALDFIAS...KGVKLVSI-GAEEI..VD............G-..NA..KMTLGMIWTIILRFAIQD.I--------
ENSCAFP00000028904  SVALEFLDR...ESIKLVSI-DSKAI..VD............G-..NL..KLILGLIWTLILHYS---.---------
ENSCAFP00000002323  SVALEFLER...EHIKLVSI-DSKAI..VD............G-..NL..KLILGLIWTLILHYS---.---------
ENSCAFP00000000453  NRVLQVLHQ...NNVDLVNI-GGTDI..VD............G-..NH..KLTLGLLWSIILHWQVKD.---------
ENSCAFP00000011340  SVALEFLDR...ESIKLVSI-DSKAI..VD............G-..NL..KLILGLVWTLILHYS---.---------
ENSCAFP00000040658  AKALKFLED...SNVKLVSI-DAAEI..AD............G-..NP..SLVLGLIWNIILFFQIKE.LTG------
ENSCAFP00000023286  EHALTFLKN...RSIKLINI-HVTDI..ID............G-..NP..SIILGLIWTIILHFHI--.---------
ENSCAFP00000014488  SRALAFLRGk..VPIPF---IGPENI..VD............G-..DQ..TLILGLIWVIILRFQISH.I--------
ENSCAFP00000025983  NKALRVLQK...NNVDLVNI-GSTDI..VD............G-..NH..KLTLGLIWNIILHWQVKNvMKNIMAGL-
ENSCAFP00000016776  SVVLNS---...--------------..--............--..--..------------------.---------
ENSCAFP00000000744  GTALKFLEG...RKIKLVNI-NSTDI..AD............G-..RP..SIVLGLMWTIILYFQI--.---------
ENSCAFP00000025535  GNFIKAITK...YGVKPHDIFEANDL..FE............NT..NH..TQVQSTLLALASMAKTKG.NKVNVG-VK
ENSCAFP00000010844  KILQAGFKR...MGVDKI--IPVD--..--............--..--..------------------.---------
ENSCAFP00000006909  KVLQAAFKK...MGVDKI--IPVEKL..VK............G-..--..------------------.---------
ENSCAFP00000029060  STFIKAMVS...YGMNPVDLFEANDL..FE............SG..NM..TQVQVSLLALAGKAKTKGlQSGVDIGVK
ENSCAFP00000026490  KLLQASFKR...MNVDKV--------..--............--..--..------------------.---------
ENSCAFP00000042920  KILQAGFKR...MDVDKI--------..--............--..--..------------------.---------
ENSCAFP00000027443  RTFLSTCCEk..FGLKRSELFEAFDL..FD............VQ..DF..GKVIYTLSALSWTPIAQN.KGIMPFPTE
ENSCAFP00000017397  SQFLQAAER...YGINTTDIFQTVDL..WE............GK..NM..ACVQRTLMNLGGLAVARD.DGLFSGDPN
ENSCAFP00000005642  KILQAGIKR...MGVDKIS-------..--............--..--..------------------.---------
ENSCAFP00000011694  QTVLEKINEt..LKLPPRSIKWNVDS..VH............AK..SL..VAILHLLVALSQYF----.---------
ENSCAFP00000015262  SQFLKAAEI...YGVRTTDIFQTVDL..WE............GK..DM..AAVQRTLMALGSVAVTKD.DGCYRGEPS
ENSCAFP00000029793  GNFIKAIQA...YGMKPHDIFEANDL..FE............NG..NM..TQVQTTLVALAGLAKTKGfHTTIDIGVK
ENSCAFP00000030423  KILQAGFKR...TGVDKI--------..--............--..--..------------------.---------
ENSCAFP00000031289  KILQAGFKR...MGVDKI--IPVDKL..VK............--..--..------------------.---------
ENSCAFP00000038555  STFIKAMVS...YGMNPVDLFEANDL..FE............SG..NM..TQVQVSLLTLAGKAKTQGlQSGVDIGVK
ENSCAFP00000018867  IQWLNAMDE...IGLPKIFYPETTDI..YD............RK..NM..PRCIYCIHALSLYLFKLG.LAPQIQDLY
ENSCAFP00000024510  NFWLSAIAH...VGLPSTFFPETTDI..YD............KK..NM..PRVVYCIHALSLFLFRLG.LAPQIHDLY
ENSCAFP00000023883  QLAFDIAEKe..LGI-----------..--............--..--..------------------.---------
ENSCAFP00000011648  QLAFDVAERe..FGIPPVT-------..--............--..--..------------------.---------
ENSCAFP00000013676  VQWLRAMES...IGLPKIFYPETTDV..YD............RK..NI..PRMIYCIHALSLYLFKLG.IAPQIQ---
ENSCAFP00000014399  DACLNFLAA...KGINIQGL-SAEEI..RN............G-..NL..KAILGLFFSLSRYKQQQ-.---------
