SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

DEATH domain alignments in Monodelphis domestica 69_5

These alignments are sequences aligned to the 0045697 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1a1za_               ..............................................................................
ENSMODP00000012034  ..............................................................................
ENSMODP00000023115  mnktvtsstyvrclnvglirqladfidpqegwkklavdikkpsgenrynqfhirrfegllqngksptsellfdwgttn
ENSMODP00000018969  ..............................................................................
ENSMODP00000036251  ..............................................................................
ENSMODP00000033729  sprttqyiyqlpswvledfchkmdsls...................................................
ENSMODP00000011339  pwepaafpaslplfdlppsllgafcsildscdgvlgwrglaerissswlevrhiekymeqgksgtrellwswaqk...
ENSMODP00000031781  meesqrelfqknrlrlvcelqveplwdlmldrelftrdmiediqragtrrd...........................
ENSMODP00000006984  qerieerlahiadhlgfswtelareldfteeq..............................................
ENSMODP00000024670  d.............................................................................
ENSMODP00000025242  tesv..........................................................................
ENSMODP00000021315  pqspcertdirmaivadhlglswtelarel................................................
ENSMODP00000010574  dttgvldkhldpvrenlgknwkkcarrlgftesqideidhdydrdglkek............................
ENSMODP00000011797  metrdkqvlrslrlelgsevlvdglv....................................................
ENSMODP00000024041  afsiplpirqklcssldapqtrghdwrmlahklkldrylnyfat..................................
ENSMODP00000040167  ..............................................................................
ENSMODP00000001598  meqehqealkknrvvlakqlllsellehllekdiit..........................................
ENSMODP00000000728  masddltlirknrmalfqhlt.........................................................
ENSMODP00000025564  vpgspslgavninrlrepalrglsdaldraadgrgwkklaelagtrgryrlscldleqcslkvlepegspsrcllkll
ENSMODP00000013080  lsgtdradmk....................................................................
ENSMODP00000026840  espdvrldkpvtgdqielfanklgeqwkilapylemkdsdikqiesdsedvkmrakqllvawqdqegi..........
ENSMODP00000040167  e.............................................................................
ENSMODP00000010893  afkiplsirqkicnsldapnsrgndwrllaqklsmdrylnyfatkasptgv...........................
ENSMODP00000000705  esddlsliqknrmalfqh............................................................
ENSMODP00000000353  maevkkdalenlrvylcekiiaerhfdhl.................................................
ENSMODP00000018737  aesgfltqsnlvtvarrlgpdwqsvalhl.................................................
ENSMODP00000020549  ktlsdhllhtl...................................................................
ENSMODP00000041337  vqqlkekknmfvesvnkdiingllddllesgmitq...........................................
ENSMODP00000034033  kvlkekrrlfvesvdrgvingllddllel.................................................
ENSMODP00000000694  eelwekiegvrh..................................................................
ENSMODP00000000253  edalwenvecnrhmlsry............................................................
ENSMODP00000009538  mdakarncllqhkealerdiktsylmdhmisdqvlslseeekirneptqkkraallitvllgkdnnsyisf.......
ENSMODP00000034022  kvlmekrrlfvesvdrgvmngllddllevqvln.............................................
ENSMODP00000015678  adtilcclvtyleelecgelskfkmylgleaeregeervprgrmekagpldlakilvaqwgpaeawe...........
ENSMODP00000037460  mtrardlilra...................................................................
ENSMODP00000022511  dhp...........................................................................
ENSMODP00000011797  philtsspsdqqinqlarklgpewepvalslglsqrdiy.......................................
ENSMODP00000013104  gvetqhirsvmwrlatkylkhndwkklahywkftdahiraieqqwt................................
ENSMODP00000006219  afkipflirqkiissldppcgrgadwrtlaqklhldshlgffask.................................
ENSMODP00000031142  gpqlyevmdavparrwkefvrtlglreaeieaveaeigrfrdqq..................................
ENSMODP00000018873  ..............................................................................
