SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Ras GEF alignments in Gasterosteus aculeatus 76_1

These alignments are sequences aligned to the 0041591 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                     10        20                                   30          40  
                                      |         |                                    |           |  
d1nvus_               ......q-MRLPSADVYRFAEPDSEEN.............IIF.........EENMQ.....PKAG..IPIIKAGTVI
ENSGACP00000015613  ......l--RLPSPEVYRFAVQDSEEN.............IVF.........EDKVQ.....SKTG..IPIIKAGTVV
ENSGACP00000015610  ......l--RLPSPEVYRFAVQDSEEN.............IVF.........EDKVQ.....SKTG..IPIIKAGTVV
ENSGACP00000021731  ddvdirf--------------------.............---.........-SKMM.....NSCK..VLQIRYASVE
ENSGACP00000014370  ddvdirf--------------------.............---.........-SKMM.....NSCK..VLQIRYASVE
ENSGACP00000026446  .......--------------------.............---.........-----.....----..----------
ENSGACP00000007871  .vdicfs--------------------.............---.........--KTL.....NSCK..VPQIRYASVE
ENSGACP00000020323  ......l--RDVEANTVRLKEHEQAVL.............VLE.........KSPRA.....STLGsiKYTVISGTPE
ENSGACP00000023488  ..gnnnn-------------------N.............HPA.........PHSYG.....EMCYh.DNSLVSASLE
ENSGACP00000021958  ......l--NQVEKNMQKVEEEGEIVM.............VKEhr.......ELDRT.....GTRK..GHIVIKGTSE
ENSGACP00000021956  ......l--NQVEKNMQKVEEEGEIVM.............VKEhr.......ELDRT.....GTRK..GHIVIKGTSE
ENSGACP00000021953  ......l--NQVEKNMQKVEEEGEIVM.............VKEhr.......ELDRT.....GTRK..GHIVIKGTSE
ENSGACP00000008098  ......c--------------------.............---.........-----.....--DK..RYVVVSGTPL
ENSGACP00000025307  sfvqyha--------------------.............---.........-----.....--VK..VRRLKAGTLE
ENSGACP00000006371  ......l--RDVEANTVRLKEHGQDVL.............VLEkslgssrasTHGAS.....SSHY..KYKVISGTPE
ENSGACP00000025304  sfvqyha--------------------.............---.........-----.....--VK..VRRLKAGTLE
ENSGACP00000021147  .edvdel------------SLIDHKEI.............MSR.........ITLKQ.....ENDD..GPDVRAGSGD
ENSGACP00000014548  ......l--KDVEANTVRLEEHGKTVL.............VLE.........KRTEWaqqggAGNS..KYTVMSGTPE
ENSGACP00000017351  ...asvs--------------------.............---.........-----.....---R..SQCVKAGTEE
ENSGACP00000008461  ....afv--------------------.............---.........---QY.....RTCK..VRRLKAATLE
ENSGACP00000026457  ......q--------------------.............---.........-----.....----..-----SATVD
ENSGACP00000002975  .......--------------------.............---.........-----.....----..----KAASLD
ENSGACP00000017143  .pssaps--------------------.............---.........-----.....----..---ASAASLD
ENSGACP00000002977  .......--------------------.............---.........-----.....----..----KAASLD
ENSGACP00000014230  ..kpqge--------------------.............---.........-----.....---D..GPDVKAASAE
ENSGACP00000001453  ....cep--------------------.............---.........-----.....----..----------
ENSGACP00000000474  ..icfsk--------------------.............---.........---TL.....NSCK..VPQIRYASVE
ENSGACP00000017355  ...pasv--------------------.............---.........-----.....--SR..SQCVKAGTEE
ENSGACP00000019246  ...kksf--------------------.............---.........-----.....----..----------
ENSGACP00000024190  ..faksy--------------------.............---.........-----.....----..----------
ENSGACP00000000065  ....sgl--------------------.............---.........-----.....-YYH..DNNLASGSLE
ENSGACP00000009014  ......f--------------------.............---.........-----.....----..----------
ENSGACP00000027607  ......l--NHVEKNTHKVEEEGEIVM.............VKEhr.......ELDRS.....GTRK..GHIVIKGTPE
ENSGACP00000007942  ...qfgs--------------------.............---.........-----.....----..----------
ENSGACP00000022976  .ryascl--------------------.............---.........-----.....----..----------
ENSGACP00000021883  .....rp--------------------.............---.........-----.....----..----------
ENSGACP00000021889  .....rp--------------------.............---.........-----.....----..----------
ENSGACP00000019373  ...ryrs--------------------.............---.........-----.....----..----------

                                 50                     60        70          80                    
                                  |                      |         |           |                    
d1nvus_               KLIERLT.....YH..MYAD...........PNFVRTFLTTYRSFC.KPQELLS.LIIERFEIP..............
ENSGACP00000026446  -------.....--..-YAD...........PNFVRTFLTTYRSFC.KPQDLLN.LLMERFEIP..............
ENSGACP00000001453  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000019246  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000024190  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000009014  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000007942  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000022976  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000021883  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000021889  -------.....--..----...........---------------.-------.---------..............
ENSGACP00000019373  -------.....--..----...........---------------.-------.---------..............

d1nvus_               ..............................................................................
ENSGACP00000015613  ..............................................................................
ENSGACP00000015610  ..............................................................................
ENSGACP00000026443  ..............................................................................
ENSGACP00000021731  ssqnnkllygepptsprvsrkfssppplsitkssspnrrrklslnipiitggkaldlaalscspngytsvhstispfs
ENSGACP00000014370  ffassqnskllygeppssprasrkfssppplaitknsspnrrrklslnipiitggkaldlaalscssngyasmystms
ENSGACP00000026446  ..............................................................................
ENSGACP00000019508  ..............................................................................
ENSGACP00000016331  ..............................................................................
ENSGACP00000007871  ihihregkvacvcqsashpspllsrsaitakvrradltsplsnssvtihfpvaassptlptppnsslpphlsptqqlk
ENSGACP00000000064  ..............................................................................
ENSGACP00000023889  ..............................................................................
ENSGACP00000023888  ..............................................................................
ENSGACP00000020323  ..............................................................................
ENSGACP00000023488  ..............................................................................
ENSGACP00000021958  ..............................................................................
ENSGACP00000021956  ..............................................................................
ENSGACP00000021953  ..............................................................................
ENSGACP00000008098  ..............................................................................
ENSGACP00000010631  ..............................................................................
ENSGACP00000025307  ..............................................................................
ENSGACP00000006371  ..............................................................................
ENSGACP00000025304  ..............................................................................
ENSGACP00000021147  ..............................................................................
ENSGACP00000014548  ..............................................................................
ENSGACP00000017351  ..............................................................................
ENSGACP00000007783  ..............................................................................
ENSGACP00000008461  ..............................................................................
ENSGACP00000026457  ..............................................................................
ENSGACP00000002975  ..............................................................................
ENSGACP00000017143  ..............................................................................
ENSGACP00000002977  ..............................................................................
ENSGACP00000014230  ..............................................................................
ENSGACP00000001453  ..............................................................................
ENSGACP00000000474  mscrgdvhslhlcisacssvrpffirhpassssssrchcprieqlscdrlsimslcpdyslkitqlaldqskspgrqd
ENSGACP00000017355  ..............................................................................
ENSGACP00000019246  ..............................................................................
ENSGACP00000024190  ..............................................................................
ENSGACP00000000065  ..............................................................................
ENSGACP00000009014  ..............................................................................
ENSGACP00000027607  ..............................................................................
ENSGACP00000007942  ..............................................................................
ENSGACP00000022976  ..............................................................................
ENSGACP00000021883  ..............................................................................
ENSGACP00000021889  ..............................................................................
ENSGACP00000019373  ..............................................................................

