SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Chondroitin AC/alginate lyase alignments

These alignments are sequences aligned to the 0046100 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1cb8a1 gta.........................................................................................
d1egua1 kdtytdrlddwngiiagnqyydsk....................................................................
d1hn0a1 epeiqfhnvkpqlpvtpenlaaidlirqrlinefvggeketnlaleenisklksdfdalnihtlanggtqgrhlitdkqiiiyqpenlnsqd
d1j0ma1 s...........................................................................................
d1qaza_ gshpfdqavvkdptasyvdvkarrtflqsgqlddrlkaalpkeydctteatpnpqqgemviprrylsgnhgpvnpdyepvvtlyrdfekisa
d1rwha1 pgaa........................................................................................


                                                                                                    
                                                                                                    
d1cb8a1 ............................................................................................
d1egua1 ............................................................................................
d1hn0a1 kqlfdnyvilgnyttlmfnisrayvlekdptqkaqlkqmyllmtkhlldqgfvkgsalvtthhwgyssrwwyistllmsdalkeanlqtqvy
d1j0ma1 ............................................................................................
d1qaza_ tlgnlyvatgkpvyatcllnmldkwakada..............................................................
d1rwha1 ............................................................................................


                                                                10                     20        30 
                                                                 |                      |         | 
d1cb8a1 ................................................---ELIMKRVMLDLKK.............PLRNMDKVAEKNLNT
d1egua1 ................................................----------NDQMAK.............LNQELEGKVADSLSS
d1hn0a1 dsllwysrefkssfdmkvsadssdldyfntlsrqhlallllepddqkr----------------.............---------------
d1j0ma1 ................................................DEFDALRIKWATLLTGgpaldpadsdiaaR----------TDKL
d1qaza_ ................................................----------------.............---------------
d1rwha1 ................................................-EFAALRNRWVDQITGrnviqagdpdfakAITALNNKAADSLAK


                   40                  50        60        70        80        90             100   
                    |                   |         |         |         |         |               |   
d1cb8a1 LQP....DGSWKDVPYK..........DDAMTNWLPNNHLLQLETIIQAYIEKDSHYYGDDKVFDQISKAFKYWYDSDPKS......RNWWH
d1egua1 ISSqa..DRIYLWEKFS..........NYKTSA-NLTATYRKLEEMAKQVTNPSSRYYQDETVVRTVRDSMEWMHKHVYNSeksiv.GNWWD
d1hn0a1 ---....----------..........------------------------------------------------------......-----
d1j0ma1 AQDa...NDYWEDMDLSssrtyiwyalRGNGTSDNVNAVYERLRTMALAATTVGSSLYGNADLKEDILDALDWLYVNSYNStrsrsaYNWWH
d1qaza_ ---....----------..........----------------------------------------------LLNYDPKS......QSWYQ
d1rwha1 LDAaagrTSVFTDLS--..........-LAKDA-EMVTTYTRLSQLATAWATPTAAVFGDAAVLAAIKAGLADANTLCYNDrkeev.GNWWS


            110       120        130       140                    150       160       170       180 
              |         |          |         |                      |         |         |         | 
d1cb8a1 NEIATPQALGEMLILMRY.GKKPLDEALVHKLTERMKRGEP.EKK............TGANKTDIALHYFYRALLTSDEALLSFAVKELFY.
d1egua1 YEIGTPRAINNTLSLMKE.YFSDEEIK---KYTDVIEKFVP.DPEhfrkttdnpfkaLGGNLVDMGRVKVIAGLLRKDDQEISSTIRSIEQ.
d1hn0a1 ------------------.----------------------.---............---------------------INLVNTFSHYITG.
d1j0ma1 WQLGIPMSLNDTAVLLYD.DISAARMA---TYMDTIDYFTPsIGL............TGANRAWQAIVVGVRAVIVKDAVKLAAARNGLSGt
d1qaza_ VEWSAATAAFALSTMMAEpNVDTAQRERVVKWLNRVARHQT.-SFpggdtsc.....CNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQ.
d1rwha1 WEIGVPRALADAMVLLHA.ELSAAERT---AYCAAIDHFVP.DPWlqfppkrgkitsVGANRVDLCQGIIIRSLAGEDPTKLNHAVAGLSQ.