ENSMODP00000021908  eecwnmlegfrvklisiidpsritpylrqckvinlddeeqvlsdpnlv..............................
ENSMODP00000021909  eecwnmlegfrvklisiidpsritpylrqckvinlddeeqvlsdpnlv..............................
ENSMODP00000013743  afkipysirqricatfdtpsakgkdwqmlaqknsinrnlsyfat..................................
ENSMODP00000039551  glysnlpaakreevekllnssseetwrhlagelgylperidsltredypvralldswa....................
ENSMODP00000016391  pcnrlppelfeqlq................................................................
ENSMODP00000003605  hsletkqirsslwklayhqlkaqewrklarswefldeqikaieeqwsgskss..........................
ENSMODP00000037737  asdlnlltrrklsrlldppdpmgkdwcllamnlglpelvakynngthkdflpspv.......................
ENSMODP00000018969  ..............................................................................
ENSMODP00000019080  psfmkllkvdrellvthirnvqclldnl..................................................
ENSMODP00000027815  qlprgqqeeveqlleagspagwqvlaeqlgfeteavetmgrdpapahtllnnwatqggsgat................
ENSMODP00000025395  maseiiekerqnfvkilqqdpd........................................................
ENSMODP00000037460  ihfvekhrtslinrvtsvdaildrlhgsvlsqeqydavraenthqnkmrk............................
ENSMODP00000025861  mkqldeeaklqlykllempdpdknwstlaqklglgilnnafrlspapsk.............................
ENSMODP00000036251  ..............................................................................
ENSMODP00000009583  qqwiqskredivhqmteaclnqcldallskdll.............................................
ENSMODP00000011508  lqksfvifaqkvpwqywnqymnllglspneiam.............................................
ENSMODP00000014557  pgdpasqrflyevpawvmcr..........................................................
ENSMODP00000014409  lhfvdqhrnqiisrvtsvdiildrlhsqflsnedyehiraektnpekmrrlfsfsps.....................
ENSMODP00000037465  margrdlilqsl..................................................................
ENSMODP00000007741  lkfarlvgrkwrtvgralqcpa........................................................
ENSMODP00000030256  vyycnghgidilklvaaqvgsqwkdiyqflcnaserevaafsngytadherayaalqhwtirgpe.............
ENSMODP00000005003  frfafptkftpnwlsvlvdslpgtkvnaemierikrrhss......................................
ENSMODP00000007693  iqerpseliqrerrrlvdtlkndsrilldglfargvifv.......................................
ENSMODP00000002694  eenlweimenhrhkivhnvypnrltpylrqakvldqldeee.....................................
ENSMODP00000025675  ..............................................................................
ENSMODP00000039722  eklmklsqhvghewrtlgimclglqqh...................................................
ENSMODP00000039043  geillsgl......................................................................
ENSMODP00000004061  yatqvmkmkkeelaagikdadlllkrlvdygiftseqklalshyet................................
ENSMODP00000039722  eiqilevlrdledaefktfkkilsqeevrastwal...........................................
ENSMODP00000040136  ekvlsdkqlmtlarklgkewiqlaianlgleiadidniqek.....................................
ENSMODP00000018873  q.............................................................................
ENSMODP00000015935  q.............................................................................
ENSMODP00000032734  mesfkaqvvstl..................................................................
ENSMODP00000003599  sptelpfdclektsrmlsstyntekaivktwrhlaesfglkrdeigg...............................
ENSMODP00000034911  kldpchptvknwrnfaskwgmhydelcfleqkqqsptlefllrn..................................
ENSMODP00000040512  mkvlkdfc......................................................................
ENSMODP00000031541  evleelvilldpepgprggsawgttrhlaaryglpaswatfayslrparsplralletvtardptaq...........
ENSMODP00000017926  qiltnkeaekfrnpktslri..........................................................
ENSMODP00000005003  qlrslmeslpgkkvglediektmklc....................................................