d1nvus_               ..............................................................................
ENSGACP00000015613  ..............................................................................
ENSGACP00000015610  ..............................................................................
ENSGACP00000026443  ..............................................................................
ENSGACP00000021731  kttldinklyvagnvagkipdegetkaegkaeesvpnkqeasvreecdqeprqseeaeaemsppkspstpknvkskns
ENSGACP00000014370  pfskttldinklyvsssisskitdegedkkdkvedpsvtkqdadlsvreetdndpnqsdegdqeasptkspttpknik
ENSGACP00000026446  ..............................................................................
ENSGACP00000019508  ..............................................................................
ENSGACP00000016331  ..............................................................................
ENSGACP00000007871  gpaspdqspyaaaegedvlrmdpfsgklrrsirrallksvslekiipespqsseagdmspcrspstprhlryrppgvq
ENSGACP00000000064  ..............................................................................
ENSGACP00000023889  ..............................................................................
ENSGACP00000023888  ..............................................................................
ENSGACP00000020323  ..............................................................................
ENSGACP00000023488  ..............................................................................
ENSGACP00000021958  ..............................................................................
ENSGACP00000021956  ..............................................................................
ENSGACP00000021953  ..............................................................................
ENSGACP00000008098  ..............................................................................
ENSGACP00000010631  ..............................................................................
ENSGACP00000025307  ..............................................................................
ENSGACP00000006371  ..............................................................................
ENSGACP00000025304  ..............................................................................
ENSGACP00000021147  ..............................................................................
ENSGACP00000014548  ..............................................................................
ENSGACP00000017351  ..............................................................................
ENSGACP00000007783  ..............................................................................
ENSGACP00000008461  ..............................................................................
ENSGACP00000026457  ..............................................................................
ENSGACP00000002975  ..............................................................................
ENSGACP00000017143  ..............................................................................
ENSGACP00000002977  ..............................................................................
ENSGACP00000014230  ..............................................................................
ENSGACP00000001453  ..............................................................................
ENSGACP00000000474  vggelpcidafcgklrrsirravletvsldkffpdspggveagdmspcrspstprhlryrqsggstlspgdnsrctms
ENSGACP00000017355  ..............................................................................
ENSGACP00000019246  ..............................................................................
ENSGACP00000024190  ..............................................................................
ENSGACP00000000065  ..............................................................................
ENSGACP00000009014  ..............................................................................
ENSGACP00000027607  ..............................................................................
ENSGACP00000007942  ..............................................................................
ENSGACP00000022976  ..............................................................................
ENSGACP00000021883  ..............................................................................
ENSGACP00000021889  ..............................................................................
ENSGACP00000019373  ..............................................................................

                                                                                        90       100
                                                                                         |         |
d1nvus_               ................................................................EPEPTEADRIAIEN
ENSGACP00000015613  ................................................................EPEPTEEDRQALWN
ENSGACP00000015610  ................................................................EPEPTEEDRQALWN
ENSGACP00000026443  ................................................................EPRLSDLDPM--DG
ENSGACP00000021731  ....aefslfsfnvgmvvsscreldsnrsalsaasafaiataganegtptkekyrrmslasagfPTDQRNGDKE----
ENSGACP00000014370  cknpaefslfsynngmvmsscreldnnrsavsatsafaiataganegtptkekyrrmslastgfPTDQRNGDK-----
ENSGACP00000026446  ................................................................EPRLSDLDPM--DG
ENSGACP00000019508  ................................................................IERPSSHRATLVEP
ENSGACP00000016331  ................................................................ERTEQDAGK-----
ENSGACP00000007871  .........................................sgdnsrcpvspasafaiataaagH-------------
ENSGACP00000000064  ................................................................QRLSD---------
ENSGACP00000023889  ................................................................QQLDQS--------
ENSGACP00000023888  ................................................................QQLDQS--------
ENSGACP00000020323  ................................................................SPPGSE--------
ENSGACP00000023488  ................................................................QRSGDA--------
ENSGACP00000021958  ................................................................--------------
ENSGACP00000021956  ................................................................--------------
ENSGACP00000021953  ................................................................--------------
ENSGACP00000008098  ................................................................RCRG----------
ENSGACP00000010631  ................................................................RYRGK---------
ENSGACP00000025307  ................................................................LTAQLR--------
ENSGACP00000006371  ................................................................ALQGSEQEKR----
ENSGACP00000025304  ................................................................YAPSTPLQED----
ENSGACP00000021147  ................................................................--------------
ENSGACP00000014548  ................................................................ELSEGS--------
ENSGACP00000017351  ................................................................--------------
ENSGACP00000007783  ................................................................--------------
ENSGACP00000008461  ................................................................SSPNRDNIVS----
ENSGACP00000026457  ................................................................LPF-----------
ENSGACP00000002975  ................................................................--------------
ENSGACP00000017143  ................................................................--------------
ENSGACP00000002977  ................................................................--------------
ENSGACP00000014230  ................................................................--------------
ENSGACP00000001453  ................................................................--------------
ENSGACP00000000474  .................................................sasafaiataaaghgS-------------
ENSGACP00000017355  ................................................................PGG-----------
ENSGACP00000019246  ................................................................--------------
ENSGACP00000024190  ................................................................--------------
ENSGACP00000000065  ................................................................QRLSD---------
ENSGACP00000009014  ................................................................--------------
ENSGACP00000027607  ................................................................--------------
ENSGACP00000007942  ................................................................--------------
ENSGACP00000022976  ................................................................--------------
ENSGACP00000021883  ................................................................--------------
ENSGACP00000021889  ................................................................--------------
ENSGACP00000019373  ................................................................--------------