ENSCAFP00000008618  DVCLSFLAA...RGVNVQGL-SAEEI..RN............G-..NL..KAILGLFFSLSRYKQQQH.HQ-------
ENSCAFP00000019079  EVAFSSAETh..ADCPQL--LDTEDM..VR............LRepDW..KCVYTYIQEFYR------.---------
ENSCAFP00000022544  ELAFSTAENl..ASCERLIEVEDMML..MG............RKp.DP..MCVFTYVQSLY-------.---------
ENSCAFP00000005691  AWALKVAEHe..LGIPPV--LSAKAV..VA............GS..DP..LGL---------------.---------
ENSCAFP00000001248  TLALDLLKD...EGLLTYPV-NPEDI..VN............K-..DA..KSTLRVLYSLF-------.---------
ENSCAFP00000020741  EKVLQFVAS...KKIRMHQT-SAKDI..VE............G-..NL..KSIMRLVLALAAH-----.---------
ENSCAFP00000020373  TLAFQAAES...VGIKST--LDINEMvrTE............RP..DW..QSVMLYVTAI--------.---------
ENSCAFP00000014859  ANFLSWCRD...LGVDETCLFESEGL..VL............HK..QP..REVCLCLLELGRIAARYG.VEPPGL-IK
ENSCAFP00000026721  LLAFEAAES...VGIKPSL--ELSEMlyTD............RP..DW..QSVMQYVAQIYKY-----.---------
ENSCAFP00000011591  TLAFSTAEK...L-------------..--............--..--..------------------.---------
ENSCAFP00000042487  GNFK--ITK...YRVKPHDIFEASDL..FE............NT..SH..TQVQFILTALASMAKMKG.NKVNIG-VK
ENSCAFP00000010246  ANFLHWCRH...IGVDETYLFESEGL..VL............HK..DP..RQVYLCLLEIGRIVSRYG.VEPPVL-VK
ENSCAFP00000038424  ANFLHWCRH...IGVDETYLFESEGL..VL............HK..DP..RQVYLCLLEIGRIVSRYG.VEPPVL-VK
ENSCAFP00000019405  AQFLKAAED...YGVTKTDMFQTVDL..YE............GK..DL..AAVQRTLMALGSLAVTKN.DGHYRGDPN
ENSCAFP00000019828  KQAFDGFAA...LGVSRL--LEPADM..VL............--..--..------------------.---------
ENSCAFP00000004624  KKAYDGFAS...IGISRL--LEPSDM..VL............LAipDK..LTVMTYLYQ---------.---------
ENSCAFP00000018733  ENFLEACRK...IGVPQDNLCSPSDI..LQ............LNl.SV..KRTVETLLSLG-------.---------
ENSCAFP00000042257  SDFLKGCAA...LQVEV---FDPDDL..YS............GA..NF..SKVLSTLLAVNKATEDQL.---------
ENSCAFP00000018018  ATFIGWCRTe..LGVPEVLMFETEDL..VL............RK..NE..KSVVLCLLEVARRGARLG.LLAPR----
ENSCAFP00000026940  ENFLDACKK...LGVSQERLCLPHHI..LE............ER..GL..VKVGVTVQALL-------.---------
ENSCAFP00000042098  ENFLEACRK...LGVPEADLCSPCDV..LQ............L-..DF..RHIRKTVGAL--------.---------
ENSCAFP00000007545  NVFLKACEQ...IGLKEAQLFHPGDL..QDlsnrvtvrqeetDR..RV..KNVLITLYWLGRKAQSNPyYNGPYLNLK
ENSCAFP00000039939  ESFLEACRK...MGVPEESLCQPHHI..LE............EE..G-..------------------.---------
ENSCAFP00000002604  ILFLRGCKE...LGLRESQLFDPSDL..QDtsnrvtvksldySR..KL..KNVLVTIYWLGKAANSSAsYSG------
ENSCAFP00000016342  QLIQEFCQE...Y-LNQCCHFTLEDM..L-............--..--..------------------.---------
ENSCAFP00000029192  RLLREFSNE...Y-------------..--............--..--..------------------.---------
ENSCAFP00000002080  RLAFKVDEKe..LGIPA--------L..LD............RN..DMicMSVPDCLSIMT-------.---------
ENSCAFP00000038602  RLAFKVDEKe..LGIPA--------L..LD............RN..DMicMSVPDCLSIMT-------.---------
ENSCAFP00000029565  ---------...------ELFEAFDL..FD............VR..DF..GKVIETLSRLSRTPIALA.TGIRPFPTE
ENSCAFP00000009287  ---------...--------------..--............--..--..------------------.---------
ENSCAFP00000019405  ---------...--------------..--............--..--..------------------.---------