                  190           200       210       220       230       240       250       260     
                    |             |         |         |         |         |         |         |     
d1cb8a1 .PVQFVHYE..EGLQYDYSYLQ....HGPQLQISSYGAVFITGVLKLANYVRDTPYALSTEKLAIFSKYYRDSYLKAIRGSYMDFNVEGRGV
d1egua1 .VFKLVDQG..EGFYQDGSYID....HTNVAYTGAYGNVLIDGLSQLLPVIQKTKNPIDKDKMQTMYHWIDKSFAPLLVNGELMDMSRGRSI
d1hn0a1 .ALTQVPPGgkDGLRPDGTAWR....HEGN--YPGYSFPAFKNASQLIYLLRDTPFSVGESGWNNLKKAMV--SAWIYSNPEVGLPLAGR--
d1j0ma1 gIFPYATGG..DGFYADGSFVQ....HTTFAYTGGYGSSVLETTANLMYLLSGSTWSVSDPNQSNVWQWIYEAYRPLLYKGAMMDMVRGREI
d1qaza_ .AMGL----..--INEDGSFVHemtrHEQSLHYQNY--------------------------------------------------------
d1rwha1 .VWQYVTSG..DGIFRDGSFIQ....HSTTPYTGSYGVVLLTGLSKLFSLLGGTAFEVSDPTRSIFFDAVEGSFAPVMINGAMADAVRGRSI


          270       280       290       300       310                                               
            |         |         |         |         |                                               
d1cb8a1 SRPDILNKKAEKKRLLVAKMIDLKHTEEWADAIARTDSTVAAG--yk.............................................
d1egua1 SRANSEGHVAAVEVLRGIHRIADMSEGETKQRLQSLVKTIVQSD-syydvfknlktykdislmqsllsdagvasvpr...............
d1hn0a1 ---------------------------------------------hpfnspslksvaqgyywlamsaksspdktlasiylaisdktqnesta
d1j0ma1 SRSYAQDHAVGHGIVASIVRLAQFAPAPHAAAFKQIAKRVIQED-tfssfygdvstdtirlakaivddpsiapaaa................
d1qaza_ ---------------------------------------------amlpltmiaetasrqgidlyaykengrdihsarkfvfaavknpdlik
d1rwha1 SREANTGYDLGASAIEAILLLARAMDPATAARWRGLCAGWIARD-tyrpilnsasvprtalvkqleatgvapvae.................


                                                                  
                                                                  