                                    10          20                   30                          40 
                                     |           |                    |                           | 
d1a1za_               ......MDPFLVLLHSVSSSLSSS..ELTELKG...LCLG........R.....VGKRK.............LERVQS
ENSMODP00000012034  ......MAEYGTLLQDLTDNITHE..DLEQLKS...ACKE........D.....IPSEK.............SDEITT
ENSMODP00000023115  .....c------------------..-------...----........-.....-----.............-----T
ENSMODP00000018969  ......-MDFHTFLYGIAEEIDSA..DLASLKF...LCLD........Q.....IPLKK.............QQHIKD
ENSMODP00000036251  ......--KFNQQLLSINEKLEPE..EIEALKF...LCSD........L.....ISPRN.............LEDIES
ENSMODP00000033729  ......------------------..EWDWMQF...ASYV........M.....TDQTQ.............LRKIKS
ENSMODP00000011339  ......------------------..-------...----........-.....-----.............---NKT
ENSMODP00000031781  ......------------------..-------...----........-.....-----.............-----Q
ENSMODP00000006984  ......------------------..-------...----........-.....IHQIR.............IENPNS
ENSMODP00000024670  ......--PFLLALHRISCNLSKK..ELEDMKF...FCKK........D.....IGKKK.............LNEVEQ
ENSMODP00000025242  ......----RCILVRYLEELTFE..ELKKFKL...FLED........S.....PPKEK.............FLRIP-
ENSMODP00000021315  ......------------------..------N...FSVD........E.....INQIR.............VENPNS
ENSMODP00000010574  ......------------------..-------...----........-.....-----.............------
ENSMODP00000011797  ......------------------..-------...----........-.....-----.............------
ENSMODP00000024041  ......------------------..-------...----........-.....-----.............---KSS
ENSMODP00000040167  ......ISPYRKLLFKIAENMTSD..YLDSAKF...LLRR........D.....LPQSK.............LEGIKT
ENSMODP00000001598  ......------------------..-------...L---........-.....-----.............------
ENSMODP00000000728  ......------------------..-------...----........-.....-----.............-----C
ENSMODP00000025564  gekgct------------------..-------...----........-.....-----.............------
ENSMODP00000013080  ......-------MVIISEHLGLSwaELARELQ...FGVE........D.....INRIR.............VENPNS
ENSMODP00000026840  ......------------------..-------...----........-.....-----.............------
ENSMODP00000040167  ......------ILLQIKDKLTRS..DLESLKF...LSSD........I.....IPLQK.............QENITR
ENSMODP00000010893  ......------------------..-------...----........-.....-----.............------
ENSMODP00000000705  ......------------------..-------...----........-.....-----.............---LTC
ENSMODP00000000353  ......------------------..-------...----........-.....-----.............------
ENSMODP00000018737  ......-------------GLSYP..EVQRIQY...AHRD........D.....LDGQV.............------
ENSMODP00000020549  ......------------ESLVAY..DLEKFKF...KLQTanldkdqvR.....IPHGR.............LQNATG
ENSMODP00000041337  ......------------------..-------...----........-.....-----.............------
ENSMODP00000034033  ......------------------..-------...----........-.....-----.............------
ENSMODP00000000694  ......------------------..-------...----........-.....----K.............LTRALN
ENSMODP00000000253  ......------------------..-------...----........-.....-----.............----IN
ENSMODP00000009538  ......-----------Y------..-------...----........-.....-----.............------
ENSMODP00000034022  ......------------------..-------...----........-.....-----.............------
ENSMODP00000015678  ......------------------..-------...----........-.....-----.............------
ENSMODP00000037460  ......-----------LEDLEND..DFKKFKL...KLRT........L.....KLREG.............F-----
ENSMODP00000022511  ......------------------..---AMLY...TVVD........Q.....VPPQR.............WKEFVR
ENSMODP00000011797  ......------------------..-------...----........-.....--R--.............------
ENSMODP00000013104  ......------------------..-------...----........-.....--GTK.............SYREHG
ENSMODP00000006219  ......------------------..-------...----........-.....-----.............----PS
ENSMODP00000031142  ......------------------..-------...--Y-........-.....-----.............------