                                      110       120         130       140             150           
                                        |         |           |         |               |           
ENSGACP00000021958  ---------.........---------SL..RDKVTRVVLLWVNNHFNDFEG..DS..AM..TRFLEEFENN...LEK
ENSGACP00000021956  ---------.........---------SL..RDKVTRVVLLWVNNHFNDFEG..DS..AM..TRFLEEFENN...LEK
ENSGACP00000021953  ---------.........---------SL..RDKVTRVVLLWVNNHFNDFEG..DS..AM..TRFLEEFENN...LEK
ENSGACP00000001453  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000019246  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000024190  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000009014  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000027607  ---------.........---------SL..RDTVTRIVLLWVNNHFNDFEG..DP..AM..THFLEDFEKH...LEA
ENSGACP00000007942  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000022976  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000021883  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000021889  ---------.........-----------..---------------------..--..--..----------...---
ENSGACP00000019373  ---------.........-----------..---------------------..--..--..----------...---

                                         160            170           180                           
                                           |              |             |                           
d1nvus_               ..............K......AMKKW.....VESITKI..I..QRKKIARDNGPGH......................
ENSGACP00000015613  ..............K......SMRKW.....VESINKI..I..RRKLQTQSNGVSH......................
ENSGACP00000015610  ..............K......SMRKW.....VESINKI..I..RRKLQTQSNGVSH......................
ENSGACP00000026443  ..............K......AMRKW.....VESITKI..I..QRKKQVQVSMQSH......................
ENSGACP00000021731  ..............D......-----.....-PELLTQ..E..RKAAANIIRTLTQ......................
ENSGACP00000014370  ..............DpelltqERKAA.....ANIIRTL..T..QEDHGDNQITLAD......................
ENSGACP00000026446  ..............K......AMRKW.....VESITKI..I..QRKKQVQVSMQSH......................
ENSGACP00000019508  ..............S......DLERR.....ARNLLAH..F..HRRQQQCEPEPDGmkagqegpgggegapgefkgll
ENSGACP00000016331  ..............S......EALRR.....AEGLLEQ..L..QSQAA----LDDT......................
ENSGACP00000007871  ..............P......DLLPQ.....ESKATAN..I..LSGLSQDEQEDAQ......................
ENSGACP00000000064  ..............Gde....VYRKA.....VGQMSQA..L..IRRLTALSQYEEA......................
ENSGACP00000023889  ..............E......AYWKT.....LNQVLQK..L..SQRLALMSQGEESilkvs.................
ENSGACP00000023888  ..............E......AYWKT.....LNQVLQK..L..SQRLALMSQGEESilkvs.................
ENSGACP00000020323  ..............D......SRILRa....LKDFVPD..L..EKIVKSHS----E......................
ENSGACP00000023488  ..............G......DEYSWra...MQQMTQR..L..IKRLSALGQYEEA......................
ENSGACP00000021958  ..............E......KMCGH.....LRLLNIA..C..AAKAKPRLVTLTK......................
ENSGACP00000021956  ..............E......KMCGH.....LRLLNIA..C..AAKAKPRLVTLTK......................
ENSGACP00000021953  ..............E......KMCGH.....LRLLNIA..C..AAKAKPRLVTLTK......................
ENSGACP00000008098  ..............Dlyefp.TLEKD.....LKEFQKL..L..RRRHTVDDCPPNQ......................
ENSGACP00000010631  ..............Dlyehp.FLEKD.....VRELQKLyqL..HRRQAVDEYSPQR......................
ENSGACP00000025307  ..............R......RLAHT.....AENLLKS..L..KERDCSQTLSHGT......................
ENSGACP00000006371  ..............Dvk....ALPAL.....GDQLTEL..ErsLKRNTDDARVSKK......................
ENSGACP00000025304  ..............R......RLAHT.....AENLLKS..L..KERGTGEWQTGLPwitls.................
ENSGACP00000021147  ..............N......GELSL.....ARVLRKN..I..LDKVE--------......................
ENSGACP00000014548  ..............D......F--RL.....FSILKEQ..F..RERRRTKLLFYRS......................
ENSGACP00000017351  ..............Dsssaa.DL---.....SARILRI..A..EALSEKALLPDAR......................
ENSGACP00000007783  ..............Q......G-QEH.....LCSLLET..K..FISERDWSWKASQ......................
ENSGACP00000008461  ssavynnmrsqpnfS......SLAGQ.....AEELLKR..L..QQKQD---MEQDE......................
ENSGACP00000026457  ..............E......GNESQ.....SQLI---..-..-----DLDSVPSY......................
ENSGACP00000002975  ..............L......SCEEH.....LKLL---..-..-------------......................
ENSGACP00000017143  ..............D......GEETQ.....LIDTSCF..F..FFL----------......................
ENSGACP00000002977  ..............L......SCEEH.....LKLL---..-..-------------......................
ENSGACP00000014230  ..............G......GELRL.....ACLLRSN..I..LSKLE-------Q......................
ENSGACP00000001453  ..............-......-----.....-------..-..-----------SE......................
ENSGACP00000000474  ..............P......DLLPQ.....ERKATSN..I..LSALSQEDQDDAQ......................
ENSGACP00000017355  ..............Dsssaa.DL---.....SARILRI..A..EALSEKALLPDAR......................
ENSGACP00000019246  ..............-......-----.....-------..-..-------------......................
ENSGACP00000024190  ..............-......-----.....-------..-..-------------......................
ENSGACP00000000065  ..............G......DEVNAcvlkaVGQMSQA..L..IRRLTALSQYEEA......................
ENSGACP00000009014  ..............-......-----.....-------..-..-------------......................
ENSGACP00000027607  ..............T......KMKGH.....LRLLNIA..C..AAKAKWRQVTLQK......................
ENSGACP00000007942  ..............-......-----.....-------..-..-------------......................
ENSGACP00000022976  ..............-......-----.....-------..-..-------------......................
ENSGACP00000021883  ..............-......-----.....-------..-..-------------......................
ENSGACP00000021889  ..............-......-----.....-------..-..-------------......................
ENSGACP00000019373  ..............-......-----.....-------..-..-------------......................