ENSCAFP00000020391  LIIVNVLHE...I-------------..--............--..--..------------------.---------
ENSCAFP00000027014  QLVQDFCASrlpRGCPL----SLEDL..LY............V-..--..------------------.---------


                         140                                                                        
                           |                                                                        
d1ujoa_               WFMKSG----pssg................................................................
ENSCAFP00000031764  ----------dielsrnealaallrdgetleelmklspeelllrwanfhlensgwqkinnfsadikdskayfhllnqi
ENSCAFP00000035137  ----------dielsrnealiallregesledlmklspeelllrwanyhlenagcnkinnfstdikdskayyhlleqv
ENSCAFP00000011696  ----------ieisrnealiallkegedleelmklspeelllrwvnyhltnagwpninnfsqdikdsrayfhllnqia
ENSCAFP00000023786  ----------iivqtqegretrsakdalllwcqmktagypqvnvtnftsswkdglafnalihkhrpdlidfdklkdsn
ENSCAFP00000004040  ----------etednkekksakdalllwcqmktagypnvnihnfttswrdgmafnalihkhrpdlidfdklkksnahy
ENSCAFP00000018206  ----------etednkekksakdalllwcqmktagypnvnvhnfttswrdglafnaivhkhrpdlldfeslkkcnahy
ENSCAFP00000007956  ----------ietednretrsakdalllwcqmktagypevniqnfttswrdglafnalihrhrpdlvdfskltksnan
ENSCAFP00000018519  ----------sveetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddpignlnt
ENSCAFP00000016032  ----------sveetsakeglllwcqrktapyrnvniqnfhtswkdglglcalihrhrpdlidysklnkddpigninl
ENSCAFP00000024336  ----------sveetsakeglllwcqrktapyknvniqnfhiswkdglgfcalihrhrpelidygklrkddpltnlnt
ENSCAFP00000038823  ----------sedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhrpmlidmskvyrqtnlenldqa
ENSCAFP00000004683  ----------iyisgesgdmsakeklllwtqkvtagytgikctnfsscwsdgkmfnalihryrpdlvdmervqiqsnr
ENSCAFP00000003533  ----------gesedmsakerlllwtqqategyagircenfttcwrdgklfnaiihkyrpdlidmntvavqsnlanle
ENSCAFP00000008756  ----------sveetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddpvtnlnn
ENSCAFP00000008741  ----------sveetsakeglllwcqrktapyknvnvqnfhiswkdglafnalihrhrpelieydklrkddpvtnlnn
ENSCAFP00000028904  ----------ismpmwdeeedeeakkqtpkqrllgwiqnklpqlpitnfsrdwqsgralgalvdscapglcpdwdswd
ENSCAFP00000002323  ----------ismpmwededdedarkqtpkqrllgwiqnkvpqlpitnfnrdwqdgkalgalvdncapglcpdweawd
ENSCAFP00000000453  ----------vmkdvmsdlqqtnsekillswvrqstrpysqvnvlnfttswtdglafnavlhrhkpdlfswdrvvkms
ENSCAFP00000011340  ----------ismpvwedegdddakkqtpkqrllgwiqnkipylpitnfnqnwqdgkalgalvdscapglcpdweswd
ENSCAFP00000040658  ----------nlsrnspssslspgsggtdsdssfpptptaersmavsvkdqrkairtllawvqrktrkygvavqdfag
ENSCAFP00000023286  ----------eelartlscnynqpsldsvsvadssptssppakkcsraqerwqmsakkalllwaqeqcasyesvnvtd
ENSCAFP00000014488  ----------sldreefgasaallsakeallvwcqrktagyanvnitdfsrswsdglafsalihahrpdlldycslhp
ENSCAFP00000025983  ----------qqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpdlfdwnsvvcqqsatqrleha
ENSCAFP00000016776  ----------ssesdgssldlslkafdhentselykellenekknfqlvrsavrdlggipaminhsdmsntipdekvv
ENSCAFP00000000744  ----------eeltsnlpqlqslsgstssvdsmvsaetasppskrkvatkiqgnakkallkwvqytvaklrqtgtevk
ENSCAFP00000025535  YAEKQERKF-epeklregrniiglqmgtnkfasqqgmtaygtrr..................................