ENSMODP00000018873  ......VSDYRVLMTQLSEDMDKS..EVTSFVF...LLRD........Y.....IGGGKp............YKNKKH
ENSMODP00000021908  ......------------------..-------...----........-.....-----.............------
ENSMODP00000021909  ......------------------..-------...----........-.....-----.............------
ENSMODP00000013743  ......------------------..-------...----........-.....-----.............---QSS
ENSMODP00000039551  ......------------------..-------...----........-.....-----.............------
ENSMODP00000016391  ......------------------..-------...----........-.....-----.............------
ENSMODP00000003605  ......------------------..-------...----........-.....-----.............--CEHG
ENSMODP00000037737  ......------------------..-------...----........-.....-----.............------
ENSMODP00000018969  ......ISPYRILLFNLSEGVGPS..ELKSIKF...MLSS........K.....IPKCK.............IEDDMT
ENSMODP00000019080  ......------------------..-------...----........-.....M----.............------
ENSMODP00000027815  ......------------------..-------...----........-.....-----.............------
ENSMODP00000025395  ......------------------..-------...----........-.....-----.............------
ENSMODP00000037460  ......------------------..-------...----........-.....-----.............------
ENSMODP00000025861  ......------------------..-------...----........-.....-----.............------
ENSMODP00000036251  ......ISSYRVMLYNLSEEITTE..DFEHIKF...IMKE........H.....IPKT-.............---LKT
ENSMODP00000009583  ......------------------..-------...----........-.....-----.............------
ENSMODP00000011508  ......------------------..-------...----........-.....--AKE.............SENVID
ENSMODP00000014557  ......-------FYQVMDSLESA..DWHKFAS...LIVQ........D.....QTELR.............------
ENSMODP00000014409  ......------------------..-------...----........-.....-----.............------
ENSMODP00000037465  ......------------NNLNDE..EFTRFKF...KLHE........M.....P----.............------
ENSMODP00000007741  ......--------------LREQ..DLENLAY...DY--........-.....-----.............--DRDG
ENSMODP00000030256  ......------------------..-------...----........-.....-----.............------
ENSMODP00000005003  ......------------------..-------...----........-.....-----.............------
ENSMODP00000007693  ......------------------..-------...----........-.....-----.............------
ENSMODP00000002694  ......------------------..-------...----........-.....-----.............------
ENSMODP00000025675  ......------LLYWLAEELSEE..NAASLAEslpLRRS........T.....IQLVK.............LKNPDN
ENSMODP00000039722  ......------------------..-------...----........-.....-----.............------
ENSMODP00000039043  ......------------EELQNE..DFKKFKF...FLSN........D.....CLMMR.............VHN-LD
ENSMODP00000004061  ......------------------..-------...----........-.....----H.............------
ENSMODP00000039722  ......------------------..-------...----........-.....-PSTS.............REDITN
ENSMODP00000040136  ......----------------SE..DITVCKF...RMLK........K.....WQEKE.............RNS-AT
ENSMODP00000018873  ......------VIHQVEEELDED..EKEVILF...LCRD........L.....APDLT.............T--KLD
ENSMODP00000015935  ......--PLHRVFQVVGAQLSEQ..ELAVLSF...LLEE........A.....LPAPQdsppglaprggpqPAPSRS
ENSMODP00000032734  ......------------TKLSPE..ELRRFGI...YLRN........VgeeprVSRHD.............LEMATK
ENSMODP00000003599  ......------------------..-------...----........-.....-----.............---MTD
ENSMODP00000034911  ......------------------..-------...----........-.....-----.............------
ENSMODP00000040512  ......------------------..-------...----........-.....-----.............------
ENSMODP00000031541  ......------------------..-------...----........-.....-----.............------
ENSMODP00000017926  ......------------------..-------...----........-.....-----.............-----R
ENSMODP00000005003  ......------------------..-------...----........-.....-----.............-----K


                                            50            60        70        80                    
                                             |             |         |         |                    
d1a1za_               .....GLD....L......FSMLLEQNDLEPGH....TELLRELLASLRRHDLLRRVDDFE.................