d1nvus_               ................................NITFQS....SPPTV...............................
ENSGACP00000015613  ................................NITFES....PPPPI...............................
ENSGACP00000015610  ................................NITFES....PPPPI...............................
ENSGACP00000026443  ................................SITFQS....SPPPI...............................
ENSGACP00000021731  ................................EDPGDN....QVTLE...............................
ENSGACP00000014370  ................................VTQ---....-----...............................
ENSGACP00000026446  ................................SITFQS....SPPPI...............................
ENSGACP00000019508  aggeggggveekttgrcggsvvkeavffcldpPGEHIG....CPFAT...............................
ENSGACP00000016331  ................................DAGFHG....NSSFC...............................
ENSGACP00000007871  ................................LRIEDI....LQMAD...............................
ENSGACP00000000064  ................................LVKINA....AAAER...............................
ENSGACP00000023889  ................................LNASSI....SDKLV...............................
ENSGACP00000023888  ................................LNASSI....SDKLV...............................
ENSGACP00000020323  ................................EAK---....----Smkkktlirqfsngeerlqkkqpirnhddill
ENSGACP00000023488  ................................VSALSAvameRPASL...............................
ENSGACP00000021958  ................................PSRDSP....LAFSLlggqekgfrifldavepgskaaevglkrgdq
ENSGACP00000021956  ................................PSRDSP....LAFSLlggqekgfrifldavepgskaaevglkrgdq
ENSGACP00000021953  ................................PSRDSP....LAFSLlggqekgfrifldavepgskaaevglkrgdq
ENSGACP00000008098  ................................KSKQMY....QQLSLkenclqlrsppsetkeviccvhvsadsylsv
ENSGACP00000010631  ................................KGKALF....HQLSLkenslqsrgtqgetkaalchvyvtmdsflsm
ENSGACP00000025307  ................................SGELGD....PEDSA...............................
ENSGACP00000006371  ................................KHKVLL....RQFSMgdeklqkrqpiksndeillkvyccdhtytti
ENSGACP00000025304  ................................HGTSGE....LGDPE...............................
ENSGACP00000021147  ................................QRKLLR....YTNSL...............................
ENSGACP00000014548  ................................ENGYQT....L---Srnqpfdwfsnceepvgrlqpirakdkvlyei
ENSGACP00000017351  ................................KDHTGP....TGPPP...............................
ENSGACP00000007783  ................................KIKANS....S----...............................
ENSGACP00000008461  ................................EVTDDE....DSGLE...............................
ENSGACP00000026457  ................................KWKRQV....TQRVP...............................
ENSGACP00000002975  ................................---DIS....TIPSY...............................
ENSGACP00000017143  ................................-FPRGP....HGNIF...............................
ENSGACP00000002977  ................................---DIS....TIPSY...............................
ENSGACP00000014230  ................................RWHMIG....SPQSL...............................
ENSGACP00000001453  ................................LDSLLP....LPEEI...............................
ENSGACP00000000474  ................................LKIEDI....LQMAE...............................
ENSGACP00000017355  ................................KDHTGP....TGPPP...............................
ENSGACP00000019246  ................................------....-----...............................
ENSGACP00000024190  ................................------....-----...............................
ENSGACP00000000065  ................................LVKINA....AAAER...............................
ENSGACP00000009014  ................................------....-----...............................
ENSGACP00000027607  ................................ASRESP....LHFSV...............................
ENSGACP00000007942  ................................----RL....LPPEN...............................
ENSGACP00000022976  ................................------....MPADN...............................
ENSGACP00000021883  ................................------....-----...............................
ENSGACP00000021889  ................................------....-----...............................
ENSGACP00000019373  ................................----PL....MPAEN...............................

d1nvus_               ..............................................................................
ENSGACP00000015613  ..............................................................................
ENSGACP00000015610  ..............................................................................
ENSGACP00000026443  ..............................................................................
ENSGACP00000021731  ..............................................................................
ENSGACP00000014370  ..............................................................................
ENSGACP00000026446  ..............................................................................
ENSGACP00000019508  ..............................................................................
ENSGACP00000016331  ..............................................................................
ENSGACP00000007871  ..............................................................................
ENSGACP00000000064  ..............................................................................
ENSGACP00000023889  ..............................................................................
ENSGACP00000023888  ..............................................................................
ENSGACP00000020323  kvycgdhtyttirvavaatgrevisavadklgttdelvllhlssacekqilkqndvsvfsalsingrlfacprdqlgs
ENSGACP00000023488  ..............................................................................
ENSGACP00000021958  ilevngqnfenvqlikaneilknnthlsitvktnllvfkelltrpeqdhdadgeeehdrkngaphlpkigdikkasry
ENSGACP00000021956  ilevngqnfenvqlikaneilknnthlsitvktnllvfkelltrpeqdhdadgeeehdrkngaphlpkigdikkasry
ENSGACP00000021953  ilevngqnfenvqlikaneilknnthlsitvktnllvfkelltrpeqdhdadgeeehdrkngaphlpkigdikkasry
ENSGACP00000008098  hthhsleghellrivgqkmdraeedmvlavashtgerrvlqpsdcvysesmtpqgklvacrrdlteilp.........
ENSGACP00000010631  rahagmvaeellqavaermevpleklvllavtynggrhllqpqdrvfsdslrpvgrlhvcrkdlgevln.........
ENSGACP00000025307  ..............................................................................
ENSGACP00000006371  rvpvgasvrevvgavadklgsaedlllvglssagekvifkpndvsvfstlsinarlfacrrdqldsltp.........
ENSGACP00000025304  ..............................................................................
ENSGACP00000021147  ..............................................................................
ENSGACP00000014548  yrpdnkpltlmlpvntsvkdvmsaivkpggdhilvkmnsmgeraqlkmdanavytalglnerlfictssqaeklmp..
ENSGACP00000017351  ..............................................................................
ENSGACP00000007783  ..............................................................................
ENSGACP00000008461  ..............................................................................
ENSGACP00000026457  ..............................................................................
ENSGACP00000002975  ..............................................................................
ENSGACP00000017143  ..............................................................................
ENSGACP00000002977  ..............................................................................
ENSGACP00000014230  ..............................................................................
ENSGACP00000001453  ..............................................................................
ENSGACP00000000474  ..............................................................................
ENSGACP00000017355  ..............................................................................
ENSGACP00000019246  ..............................................................................
ENSGACP00000024190  ..............................................................................
ENSGACP00000000065  ..............................................................................
ENSGACP00000009014  ..............................................................................
ENSGACP00000027607  ..............................................................................
ENSGACP00000007942  ..............................................................................
ENSGACP00000022976  ..............................................................................
ENSGACP00000021883  ..............................................................................
ENSGACP00000021889  ..............................................................................
ENSGACP00000019373  ..............................................................................