ENSCAFP00000010844  ----------klvkgkfqdnfefvqwfkkffdanydgkdydpvaar................................
ENSCAFP00000006909  ----------kfqdnfefiqwfkkffdanydgkdynpllar.....................................
ENSCAFP00000029060  YSEKQERNF-ddatmkaghcviglqmgtnkcasqsgmtaygtrr..................................
ENSCAFP00000026490  ----------ipveklvkgrfqdnldfiqwfkkfydanydgkeydpvear............................
ENSCAFP00000042920  ----------ipvdqlvkgkfqdnfefvqwfkkffdanydgkdydpvaar............................
ENSCAFP00000027443  E---------esvgdediysglsdqiddtveededlydcveneeaegdeiyedlmrtepmpmppkmteydkrccclre
ENSCAFP00000017397  WFPKKSKE--nprnfsdnqlqegknviglqmgtnrgasqagmtgygmpr.............................
ENSCAFP00000005642  ----------pvdklvkgkfqdnfefvqwfkkffdanydgkdcdpvaar.............................
ENSCAFP00000011694  ----------rapirlpdhvsiqvvvvqkregilqsrqiqeeitgntealsgrherdafdtlfdhapdklnvvkktli
ENSCAFP00000015262  WFHRKA----qqnrrgfseeqlrqgqnviglqmgsnkgasqagmtgygmpr...........................
ENSCAFP00000029793  YAEKQTRRF-degklkagqsviglqmgtnkcasqagmtaygtrr..................................
ENSCAFP00000030423  ----------ipvdklvkgnfqdnfefvqwkkffdahydgkdydpvfar.............................
ENSCAFP00000031289  ----------gkfqenfefvqwfkkffdanydgkdydpvgar....................................
ENSCAFP00000038555  YSEKQE----qlqrrhheagqcvvglqigtnkcasqsgmtaygtrr................................
ENSCAFP00000018867  ----------gkvdfteeeinnmkielekygiqmpafs........................................
ENSCAFP00000024510  GKV-------kfsaeelsnmaselakyglqlpafs...........................................
ENSCAFP00000023883  ----------spimtgkemasvgepdklsmvmyltqfyemfkd...................................
ENSCAFP00000011648  ----------tgkemasaqepdklsmvmylskfyelfr........................................
ENSCAFP00000013676  ----------dllgkvdfteeeisnmrkelekygiqmpsfs.....................................
ENSCAFP00000014399  ----------qqp.................................................................
ENSCAFP00000008618  ----------qqyyqslaelqqrvs.....................................................
ENSCAFP00000019079  ----------cl..................................................................
ENSCAFP00000022544  ----------nhlr................................................................
ENSCAFP00000005691  ----------iaylshfhstfkn.......................................................
ENSCAFP00000001248  ----------qkh.................................................................
ENSCAFP00000020741  ----------fkpgssrtvsqgrdsraplqshqphca.........................................
ENSCAFP00000020373  ----------ykyf................................................................
ENSCAFP00000014859  LEKEIE----qeetlsaps...........................................................