d1cb8a1 ..........................................................
d1egua1 ..........................................................
d1hn0a1 ifgetitpasl...............................................
d1j0ma1 ..........................................................
d1qaza_ kyasepqdtrafkpgrgdlnwieyqrarfgfadelgfmtvpifdprtggsatllaykp
d1rwha1 ..........................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046100 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Podospora anserina
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Botrytis cinerea B05.10
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Micromonas sp. RCC299
NoYes   Porphyridium purpureum 02_2012
NoYes   Giardia lamblia 2.3
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora capsici
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Acaryochloris marina MBIC11017
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma fermentans M64
NoYes   Eggerthella sp. YY7918
NoYes   Thermobispora bispora DSM 43833
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium acnes SK137
NoYes   Rhodococcus opacus B4
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Anaerolinea thermophila UNI-1
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Roseburia hominis A2-183
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium novyi NT
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecalis 62
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus suis P1/7
NoYes   Exiguobacterium sp. AT1b
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Rhodothermus marinus DSM 4252
NoYes   Cyclobacterium marinum DSM 745
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Prevotella ruminicola 23
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Treponema brennaborense DSM 12168
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Candidatus Nitrospira defluvii
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Bacteriovorax marinus SJ
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Geobacter metallireducens GS-15
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Thauera sp. MZ1T
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella avium 197N
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Alteromonas sp. SN2
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas sp. MWYL1
NoYes   Methylomonas methanica MC09
NoYes   Frateuria aurantia DSM 6220
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Allochromatium vinosum DSM 180
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Cronobacter turicensis z3032
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Francisella sp. TX077308
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Caldivirga maquilingensis IC-167
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella paludicola SANAE
NoYes   Ferroglobus placidus DSM 10642
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Aspergillus fumigatus A1163
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Mycoplasma fermentans JER
NoYes   Mycoplasma fermentans PG18
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. CcI3
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Mycobacterium gilvum Spyr1
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Clostridium perfringens SM101
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum BKT015925
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus LOCK900
NoYes   Lactobacillus rhamnosus ATCC 8530
NoYes   Streptococcus constellatus subsp. pharyngis C1050
NoYes   Streptococcus constellatus subsp. pharyngis C818
NoYes   Streptococcus constellatus subsp. pharyngis C232
NoYes   Streptococcus intermedius B196
NoYes   Streptococcus intermedius C270
NoYes   Streptococcus anginosus C238
NoYes   Streptococcus equi subsp. zooepidemicus MGCS10565
NoYes   Streptococcus equi subsp. zooepidemicus
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus pyogenes HSC5
NoYes   Streptococcus pyogenes A20
NoYes   Streptococcus pyogenes MGAS1882
NoYes   Streptococcus pyogenes MGAS15252
NoYes   Streptococcus pyogenes Alab49
NoYes   Streptococcus pyogenes MGAS10750
NoYes   Streptococcus pyogenes MGAS10270
NoYes   Streptococcus pyogenes MGAS2096
NoYes   Streptococcus pyogenes MGAS9429
NoYes   Streptococcus pyogenes MGAS6180
NoYes   Streptococcus pyogenes NZ131
NoYes   Streptococcus pyogenes MGAS8232
NoYes   Streptococcus pyogenes MGAS10394
NoYes   Streptococcus pyogenes MGAS315
NoYes   Streptococcus pyogenes SSI-1
NoYes   Streptococcus pyogenes M1 476
NoYes   Streptococcus pyogenes MGAS5005
NoYes   Streptococcus pyogenes M1 GAS
NoYes   Streptococcus pneumoniae A026
NoYes   Streptococcus pneumoniae ST556
NoYes   Streptococcus pneumoniae SPNA45
NoYes   Streptococcus pneumoniae SPN994039
NoYes   Streptococcus pneumoniae SPN994038
NoYes   Streptococcus pneumoniae SPN034183
NoYes   Streptococcus pneumoniae SPN034156
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae OXC141
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669
NoYes   Streptococcus pneumoniae TCH8431/19A
NoYes   Streptococcus pneumoniae CGSP14
NoYes   Streptococcus pneumoniae G54
NoYes   Streptococcus pneumoniae JJA
NoYes   Streptococcus pneumoniae 70585
NoYes   Streptococcus pneumoniae Hungary19A-6
NoYes   Streptococcus pneumoniae Taiwan19F-14
NoYes   Streptococcus pneumoniae D39
NoYes   Streptococcus pneumoniae 670-6B
NoYes   Streptococcus pneumoniae R6
NoYes   Streptococcus pneumoniae TIGR4
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae SA20-06
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis SC070731