ENSMODP00000012034  .....GSA....W......FHFLETHNKLDKDN....LSYIEHIFEISRRPDLLTMVVDYRtrvlkiseedeldtklt
ENSMODP00000023115  .....VGD....L......VDLLIRNDFL----....------------------------aparlllpdiipeivqv
ENSMODP00000018969  .....ALV....L......FQTLEERGLLEEDN....LFFLKELLFRINRIDLLNE-----plntkgpemerelqvpn
ENSMODP00000036251  .....GHQ....L......FQKFMDEDLLNEGD....YFLVAELLFLIKHHNLLQKIGYT-kekvkkelsskrkissy
ENSMODP00000033729  meriqGVS....I......TRELLWWWGMRQAT....VQQLLDLLYRLELY----------raaqvildwg.......
ENSMODP00000011339  .....IGD....L......LQILQEM-------....------------------------gherainlivnhgrtis
ENSMODP00000031781  .....ARQ....L......VTDLQTRGK---RA....LPIFISCLEATGQWDLAALL----sesnttltqqpdpid..
ENSMODP00000006984  .....LQD....Q......SHALLKYWLERDGKhat.DNSLTECLTKINRMDIVHLME---tstmeplqertsrsyae
ENSMODP00000024670  .....AIQ....L......FSLLMQQNLLSANN....TAFLTSVLRSLKRDDLIQELA---kaagsqpgsgapldp..
ENSMODP00000025242  .....---....-......--------------....------------------------rsqmkkadntdmaelmv
ENSMODP00000021315  .....LIA....Q......SFMLLKKWVTRDGKnat.TDALTSVLTKINRIDIVTLLE---gpifdygnisgtrsfae
ENSMODP00000010574  .....---....-......VFQMLQKWLMREGNkgatVGKLAKALFQCQRIDLVNIL----i................
ENSMODP00000011797  .....---....-......LQYLYQEGILTENH....VQE---------------------iraqstglrktmmlldi
ENSMODP00000024041  .....PTG....V......ILDLWEAQNFPDGN....LSMLAAVLEEMGRHE---------tvvsl............
ENSMODP00000040167  .....PLK....L......FIEMEKHGLIEKTN....LKALKDILQSLNAECLLKHIKEYEkktkdlagsavtaqles
ENSMODP00000001598  .....---....-......--------------....------------------------emreliqakvgsfsqnv
ENSMODP00000000728  .....VLP....I......LDSLLTSGVINEQE....HDVIK-------------------qktqtslqarelidtil
ENSMODP00000025564  .....---....-......--------------....VTELSEFLQAMEHTDVL-------qllgppg..........
ENSMODP00000013080  .....LLE....Q......SSALLNLWVIREGKnak.MENLYTALRNIDRSEIVNMLE---g................
ENSMODP00000026840  .....---....-......----------H---....------------------------atpenlinalnksglsd
ENSMODP00000040167  .....SLA....F......FQALQKRELLD--N....NSILEELLFLIGRKDILTK-----qlnvnieelkrklqhsd
ENSMODP00000010893  .....---....-......ILDLWESLHQDDGD....LNTLASALEEM-------------gksemlv..........
ENSMODP00000000705  .....VLP....V......LNCLLTASVINEQE....YDVIKQ------------------ktqislqvrelidtiiv
ENSMODP00000000353  .....---....-......----RARKILTRED....------------------------teeiscrtsskkragkl
ENSMODP00000018737  .....-RN....M......LFSWAERQIGHPGS....IQQLLEALEQSDRRDVAEEVQ---ailelgrskyre.....