ENSCAFP00000026721  ----------f...................................................................
ENSCAFP00000011591  ----------adcaqllevddmvrlavpdskcvytyiqelyr....................................
ENSCAFP00000042487  YAEEQELK--felgklregqsiiglqmgtnkfasqqgtmaygsqh.................................
ENSCAFP00000010246  LEKEIE----leetllntsgped.......................................................
ENSCAFP00000038424  LEKEIE----leetllntsgped.......................................................
ENSCAFP00000019405  WFMKKA----qe..................................................................
ENSCAFP00000019828  ----------lsvpdklivmtylcqir...................................................
ENSCAFP00000004624  ----------irahf...............................................................
ENSCAFP00000018733  ----------ah..................................................................
ENSCAFP00000042257  ----------serpc...............................................................
ENSCAFP00000018018  ----------lvqfeqeierelraap....................................................
ENSCAFP00000026940  ----------elp.................................................................
ENSCAFP00000042098  ----------l...................................................................
ENSCAFP00000007545  ----------afe.................................................................
ENSCAFP00000039939  ----------apgrglpyiaavihal....................................................
ENSCAFP00000002604  ----------ttlnlkefegllaqmrketddiespkrsirdsgyid................................
ENSCAFP00000016342  ----------yaassiksnylvfmaelfwwfe..............................................
ENSCAFP00000029192  ----------lnkcfyltledmlyaplvlkpnvmvfiaelfwwfenvkpdfv..........................
ENSCAFP00000002080  ----------yvsqyynhf...........................................................
ENSCAFP00000038602  ----------yvsqyynhf...........................................................
ENSCAFP00000029565  ES--------vsdediykglpdlidethvddeeglydcvygedeggevyedlmkaeeahqpkcpendirscclaeikq
ENSCAFP00000009287  ----------anslqqklsnwghlnrkvlnkln.............................................
ENSCAFP00000019405  ----------....................................................................
ENSCAFP00000020391  ----------g...................................................................
ENSCAFP00000027014  ----------ppplkinlvvllaemfmc..................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  apkgqkegepridinmsgfnetddlkraesmlqqadklgcrqfvtpadvvsgnpklnlafvanlfnkypaltkpenqd
ENSCAFP00000035137  apkgdeegipavvidmsglrekddiqraecmlqqaerlgcrqfvtatdvvrgnpklnlafianlfnrypalhkpenqd
ENSCAFP00000011696  pkgdqgdepaitidlsgfnekndlkragfmlqeadklgcrqfvtpadvvsgnpklnlafvanlfntypclhkpdndid
ENSCAFP00000023786  arhnlehafdvaerqlgiiplldpedvftenpdeksiityvvafyhyfsk............................
ENSCAFP00000004040  nlqnafnlaeqhlgltklldpedisvdhpdeksiityvvtyyhyfsk...............................
ENSCAFP00000018206  nlqnafnlaekelgltklldpedvnvdqpdeksiityvatyyhyfsk...............................
ENSCAFP00000007956  ynlqrafrtaeqhlgltrlldpedvnmeapdeksiityvvsfyhyfsk..............................
ENSCAFP00000018519  afevaekyldiprmldaedivntpkpdekaimtyvscfyhaf....................................
ENSCAFP00000016032  ameiaekhldipkmldaedivntpkpderaimtyvscfyhaf....................................
ENSCAFP00000024336  afdvaekyldipkmldaedivgtarpdekaimtyvssfyhaf....................................
ENSCAFP00000038823  fsvaerdlgvtrlldpedvdvpqpdeksiityvssly.........................................
ENSCAFP00000004683  enleqafevaerlgvtrlldaedvdvpspdeksvityvssiy....................................
ENSCAFP00000003533  hafyvaekigvirlldpedvdvsspdeksvityvssly........................................
ENSCAFP00000008756  afevaekyldipkmldaedivgtlrpdekaimtyvscfyhaf....................................
ENSCAFP00000008741  afevaekyldipkmldaedivntarpdekaimtyvssfyh......................................
ENSCAFP00000028904  askpvnnareamqqaddwlgipqvitpeeivdpnvdehsvmtylsqf...............................
ENSCAFP00000002323  pnqpvenareamqqaddwlgvpqviapeeivdpnvdehsvmtylsqfpkaklk.........................