d1nvus_               ..............................................................................
ENSGACP00000015613  ..............................................................................
ENSGACP00000015610  ..............................................................................
ENSGACP00000026443  ..............................................................................
ENSGACP00000021731  ..............................................................................
ENSGACP00000014370  ..............................................................................
ENSGACP00000026446  ..............................................................................
ENSGACP00000019508  ..............................................................................
ENSGACP00000016331  ..............................................................................
ENSGACP00000007871  ..............................................................................
ENSGACP00000000064  ..............................................................................
ENSGACP00000023889  ..............................................................................
ENSGACP00000023888  ..............................................................................
ENSGACP00000020323  ltp...........................................................................
ENSGACP00000023488  ..............................................................................
ENSGACP00000021958  sipdlavdveqvmglekaskkaksnsvggrnklkkifdktltsilppkpyndvcvgqsqddsivgmkqskqiapalpv
ENSGACP00000021956  sipdlavdveqvmglekaskkaksnsvggrnklkkifdktltsilppkpyndvcvgqsqddsivgmkqskqiapalpv
ENSGACP00000021953  sipdlavdveqvmglekaskkaksnsvggrnklkkifdktltsilppkpyndvcvgqsqddsivgmkqskqiapalpv
ENSGACP00000008098  ..............................................................................
ENSGACP00000010631  ..............................................................................
ENSGACP00000025307  ..............................................................................
ENSGACP00000006371  ..............................................................................
ENSGACP00000025304  ..............................................................................
ENSGACP00000021147  ..............................................................................
ENSGACP00000014548  ..............................................................................
ENSGACP00000017351  ..............................................................................
ENSGACP00000007783  ..............................................................................
ENSGACP00000008461  ..............................................................................
ENSGACP00000026457  ..............................................................................
ENSGACP00000002975  ..............................................................................
ENSGACP00000017143  ..............................................................................
ENSGACP00000002977  ..............................................................................
ENSGACP00000014230  ..............................................................................
ENSGACP00000001453  ..............................................................................
ENSGACP00000000474  ..............................................................................
ENSGACP00000017355  ..............................................................................
ENSGACP00000019246  ..............................................................................
ENSGACP00000024190  ..............................................................................
ENSGACP00000000065  ..............................................................................
ENSGACP00000009014  ..............................................................................
ENSGACP00000027607  ..............................................................................
ENSGACP00000007942  ..............................................................................
ENSGACP00000022976  ..............................................................................
ENSGACP00000021883  ..............................................................................
ENSGACP00000021889  ..............................................................................
ENSGACP00000019373  ..............................................................................

d1nvus_               ..............................................................................
ENSGACP00000015613  ..............................................................................
ENSGACP00000015610  ..............................................................................
ENSGACP00000026443  ..............................................................................
ENSGACP00000021731  ..............................................................................
ENSGACP00000014370  ..............................................................................
ENSGACP00000026446  ..............................................................................
ENSGACP00000019508  ..............................................................................
ENSGACP00000016331  ..............................................................................
ENSGACP00000007871  ..............................................................................
ENSGACP00000000064  ..............................................................................
ENSGACP00000023889  ..............................................................................
ENSGACP00000023888  ..............................................................................
ENSGACP00000020323  ..............................................................................
ENSGACP00000023488  ..............................................................................
ENSGACP00000021958  sgnlsssnpdllqshhrildfnnqpdmsdqvlrvfkadqqsryimigkdttakevvaqairefaltaapeayslcevs
ENSGACP00000021956  sgnlsssnpdllqshhrildfnnqpdmsdqvlrvfkadqqsryimigkdttakevvaqairefaltaapeayslcevs
ENSGACP00000021953  sgnlsssnpdllqshhrildfnnqpdmsdqvlrvfkadqqsryimigkdttakevvaqairefaltaapeayslcevs
ENSGACP00000008098  ..............................................................................
ENSGACP00000010631  ..............................................................................
ENSGACP00000025307  ..............................................................................
ENSGACP00000006371  ..............................................................................
ENSGACP00000025304  ..............................................................................
ENSGACP00000021147  ..............................................................................
ENSGACP00000014548  ..............................................................................
ENSGACP00000017351  ..............................................................................
ENSGACP00000007783  ..............................................................................
ENSGACP00000008461  ..............................................................................
ENSGACP00000026457  ..............................................................................
ENSGACP00000002975  ..............................................................................
ENSGACP00000017143  ..............................................................................
ENSGACP00000002977  ..............................................................................
ENSGACP00000014230  ..............................................................................
ENSGACP00000001453  ..............................................................................
ENSGACP00000000474  ..............................................................................
ENSGACP00000017355  ..............................................................................
ENSGACP00000019246  ..............................................................................
ENSGACP00000024190  ..............................................................................
ENSGACP00000000065  ..............................................................................
ENSGACP00000009014  ..............................................................................
ENSGACP00000027607  ..............................................................................
ENSGACP00000007942  ..............................................................................
ENSGACP00000022976  ..............................................................................
ENSGACP00000021883  ..............................................................................
ENSGACP00000021889  ..............................................................................
ENSGACP00000019373  ..............................................................................