NoYes   Streptococcus suis S735
NoYes   Streptococcus suis ST3
NoYes   Streptococcus suis D9
NoYes   Streptococcus suis SS12
NoYes   Streptococcus suis ST1
NoYes   Streptococcus suis A7
NoYes   Streptococcus suis JS14
NoYes   Streptococcus suis BM407
NoYes   Streptococcus suis SC84
NoYes   Streptococcus suis GZ1
NoYes   Streptococcus suis 98HAH33
NoYes   Streptococcus suis 05ZYH33
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus E33L
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Staphylococcus aureus subsp. aureus MSHR1132
NoYes   Staphylococcus aureus CA-347
NoYes   Staphylococcus aureus Bmb9393
NoYes   Staphylococcus aureus M1
NoYes   Staphylococcus aureus 08BA02176
NoYes   Staphylococcus aureus ST228/18412
NoYes   Staphylococcus aureus ST228/18341
NoYes   Staphylococcus aureus ST228/16125
NoYes   Staphylococcus aureus ST228/16035
NoYes   Staphylococcus aureus ST228/15532
NoYes   Staphylococcus aureus ST228/10497
NoYes   Staphylococcus aureus ST228/10388
NoYes   Staphylococcus aureus 04-02981
NoYes   Staphylococcus aureus RF122
NoYes   Staphylococcus aureus subsp. aureus Z172
NoYes   Staphylococcus aureus subsp. aureus 6850
NoYes   Staphylococcus aureus subsp. aureus SA957
NoYes   Staphylococcus aureus subsp. aureus CN1
NoYes   Staphylococcus aureus subsp. aureus SA40
NoYes   Staphylococcus aureus subsp. aureus 11819-97
NoYes   Staphylococcus aureus subsp. aureus M013
NoYes   Staphylococcus aureus subsp. aureus HO 5096 0412
NoYes   Staphylococcus aureus subsp. aureus VC40
NoYes   Staphylococcus aureus subsp. aureus T0131
NoYes   Staphylococcus aureus subsp. aureus LGA251
NoYes   Staphylococcus aureus subsp. aureus ECT-R 2
NoYes   Staphylococcus aureus subsp. aureus JKD6159
NoYes   Staphylococcus aureus subsp. aureus ED133
NoYes   Staphylococcus aureus subsp. aureus ED98
NoYes   Staphylococcus aureus subsp. aureus TW20
NoYes   Staphylococcus aureus subsp. aureus 55/2053
NoYes   Staphylococcus aureus subsp. aureus TCH60
NoYes   Staphylococcus aureus subsp. aureus str. JKD6008
NoYes   Staphylococcus aureus subsp. aureus 71193
NoYes   Staphylococcus aureus subsp. aureus S0385
NoYes   Staphylococcus aureus subsp. aureus str. Newman
NoYes   Staphylococcus aureus subsp. aureus Mu3
NoYes   Staphylococcus aureus subsp. aureus USA300_TCH1516
NoYes   Staphylococcus aureus subsp. aureus USA300_FPR3757
NoYes   Staphylococcus aureus subsp. aureus JH9
NoYes   Staphylococcus aureus subsp. aureus MSSA476
NoYes   Staphylococcus aureus subsp. aureus MRSA252
NoYes   Staphylococcus aureus subsp. aureus MW2
NoYes   Staphylococcus aureus subsp. aureus N315
NoYes   Staphylococcus aureus subsp. aureus Mu50
NoYes   Staphylococcus aureus subsp. aureus COL
NoYes   Staphylococcus aureus subsp. aureus NCTC 8325
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella dentalis DSM 3688
NoYes   Alistipes shahii WAL 8301
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Helicobacter pylori BM012S
NoYes   Helicobacter pylori BM012A
NoYes   Helicobacter pylori SouthAfrica20
NoYes   Helicobacter pylori UM298
NoYes   Helicobacter pylori UM066
NoYes   Helicobacter pylori UM037
NoYes   Helicobacter pylori UM299
NoYes   Helicobacter pylori UM032
NoYes   Helicobacter pylori OK310
NoYes   Helicobacter pylori OK113
NoYes   Helicobacter pylori Rif2
NoYes   Helicobacter pylori Rif1
NoYes   Helicobacter pylori HUP-B14
NoYes   Helicobacter pylori PeCan18
NoYes   Helicobacter pylori Shi169
NoYes   Helicobacter pylori Shi112
NoYes   Helicobacter pylori Shi417
NoYes   Helicobacter pylori XZ274
NoYes   Helicobacter pylori Aklavik117
NoYes   Helicobacter pylori SNT49
NoYes   Helicobacter pylori Puno135
NoYes   Helicobacter pylori Puno120
NoYes   Helicobacter pylori ELS37
NoYes   Helicobacter pylori Gambia94/24
NoYes   Helicobacter pylori SouthAfrica7
NoYes   Helicobacter pylori India7
NoYes   Helicobacter pylori Lithuania75
NoYes   Helicobacter pylori 2017
NoYes   Helicobacter pylori 2018
NoYes   Helicobacter pylori F57
NoYes   Helicobacter pylori F30
NoYes   Helicobacter pylori F16
NoYes   Helicobacter pylori Sat464
NoYes   Helicobacter pylori Cuz20
NoYes   Helicobacter pylori PeCan4
NoYes   Helicobacter pylori SJM180
NoYes   Helicobacter pylori B8
NoYes   Helicobacter pylori 52
NoYes   Helicobacter pylori v225d
NoYes   Helicobacter pylori 83
NoYes   Helicobacter pylori 35A
NoYes   Helicobacter pylori P12
NoYes   Helicobacter pylori G27
NoYes   Helicobacter pylori Shi470
NoYes   Helicobacter pylori HPAG1
NoYes   Helicobacter pylori 51
NoYes   Helicobacter pylori F32
NoYes   Helicobacter pylori J99
NoYes   Helicobacter pylori 26695
NoYes   Helicobacter pylori 26695
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sp. M18
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Nitrosomonas sp. AL212
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Candidatus Pelagibacter ubique HTCC1062
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Thioflavicoccus mobilis 8321
NoYes   Proteus mirabilis BB2000
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Enterobacter cloacae SCF1
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter junii SH205
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Moniliophthora perniciosa FA553
NoYes   Ricinus communis - Castor bean
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot Spring microbial communities from Yellowstone Obsidian Hot Spring, Sample 10594 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Nymph Lake Bulk Water (meta-genome)
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]