ENSCAFP00000000453  pierlehafskaqtylgieklldpedvavqlpdkksiimyltslf.................................
ENSCAFP00000011340  prkpvdnareamqqaddwlgvpqvitpeeiihpdvdehsvmtylsqf...............................
ENSCAFP00000040658  swrsgmaflavikaidpslvdmkqaledsmrenlekafsiahealhiprllepedimvdtpdeqsivtyvaqflehfp
ENSCAFP00000023286  fksswrngmaflavihalrpdlidmksvkhrsnkdnlkeafgiaerefkipkllepedvdvanpdeksimtyvaqfl.
ENSCAFP00000014488  krplhnldlafhvaeqelgiaqlldpedvaalqpdersimtyvslyyh..............................
ENSCAFP00000025983  fniakyqlgieklldpedvattypdkksilmyitslf.........................................
ENSCAFP00000016776  itylsflcsrll..................................................................
ENSCAFP00000000744  dfgrswrsgvafhsvihairpelvdlekvkgrsnrenleeaftiaetelgiprlldpedvdvdkpdeksimtyvaqfl
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  iqqteekytdtlgsiqqhfmkplqrflkpqdiei............................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  tfvnkhlnklnlevteletqfadgvylvllmgllegyfvplhsffltpdsfeqkvlnvsfafelmqdgglek......
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  ..............................................................................
ENSCAFP00000011648  ..............................................................................
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ..............................................................................
ENSCAFP00000001248  ..............................................................................
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  teekytetlesiekyfmaplkrf.......................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  idwtllegetreertfrnwmnslgvnphvnhlyadlqdalvilqlyerikvpvdwskvnkppypklganmkklencny
ENSCAFP00000035137  idwgalegetreertfrnwmnslgvnprvnhlysdladalvifqlyekikvpvdwnrvnkppypklggnmkklencny
ENSCAFP00000011696  inllegeskeertfrnwmnslgvnpyinhlysdladalvifqlyemirvpvkwsrvnkppypalggnmkkiencnyav
ENSCAFP00000023786  ..............................................................................
ENSCAFP00000004040  ..............................................................................
ENSCAFP00000018206  ..............................................................................
ENSCAFP00000007956  ..............................................................................
ENSCAFP00000018519  ..............................................................................
ENSCAFP00000016032  ..............................................................................
ENSCAFP00000024336  ..............................................................................
ENSCAFP00000038823  ..............................................................................
ENSCAFP00000004683  ..............................................................................
ENSCAFP00000003533  ..............................................................................
ENSCAFP00000008756  ..............................................................................
ENSCAFP00000008741  ..............................................................................
ENSCAFP00000028904  ..............................................................................
ENSCAFP00000002323  ..............................................................................
ENSCAFP00000000453  ..............................................................................
ENSCAFP00000011340  ..............................................................................
ENSCAFP00000040658  e.............................................................................
ENSCAFP00000023286  ..............................................................................
ENSCAFP00000014488  ..............................................................................
ENSCAFP00000025983  ..............................................................................
ENSCAFP00000016776  ..............................................................................
ENSCAFP00000000744  ..............................................................................
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  ..............................................................................
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  ..............................................................................
ENSCAFP00000011648  ..............................................................................
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ..............................................................................
ENSCAFP00000001248  ..............................................................................
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  ..............................................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  avelgkhpakfslvgiggqdlndgnqtltlalvwqlmrrytlnvledlgdgqkanddiivswvnrtlaeagkstsiqs
ENSCAFP00000035137  avelgknqakfslvgiggqdlnegnrtltlaliwqlmrrytlnileeigggqkvnddiivnwvnetlkeaeksssiss
ENSCAFP00000011696  elgkteakfslvgiagqdlnegnstltlalvwqlmrrytlnvlsdlgegekvndeiiikwvnetlksaqkptsissfk
ENSCAFP00000023786  ..............................................................................
ENSCAFP00000004040  ..............................................................................
ENSCAFP00000018206  ..............................................................................
ENSCAFP00000007956  ..............................................................................
ENSCAFP00000018519  ..............................................................................
ENSCAFP00000016032  ..............................................................................
ENSCAFP00000024336  ..............................................................................