ENSMODP00000020549  .....PVK....L......--------------....------------------------adllinyygeryavklt
ENSMODP00000041337  .....---....-......----EKMEELRDEN....VTMMDKALALI-------------eyviwkgpeacqlliks
ENSMODP00000034033  .....---....-......-------QVLNLEE....MEILK-------------------eesrtirdkarvlidai
ENSMODP00000000694  .....PAK....L......TPYLRQCRVIDEQD....EE----------------------evlstygfpcrvnrtgr
ENSMODP00000000253  .....PAK....L......TPYLRQCKVIDEQD....ED----------------------evlsapmlpskinrsgr
ENSMODP00000009538  .....---....-......--------------....------------------------nallhegykdlafllqk
ENSMODP00000034022  .....---....-......---L----------....------------------------eemeivreesktnrdka
ENSMODP00000015678  .....---....-......--------------....--LALRVFNRINRKDLW-------ergcqe...........
ENSMODP00000037460  .....---....-......--------------....NAIPRGILENLDRVDLTDKI----vccyledyglvltaevl
ENSMODP00000022511  .....RLG....LspnaieFLEMQNSRCLREAH....YSMLEAWQKG--------------vprhqatletlalvlqe
ENSMODP00000011797  .....---....-......--------------....------------------------ckvnhpynvqsqiveaf
ENSMODP00000013104  .....HRM....L......LIWLHGVIMAAENP....NKGLYEGLVGIGRRDLAESIRK--kanadsnss........
ENSMODP00000006219  .....PTA....M......ILNLWEARHFPHGN....LSQLAAA-----------------vadlgkqdtal......
ENSMODP00000031142  .....---....-......--------------....------------------------emlkrwrqqqpagldav
ENSMODP00000018873  .....FLD....V......VIELEKVNLISPDK....LDLLEKCLKNIHRIDLKKKIQKYK.................
ENSMODP00000021908  .....---....-......---------IRKRK....VGVLLDILQRTG------------hkgyvafleslelyypq
ENSMODP00000021909  .....---....-......---------IRKRK....VGVLLDILQRTG------------hkgyvafleslelyypq
ENSMODP00000013743  .....PSA....V......ILNLWEARHQHDGD....LDSLACALEEIGR-----------t................
ENSMODP00000039551  .....---....-......--------AQDSAT....LDALYAALRRIQRGDIVEN-----ly...............
ENSMODP00000016391  .....---....-......--MLLEPSSITGND....WRRLASHLGL--------------cgmkirflscqrspaaa
ENSMODP00000003605  .....HRM....L......LIWLHGILMRRENP....ERRLYEDLVKAGFPELAEKIRQ--lqss.............
ENSMODP00000037737  .....---....-......HALLQEWCHYPEST....VGVLMSKLRELGRRD---------aadfl............
ENSMODP00000018969  .....LMD....L......FIEMEKRGILGEGN....LDALKIVCDQID-KSLLKKIQEYE.................
ENSMODP00000019080  .....---....-......--------------....------------------------andyfsmedaeivgacp
ENSMODP00000027815  .....---....-......--------------....LERLEASLRAIGREDVA-------rals.............
ENSMODP00000025395  .....--S....V......LDTLISRNLISEEE....YEILD-------------------tvtdplkksrkmlilvq
ENSMODP00000037460  .....---....L......--------------....------------------------lgfmvawdksckdqlle
ENSMODP00000025861  .....---....-......--T-----------....------------------------lmdnyevsggtirelvd
ENSMODP00000036251  .....FLS....L......LRHMEKQNLLSENN....LEILVNICKPLS-INLIKRIEQYK.................
ENSMODP00000009583  .....---....-......----------M---....------------------------kedyelistkptrtskv
ENSMODP00000011508  .....YPH....R......MLTMWQQKVGKAAT....VDILLETLSKIKL-----------kaaresiqeelihekly
ENSMODP00000014557  .....---....-......--------------....------------------------lgerfhdrtarimwswi
ENSMODP00000014409  .....---....-......---------WSKDY....KDHLYRVLREIH-PH---------lmnele...........