                                                                  200              210       220    
                                                                    |                |         |    
d1nvus_               ..........................................E.WHISRPGHIET.......FDLLTLHPIEIARQLT
ENSGACP00000015613  ..........................................E.WHICRVGHVDT.......FDLMTLHPIEIARQLT
ENSGACP00000015610  ..........................................E.WHICRVGHVDT.......FDLMTLHPIEIARQLT
ENSGACP00000026443  ..........................................E.WHTCKPGNTEQ.......FDLMTLHPIEIGRQLT
ENSGACP00000021731  ..........................................E.IIQMASEDCKT.......EPFESHSALEIAEQLT
ENSGACP00000014370  ..........................................-.----AMGEGKV.......EQFESHSALEIAEQLT
ENSGACP00000026446  ..........................................E.WHTCKPGNTEQ.......FDLMTLHPIEIGRQLT
ENSGACP00000019508  ..........................................Q.EESGFEDELPA.......FSFLSFDPIMVAEQFT
ENSGACP00000016331  ..........................................L.GEEEEVEVEVQ.......ENFLSFESDLVAEQLT
ENSGACP00000007871  ..........................................C.PKAEC------.......--FESLSAMELAEQIT
ENSGACP00000000064  ..........................................L.TSLKAKPQASIqrd....MLSICNDPFAVAQQLT
ENSGACP00000023889  ..........................................A.FKTKPPHIQKD.......MLSICNDPYTLAQQLT
ENSGACP00000023888  ..........................................A.FKTKPPHIQKD.......MLSICNDPYTLAQQLT
ENSGACP00000020323  ..........................................L.PDQEGPSAGSM.......STFELMSSKDLAYQMT
ENSGACP00000023488  ..........................................K.GRQAAGQRGD-.......VMSACDDPFVLAQQLT
ENSGACP00000021958  vtpegvikqrrlpdqlskladriqlsgryylksnmetetlcsD.DDAQDLLREGQ.......ISLLQLSTVEVATQLS
ENSGACP00000021956  vtpegvikqrrlpdqlskladriqlsgryylksnmetetlcsD.DDAQDLLREGQ.......ISLLQLSTVEVATQLS
ENSGACP00000021953  vtpegvikqrrlpdqlskladriqlsgryylksnmetetlcsD.DDAQDLLREGQ.......ISLLQLSTVEVATQLS
ENSGACP00000008098  ..........................................P.LTDSAELSRRP.......VRLLGINTCDVAAALT
ENSGACP00000010631  ..........................................P.FTDNSELQQRT.......ARMLSINTWDVAVALT
ENSGACP00000025307  ..........................................-.--DTSIREEDK.......CNFMDFAVREVAEQLT
ENSGACP00000006371  ..........................................L.PEQEGSSTGPL.......ASFELMSSKDVAYHMT
ENSGACP00000025304  ..........................................D.SADTSIREEDK.......CNFMDFAVREVAEQLT
ENSGACP00000021147  ..........................................K.PLAARGVSARP.......GTLHDFRSHEIADQLT
ENSGACP00000014548  ..........................................L.KEQQGPERGTT.......DLLEQMGSKDIANELT
ENSGACP00000017351  ..........................................-.----DASKFEP.......TSVLGFPAALIAEQLT
ENSGACP00000007783  ..........................................-.-----KKRKVS.......LLFDHLEPIELAEHLT
ENSGACP00000008461  ..........................................V.-------SHDP.......GGILDFPALAIAEQLT
ENSGACP00000026457  ..........................................-.--SMSKKRKMS.......LLFDHLDSCELAEHLT
ENSGACP00000002975  ..........................................D.WMRKLTQRKKQpkkgkasLLFDHLEPMELAEHLT
ENSGACP00000017143  ..........................................QaPSPSVKKRKVS.......LIFDHMEPDEMAEHLS
ENSGACP00000002977  ..........................................D.WMRKLTQRKKQpkkgkasLLFDHLEPMELAEHLT
ENSGACP00000014230  ..........................................R.PLAAKGVAARP.......GTLLDFRSQDLAEQLT
ENSGACP00000001453  ..........................................H.WTPGDS-----.......-KLHDMSAEEVANQLV
ENSGACP00000000474  ..........................................N.PKAEC------.......--FESLSAMELAEQIT
ENSGACP00000017355  ..........................................-.----DASKFEP.......TSVLGFPAALIAEQLT
ENSGACP00000019246  ..........................................-.-------DAVV.......FDVLKVTPEEYAGQIT
ENSGACP00000024190  ..........................................-.-------DAVV.......FDVLKVTPEEFASQIT
ENSGACP00000000065  ..........................................L.TSLKAKPQASIqrd....MLSICNDPFAVAQQLT
ENSGACP00000009014  ..........................................-.-----------.......-------PEEIACILT
ENSGACP00000027607  ..........................................Q.G----------.......----------------
ENSGACP00000007942  ..........................................K.PLETVVLKRAK.......ELLLSHDHHSIARHLL
ENSGACP00000022976  ..........................................K.PLEMSVLKRVK.......ELLAEVDARTAAVHIT
ENSGACP00000021883  ..........................................-.-LEPAVLLALK.......ELFNRSKAEATALHML
ENSGACP00000021889  ..........................................-.-LEPAVLLALK.......ELFNRSKAEATALHML
ENSGACP00000019373  ..........................................R.PLEAGVLRRVK.......ELLAEVDARTAARHIT

                         230       240                     250                                      
                           |         |                       |                                      
d1nvus_               LLESDLYRAVQPSELV.GSVWT...KE..........DKE........................IN.SPNLL......
ENSGACP00000015613  LLESELYRAVRPSELV.GSVWT...KE..........DKE........................KN.SPNLL......
ENSGACP00000015610  LLESELYRAVRPSELV.GSVWT...KE..........DKE........................KN.SPNLL......
ENSGACP00000026443  LLESDFYRAVQPSELV.GSVWT...KE..........DKE........................IH.SPNLL......
ENSGACP00000021731  LLDHLVFKVIPYEEFF.GQGWM...KN..........DKN........................ER.TPYIM......
ENSGACP00000014370  LLDHLVFKVIPYEEFF.GQGWM...KN..........DKN........................EK.TPYIM......
ENSGACP00000026446  LLESDFYRAVQPSELV.GSVWT...KE..........DKE........................IH.SPNLL......
ENSGACP00000019508  LMDADLFKKVVPYHCL.GGIWSqrdKK..........GKE........................HL.APTIR......
ENSGACP00000016331  YMDALLFKKVVPHHCL.GSVWSqrdKK..........HNK........................HS.APTVR......
ENSGACP00000007871  LLDHIVFRSIPYEEFL.GLGWM...KV..........DKT........................ER.TPYIM......
ENSGACP00000000064  HIELERLSYIGPEEFV.QAFVQ...KDpldndkscf.SDH........................KK.ASSLE......
ENSGACP00000023889  HVEQEHLSHIGPEEFV.QAFVQ...KDpldgtqpcfgDQK........................KK.TFNLE......
ENSGACP00000023888  HVEQEHLSHIGPEEFV.QAFVQ...KDpldgtqpcfgDQK........................KK.TFNLE......
ENSGACP00000020323  LYDWELFSCVHEHELL.YHTFG...RA..........SFR........................RT.TANLD......
ENSGACP00000023488  HIELDRLSFIGPEEFI.QTFAM...KD..........PLEnhkgffrk................RK.TSNLE......
ENSGACP00000021958  MRAFELFCAIEPTEYI.DDLF-...KH..........RSK........................AG.SASLK......
ENSGACP00000021956  MRAFELFCAIEPTEYI.DDLF-...KH..........RSK........................AG.SASLK......
ENSGACP00000021953  MRAFELFCAIEPTEYI.DDLF-...KH..........RSK........................AG.SASLK......
ENSGACP00000008098  HLDWSLFKSIHEQELA.YYTLS...RV..........PGT........................GH.TAALS......
ENSGACP00000010631  DFDWTIFESIHEQELV.YFTFS...RH..........SSS........................SH.TVALE......
ENSGACP00000025307  RLDAELFVRVKPFHCL.GCVWSqrdKR..........QNR........................NL.APTVR......
ENSGACP00000006371  SYDWELFHCVHELELL.YHTFG...RQ..........NLK........................KT.TVNLD......
ENSGACP00000025304  RLDAELFVRVKPFHCL.GCVWSqrdKR..........QNR........................NL.APTVR......
ENSGACP00000021147  LLDAELFYKIEIPEVL.--LWA...KE..........QNE........................EK.SPNLT......
ENSGACP00000014548  NYDWELFTAMHEVELV.YYIFG...LH..........KFP........................GAiTANLE......
ENSGACP00000017351  RLETELFVRLVPYHCL.GSLWSqrdKK..........GRE........................GV.CWSVR......
ENSGACP00000007783  FLEFKSFCRISFVDYQ.NYIR-...-S..........CCM........................KD.IPVME......
ENSGACP00000008461  RKDSALFVKVMPYQCL.GCVWS...KR..........DKK........................ENmSPTIR......
ENSGACP00000026457  YLEYKSFCKILFQDYH.SFVM-...-H..........GCT........................VE.NPILE......
ENSGACP00000002975  YLEFKSTRRISFNDYH.SYVI-...-H..........GCL........................VE.NPTLE......
ENSGACP00000017143  YLEFKNFCNVSFLDYR.SYVV-...-R..........GSV........................RD.NPALE......
ENSGACP00000002977  YLEFKSTRRISFNDYH.SYVI-...-H..........GCL........................VE.NPTLE......
ENSGACP00000014230  LLDSELFCKIELPEVL.--LWS...KE..........QNE........................EK.SPNLK......
ENSGACP00000001453  AFDWELFSCVHEVEFV.CYVFH...GE..........QSR........................WR.PLNLE......
ENSGACP00000000474  LLDHIVFRGIPYEEFL.GQGWM...KV..........DKT........................ER.TPYIM......
ENSGACP00000017355  RLETELFVRLVPYHCL.GSLWSqrdKK..........GRE........................GV.CWSVR......
ENSGACP00000019246  LMDSPVFKAIQNFDELsSCGWN...KK..........EKH........................SS.SPNVV......
ENSGACP00000024190  LMDAPVFKAIHPEELA.SCGWI...GK..........EKH........................RL.SPNVV......
ENSGACP00000000065  HIELERLSYIGPEEFV.QAFVQ...KDpldndkscf.SDH........................KK.ASSLE......
ENSGACP00000009014  GQEQELYQRVFPLDYL.CFLTR...DV..........GSPesrtkrhhhlkaslsvpaiptqsaQR.SNAVE......
ENSGACP00000027607  ----------------.-----...--..........---........................--.-----......
ENSGACP00000007942  LADCQVARTVGVTPEV.-----...-K..........GQM........................GV.SSGLElvtlph
ENSGACP00000022976  MADCTVARILGVTTEL.-----...-Q..........RMM........................GV.SSGLElltlph
ENSGACP00000021883  SVDCQVARIVGVTDEQ.-----...-K..........TSMgvgsglelvtlp............HG.SQLRK......
ENSGACP00000021889  SVDCQVARIVGVTDEQ.-----...-K..........TSMgvgsglelvtlp............HG.SQLRK......
ENSGACP00000019373  AADCRVARILEVTPEA.-----...-Q..........RMM........................GV.SSGMElltlph