ENSCAFP00000038823  ..............................................................................
ENSCAFP00000004683  ..............................................................................
ENSCAFP00000003533  ..............................................................................
ENSCAFP00000008756  ..............................................................................
ENSCAFP00000008741  ..............................................................................
ENSCAFP00000028904  ..............................................................................
ENSCAFP00000002323  ..............................................................................
ENSCAFP00000000453  ..............................................................................
ENSCAFP00000011340  ..............................................................................
ENSCAFP00000040658  ..............................................................................
ENSCAFP00000023286  ..............................................................................
ENSCAFP00000014488  ..............................................................................
ENSCAFP00000025983  ..............................................................................
ENSCAFP00000016776  ..............................................................................
ENSCAFP00000000744  ..............................................................................
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  ..............................................................................
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  ..............................................................................
ENSCAFP00000011648  ..............................................................................
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ..............................................................................
ENSCAFP00000001248  ..............................................................................
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  ..............................................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                                                                                                    
                                                                                                    
d1ujoa_               ..............................................................................
ENSCAFP00000031764  fkdktissslavvdlidaiqpgcinydlvksgnlteddkhnnakyavsmarrigarvyalpedlvevkpkmvmtvfac
ENSCAFP00000035137  fkdpkistslpvldlidaiqpgsinydllktenlndeeklnnakyaismarkigarvyalpedlvevnpkmvmtvfac
ENSCAFP00000011696  dktistslpvldlidaiapnavrqemikrenlseedklnnakyaisvarkigariyalpddlvevkpkmvmtvfaclm
ENSCAFP00000023786  ..............................................................................
ENSCAFP00000004040  ..............................................................................
ENSCAFP00000018206  ..............................................................................
ENSCAFP00000007956  ..............................................................................
ENSCAFP00000018519  ..............................................................................
ENSCAFP00000016032  ..............................................................................
ENSCAFP00000024336  ..............................................................................
ENSCAFP00000038823  ..............................................................................
ENSCAFP00000004683  ..............................................................................
ENSCAFP00000003533  ..............................................................................
ENSCAFP00000008756  ..............................................................................
ENSCAFP00000008741  ..............................................................................
ENSCAFP00000028904  ..............................................................................
ENSCAFP00000002323  ..............................................................................
ENSCAFP00000000453  ..............................................................................
ENSCAFP00000011340  ..............................................................................
ENSCAFP00000040658  ..............................................................................
ENSCAFP00000023286  ..............................................................................
ENSCAFP00000014488  ..............................................................................
ENSCAFP00000025983  ..............................................................................
ENSCAFP00000016776  ..............................................................................
ENSCAFP00000000744  ..............................................................................
ENSCAFP00000025535  ..............................................................................
ENSCAFP00000010844  ..............................................................................
ENSCAFP00000006909  ..............................................................................
ENSCAFP00000029060  ..............................................................................
ENSCAFP00000026490  ..............................................................................
ENSCAFP00000042920  ..............................................................................
ENSCAFP00000027443  ..............................................................................
ENSCAFP00000017397  ..............................................................................
ENSCAFP00000005642  ..............................................................................
ENSCAFP00000011694  ..............................................................................
ENSCAFP00000015262  ..............................................................................
ENSCAFP00000029793  ..............................................................................
ENSCAFP00000030423  ..............................................................................
ENSCAFP00000031289  ..............................................................................
ENSCAFP00000038555  ..............................................................................
ENSCAFP00000018867  ..............................................................................
ENSCAFP00000024510  ..............................................................................
ENSCAFP00000023883  ..............................................................................
ENSCAFP00000011648  ..............................................................................
ENSCAFP00000013676  ..............................................................................
ENSCAFP00000014399  ..............................................................................
ENSCAFP00000008618  ..............................................................................
ENSCAFP00000019079  ..............................................................................
ENSCAFP00000022544  ..............................................................................
ENSCAFP00000005691  ..............................................................................
ENSCAFP00000001248  ..............................................................................
ENSCAFP00000020741  ..............................................................................
ENSCAFP00000020373  ..............................................................................
ENSCAFP00000014859  ..............................................................................
ENSCAFP00000026721  ..............................................................................
ENSCAFP00000011591  ..............................................................................