ENSMODP00000037465  .....---....-......--------------....------------------------vrisfvylprktvqslt
ENSMODP00000007741  .....LFE....Q......AFQLLHHFVQAEGR....RATLQRLIEALDRSSLTS------vaedllg..........
ENSMODP00000030256  .....---....-......------------AS....LAQLISALRQHRRNDVVEKI----r................
ENSMODP00000005003  .....-QE....Q......TFQLLKLWKHQNKD....QGMVK-------------------kiiqdidlcensvvkhi
ENSMODP00000007693  .....---....-......-N------------....------------------------eyesldamddpermvrk
ENSMODP00000002694  .....---....-......--------V-----....------------------------lhspkftnnamrvgyll
ENSMODP00000025675  .....LTEqiyeF......LSFWKKSLPTSVDK....QRLLSRHLRKIGRRDLSEE-----lr...............
ENSMODP00000039722  .....---....-......-----QLERLEEDN....PSTVMRIFNMFQ------------lwrnqerknatvtrlyq
ENSMODP00000039043  .....RID....L......ATCMKKQLPCP---....-SFMNKFIEILKKMNLN-------etakkykeq........
ENSMODP00000004061  .....---....-......--------------....------------------------lekvnrildilisqgeh
ENSMODP00000039722  .....---....-......--QLL--KYYGSEA....RNVVAQILYRVPALHLLEKL----ge...............
ENSMODP00000040136  .....AKN....L......YNCLESD-------....------------------------asievhemlkgfl....
ENSMODP00000018873  .....LRD....L......LCTLNDKGKLS---....PAGLAELLYRVRRFDLLKRIMK--t................
ENSMODP00000015935  .....GLE....L......LLELERRGQCDEAR....LGPLKQLLRVLSRQDLLPKL----.................
ENSMODP00000032734  .....PEE....L......ADLLLKRYVMT-GT....PRVLVQVLGQVPRKDLA-------lewe.............
ENSMODP00000003599  .....GMQ....L......FDRISTAG------....------------------------ysipelltklvqierld
ENSMODP00000034911  .....---....-......----------SHKT....VDQLIELCRLYHRVDVEKVLR---rwveeewpk........
ENSMODP00000040512  .....---....-......-DDLIEQDVFNQNE....IKNMGKQLSTVK------------dksedlvkivthkgsqi
ENSMODP00000031541  .....---....-......--------------....LGQLAEHLGQLGRGD---------algvlyk..........
ENSMODP00000017926  .....LSD....L......LTHLQRKG------....------------------------erdcqefyralyinaqh
ENSMODP00000005003  .....STD....Q......VLKLLNLWRIKNGD....QDTLKGLA----------------hglkhlktyhfpkvvlq


                                                                            
                                                                            
d1a1za_               ......................................................
ENSMODP00000012034  ripsakkykdiirqpseeeiiklap.............................
ENSMODP00000023115  lpq...................................................
ENSMODP00000018969  karispyrillfnlseg.....................................
ENSMODP00000036251  rvmlynlseeittedfehikf.................................
ENSMODP00000033729  ......................................................
ENSMODP00000011339  as....................................................
ENSMODP00000031781  ......................................................
ENSMODP00000006984  ieqtialdhse...........................................
ENSMODP00000024670  ......................................................
ENSMODP00000025242  hhygegeawdvalmiwekmglrelweqakreap.....................
ENSMODP00000021315  ennvf.................................................
ENSMODP00000010574  ......................................................
ENSMODP00000011797  lptrgpkafdtfldslqefpwvrekl............................
ENSMODP00000024041  ......................................................
ENSMODP00000040167  hlghlsllsgnagqaaaplnipeesemntlpqsmppykmehvphgyvviidnih
ENSMODP00000001598  eflnllpkrgphafeafcdalretkqghledllhrtl.................
ENSMODP00000000728  vkgnaaasvfknclreigsvlynnlfveknmkyipte.................