                            260       270                       280       290         300       310 
                              |         |                         |         |           |         | 
ENSGACP00000000065  ......AYVDWFNRLSYLVATEICLVR..D..............---------------.-----.------------
ENSGACP00000027607  ......---------------------..-..............---------------.-----.------------

                            320       330       340                 350                             
                              |         |         |                   |                             
d1nvus_               AMNSSPVYRLDHTFEQIPSRQKKILEEAHE.......LS.E..DHYKKYLAKL.........................
ENSGACP00000000064  GMNMSPVSRLKKTWNKVK---TAKFDILEH.......QMdPs.SNFYNYRTAL.........................
ENSGACP00000023889  GMNMSPVSRLKKTWGKAK---TAKFFILEH.......QMdPt.GNFYNYRTAL.........................
ENSGACP00000023888  GMNMSPVSRLKKTWGKAK---TAKFFILEH.......QMdPt.GNFYNYRTAL.........................
ENSGACP00000023488  GMNMSPVARLRKTWSKVN---TDKFEILEH.......QMdPs.SNFTNYRTAL.........................
ENSGACP00000021147  ALDSAPIRRLEW-----QKQTSEGLEEYCT.......LIdSs.SSFRAYRAAL.........................
ENSGACP00000014230  ALDSAPLRRLDW-----QRHTAEALEEFSS.......LIdSs.SSFRAYRAAL.........................
ENSGACP00000000474  ALNRSAIYRLKKTWAKVCKQVRMXPNFSKEgprrmvrCFiPs.TNPLNESD--.........................
ENSGACP00000000065  ------------------------------.......--.-..----------.........................
ENSGACP00000009014  GLRSRKVL---KMWQFMDPSDIETMRSLKD.......AMaQh.ESSSEYKKVV.........................
ENSGACP00000027607  ------------------------------.......--.-..----------.........................
ENSGACP00000007942  ALDLPQISRLEETWTTLRRTYTQTAISYEK.......TLkPfyKNL-------.........................
ENSGACP00000021883  ALDMPQITRLEMTWRALRRNHTDTAVLFEK.......KLkP..----------.........................
ENSGACP00000021889  ALDMPQITRLEMTWRALRRNHTDTAVLFEK.......KLkP..----------.........................