ENSCAFP00000042487  ..............................................................................
ENSCAFP00000010246  ..............................................................................
ENSCAFP00000038424  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000019828  ..............................................................................
ENSCAFP00000004624  ..............................................................................
ENSCAFP00000018733  ..............................................................................
ENSCAFP00000042257  ..............................................................................
ENSCAFP00000018018  ..............................................................................
ENSCAFP00000026940  ..............................................................................
ENSCAFP00000042098  ..............................................................................
ENSCAFP00000007545  ..............................................................................
ENSCAFP00000039939  ..............................................................................
ENSCAFP00000002604  ..............................................................................
ENSCAFP00000016342  ..............................................................................
ENSCAFP00000029192  ..............................................................................
ENSCAFP00000002080  ..............................................................................
ENSCAFP00000038602  ..............................................................................
ENSCAFP00000029565  ..............................................................................
ENSCAFP00000009287  ..............................................................................
ENSCAFP00000019405  ..............................................................................
ENSCAFP00000020391  ..............................................................................
ENSCAFP00000027014  ..............................................................................


                        
                        
d1ujoa_               ..
ENSCAFP00000031764  lm
ENSCAFP00000035137  lm
ENSCAFP00000011696  ..
ENSCAFP00000023786  ..
ENSCAFP00000004040  ..
ENSCAFP00000018206  ..
ENSCAFP00000007956  ..
ENSCAFP00000018519  ..
ENSCAFP00000016032  ..
ENSCAFP00000024336  ..
ENSCAFP00000038823  ..
ENSCAFP00000004683  ..
ENSCAFP00000003533  ..
ENSCAFP00000008756  ..
ENSCAFP00000008741  ..
ENSCAFP00000028904  ..
ENSCAFP00000002323  ..
ENSCAFP00000000453  ..
ENSCAFP00000011340  ..
ENSCAFP00000040658  ..
ENSCAFP00000023286  ..
ENSCAFP00000014488  ..
ENSCAFP00000025983  ..
ENSCAFP00000016776  ..
ENSCAFP00000000744  ..
ENSCAFP00000025535  ..
ENSCAFP00000010844  ..
ENSCAFP00000006909  ..
ENSCAFP00000029060  ..
ENSCAFP00000026490  ..
ENSCAFP00000042920  ..
ENSCAFP00000027443  ..
ENSCAFP00000017397  ..
ENSCAFP00000005642  ..
ENSCAFP00000011694  ..
ENSCAFP00000015262  ..
ENSCAFP00000029793  ..
ENSCAFP00000030423  ..
ENSCAFP00000031289  ..
ENSCAFP00000038555  ..
ENSCAFP00000018867  ..
ENSCAFP00000024510  ..
ENSCAFP00000023883  ..
ENSCAFP00000011648  ..
ENSCAFP00000013676  ..
ENSCAFP00000014399  ..
ENSCAFP00000008618  ..
ENSCAFP00000019079  ..
ENSCAFP00000022544  ..
ENSCAFP00000005691  ..
ENSCAFP00000001248  ..
ENSCAFP00000020741  ..
ENSCAFP00000020373  ..
ENSCAFP00000014859  ..
ENSCAFP00000026721  ..
ENSCAFP00000011591  ..
ENSCAFP00000042487  ..
ENSCAFP00000010246  ..
ENSCAFP00000038424  ..
ENSCAFP00000019405  ..
ENSCAFP00000019828  ..
ENSCAFP00000004624  ..
ENSCAFP00000018733  ..
ENSCAFP00000042257  ..
ENSCAFP00000018018  ..
ENSCAFP00000026940  ..
ENSCAFP00000042098  ..
ENSCAFP00000007545  ..
ENSCAFP00000039939  ..
ENSCAFP00000002604  ..
ENSCAFP00000016342  ..
ENSCAFP00000029192  ..
ENSCAFP00000002080  ..
ENSCAFP00000038602  ..
ENSCAFP00000029565  ..
ENSCAFP00000009287  ..
ENSCAFP00000019405  ..
ENSCAFP00000020391  ..
ENSCAFP00000027014  ..


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0044393 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Methanococcus vannielii SB
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Staphylococcus pasteuri SP1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   1_Upper_euphotic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]