ENSMODP00000025564  ......................................................
ENSMODP00000013080  ......................................................
ENSMODP00000026840  laesltn...............................................
ENSMODP00000040167  slkispyrkllfkiaenmtsd.................................
ENSMODP00000010893  ......................................................
ENSMODP00000000705  kgniaanifkkclrdfdpvlyenlfveknmkyipte..................
ENSMODP00000000353  ldylqenpkgldtlvesirrektqsfliekitdevqk.................
ENSMODP00000018737  ......................................................
ENSMODP00000020549  lqvlqainqnllveelsqa...................................
ENSMODP00000041337  iwhrdphlarkmn.........................................
ENSMODP00000034033  iskgpkasqcftksiwerdghlaeklgl..........................
ENSMODP00000000694  lmdilrcrgrrgyeafleslefyypehftlltgrepaqrcsm............
ENSMODP00000000253  lldilhtkgergyvvfleslefyypelyklvtgkeptrrfst............
ENSMODP00000009538  glp...................................................
ENSMODP00000034022  rvlidaviskgpkasqcftksicerdghlaeklgl...................
ENSMODP00000015678  ......................................................
ENSMODP00000037460  qeigmreeavklle........................................
ENSMODP00000022511  mklcgclqnirealeqd.....................................
ENSMODP00000011797  vqwrqkngsqatiqslqkglvamdvdpsv.........................
ENSMODP00000013104  ......................................................
ENSMODP00000006219  ......................................................
ENSMODP00000031142  yaalermglegcaedlrsrlq.................................
ENSMODP00000018873  ......................................................
ENSMODP00000021908  lykkitgkeptrvfsm......................................
ENSMODP00000021909  lykkitgkeptrvfsm......................................
ENSMODP00000013743  ......................................................
ENSMODP00000039551  ......................................................
ENSMODP00000016391  vlelfeeqngslqelhylmtsmerldcasai.......................
ENSMODP00000003605  ......................................................
ENSMODP00000037737  ......................................................
ENSMODP00000018969  ......................................................
ENSMODP00000019080  tppdkvrkmldlvqskgeevceyllhvlqqi.......................
ENSMODP00000027815  ......................................................
ENSMODP00000025395  kkgerscqqfleclhsafpes.................................
ENSMODP00000037460  alrdlhpylvqele........................................
ENSMODP00000025861  alrqmgyteaieviqk......................................
ENSMODP00000036251  ......................................................
ENSMODP00000009583  rqmldtsdiqgeefakiivqklkdnkqlglqpy.....................
ENSMODP00000011508  vykes.................................................
ENSMODP00000014557  nrnarvadllhiltslqlrdp.................................
ENSMODP00000014409  ......................................................
ENSMODP00000037465  rlnvanwmvsslpenggvklttimlqgigkqeeavrlen...............
ENSMODP00000007741  ......................................................
ENSMODP00000030256  ......................................................
ENSMODP00000005003  gf....................................................
ENSMODP00000007693  illivqqkgefacqellkcaseihpndsr.........................
ENSMODP00000002694  dvlktrgktgaialvekkfhnpdiytlvtgleps....................
ENSMODP00000025675  ......................................................
ENSMODP00000039722  lls...................................................
ENSMODP00000039043  ......................................................
ENSMODP00000004061  acqvffypclkqlepnlyqiirk...............................
ENSMODP00000039722  ......................................................
ENSMODP00000040136  ......................................................
ENSMODP00000018873  ......................................................
ENSMODP00000015935  ......................................................
ENSMODP00000032734  ......................................................
ENSMODP00000003599  aveslc................................................
ENSMODP00000034911  ......................................................
ENSMODP00000040512  gdifvkrv..............................................
ENSMODP00000031541  ......................................................
ENSMODP00000017926  lygsl.................................................
ENSMODP00000005003  slrktv................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045697 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Eubacterium eligens ATCC 27750
NoYes   Nitrosococcus halophilus Nc4
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]