                                                           360       370        380                 
                                                             |         |          |                 
d1nvus_               .........RSI....NP.....................PCVPFFGIYLT.NILKTEEGNPEVLKR............
ENSGACP00000015613  .........KSI....NP.....................PCVPFFGIYLT.NILKTEEGNPDFLKR............
ENSGACP00000015610  .........KSI....NP.....................PCVPFFGIYLT.NILKTEEGNPDFLKR............
ENSGACP00000026443  .........RSI....NP.....................PCVPFFGIYLT.NILKTEEGNPDFLRR............
ENSGACP00000021731  .........KNC....DP.....................PCVPYLGMYLT.DLAFIEEGTPNYT--............
ENSGACP00000014370  .........KNC....DP.....................PCVPYLGMYLT.DLAFIEEGTPNYT--............
ENSGACP00000026446  .........RSI....NP.....................PCVPFFGIYLT.NILKTEEGNPDFLRR............
ENSGACP00000019508  .........Q--....-Qqrdlgvmq.............GTIPYLGTFLT.DLVMMDTAMKDHT--............
ENSGACP00000016331  ...lqlqkeMGA....MQ.....................GTIPYLGTFLT.DLTMMDTALPDLI--............
ENSGACP00000007871  .........KNC....NP.....................PCVPYLGMYQT.DLAFIEEGRPNLT--............
ENSGACP00000000064  .........RGA....TQrsvtanssrek..........IVVPFFSLLIK.DIYFLNEGCANRL--............
ENSGACP00000023889  .........RGA....AHrsrtansnrer..........IVIPFFSLLIK.DIYFLNEGCANRL--............
ENSGACP00000023888  .........RGA....AHrsrtansnrer..........IVIPFFSLLIK.DIYFLNEGCANRL--............
ENSGACP00000020323  .........TKL....EP.....................PIIPFMPLLLK.DMTFTHEGNKTFI--............
ENSGACP00000023488  .........RGA....TQrsetahssqek..........IVIPFFSLLIK.DIYFLNEGCASKL--............
ENSGACP00000021958  .........NNQnl..QP.....................PIIPLFPVIKK.DLTFLHEGNDSKV--............
ENSGACP00000021956  .........NNQnl..QP.....................PIIPLFPVIKK.DLTFLHEGNDSKV--............
ENSGACP00000021953  .........NNQnl..QP.....................PIIPLFPVIKK.DLTFLHEGNDSKV--............
ENSGACP00000008098  .........KKM....KP.....................PKIPFMPLLLK.DITFIHEGNKTFH--............
ENSGACP00000010631  .........KKM....KA.....................PKIPFPPLLLK.DITFIHEGNKTFH--............
ENSGACP00000025307  ifkfqvqppKSF....SS.....................GVVPYLGTYLT.VLTMLDTALTDTV--............
ENSGACP00000006371  .........AKL....EP.....................PIIPFMPLLIKaDMTFTHEGNRTFI--............
ENSGACP00000025304  .........PSF....SS.....................GVVPYLGTYLT.VLTMLDTALTDTV--............
ENSGACP00000021147  .........AEV....EP.....................PCIPYLGLILQ.DLTFVHLGNPDLI--............
ENSGACP00000014548  .........AKL....SP.....................PYIPFMPLLLK.DMTFINDGNPNYV--............
ENSGACP00000017351  .........KEV....SFrpsvismlkkenyshrgtnaqGTVPYLGIFLT.DLTMLDTAVKDRL--............
ENSGACP00000007783  .........SRC....TG.....................FKIPILGVHLK.DLISVNEAMSDYV--............
ENSGACP00000008461  .........R--....-Qmstcs................GVVPYLGTYLS.VFNMLDTAHPDTV--............
ENSGACP00000026457  .........SEC....SG.....................FRFPILGVHLK.DLIAVHVALPDWA-D............
ENSGACP00000002975  .........NEC....QG.....................FKIPILGVHLK.DLIAVHVIFPDWV--............
ENSGACP00000017143  .........NVC....SG.....................FKVPILGVHLK.DLISLNEALPDYI--............
ENSGACP00000002977  .........NEC....QG.....................FKIPILGVHLK.DLIAVHVIFPDWV--............
ENSGACP00000014230  .........AEV....EP.....................PCIPYLGLILQ.DLTFVHLGNPDTLMT............
ENSGACP00000001453  .........TSL....RP.....................PLIPFTPLLLK.DLTFLHESCKTFH--............
ENSGACP00000000474  .........---....-Alvkktyildgkss........FVIP-------.---------PSLT--............
ENSGACP00000017355  .........K--....--.....................-----------.---------------............
ENSGACP00000019246  .........SSQs...MV.....................SCIPYLGMYLS.DLTYIDSAYPST---............
ENSGACP00000024190  .........RSLk...MV.....................PRIPYLGIYLL.DMIYIDSAYPA----............
ENSGACP00000000065  .........---....--.....................-----------.---------------............
ENSGACP00000009014  .........TRAlnipGF.....................KVVPFCGVFLK.ELSDALDGTASIISLkpplyntedsie
ENSGACP00000027607  .........---....--.....................-----------.---------------............
ENSGACP00000007942  .........---....--.....................-----------.---------------............
ENSGACP00000022976  .........ALAnts.VP.....................HIIPILSLLER.GMAVGEALEPWESAEvgvdvvmyhlea
ENSGACP00000021883  .........---....--.....................-----------.---------------............
ENSGACP00000021889  .........---....--.....................-----------.---------------............
ENSGACP00000019373  .........PLAgtt.FP.....................HVLPLLSLLEK.---------------............

                                          390       400       410                                   
                                            |         |         |                                   
d1nvus_               ...............HGK.E..LINFSKRRKVAEITGEIQQYQ..NQP.......Y......................
ENSGACP00000015613  ...............HGK.E..LINFSKRRKVAEITGEIQQYQ..NQP.......Y......................
ENSGACP00000015610  ...............HGK.E..LINFSKRRKVAEITGEIQQYQ..NQP.......Y......................
ENSGACP00000026443  ...............HGK.D..LINFSKRRKVAEITGEIQQYQ..NQP.......Y......................
ENSGACP00000021731  ...............-ED.N..LVNFSKMRMISHIIREIRQFQ..QTA.......Y......................
ENSGACP00000014370  ...............-ED.R..LVNFSKMRMISHIIREIRQFQ..QTA.......Y......................
ENSGACP00000026446  ...............HGK.D..LINFSKRRKVAEITGEIQQYQ..NQP.......Y......................
ENSGACP00000019508  ...............-EG.G..LINFEKRRKEFEVIAQIKLLQlaSNN.......Y......................
ENSGACP00000016331  ...............-EG.G..LNNFEKRRREFEVIAQIKLLQ..SACns.....Y......................
ENSGACP00000007871  ...............-ED.G..LVNFSKMRMISHIIREIRQFQ..QTP.......Y......................
ENSGACP00000000064  ...............-QS.G..HVNFEKFWELAKQVSEFMAWK..KVE.......C......................
ENSGACP00000023889  ...............-PS.G..HVNFEKFVELARQVREFMTWK..KVE.......C......................
ENSGACP00000023888  ...............-PS.G..HVNFEKFVELARQVREFMTWK..KVE.......C......................
ENSGACP00000020323  ...............--D.N..MVNFEKMRIIANTIRQVRHCR..SQP.......F......................
ENSGACP00000023488  ...............-TN.G..HINFEKLWELAKQVSEFLVWR..QVI.......C......................
ENSGACP00000021958  ...............--D.G..LVNFEKLRMIAKEIRHVGRMA..SVN.......M......................
ENSGACP00000021956  ...............--D.G..LVNFEKLRMIAKEIRHVGRMA..SVN.......M......................
ENSGACP00000021953  ...............--D.G..LVNFEKLRMIAKEIRHVGRMA..SVN.......M......................
ENSGACP00000008098  ...............--D.N..LVNFEKLHMIAETVRMIRHCQ..SDQpgnevigV......................
ENSGACP00000010631  ...............--D.N..MVNFEKLHMIADTLRLIRQCQ..KDHmgng...I......................
ENSGACP00000025307  ...............-EG.G..LINFEKRRREFEILSQIRQLQ..ASSsr.....Y......................
ENSGACP00000006371  ...............--D.Y..LVNFEKMRMIANTLKIVRYCR..SQA.......F......................
ENSGACP00000025304  ...............-EG.G..LINFEKRRREFEILSQIRQLQ..ASSsr.....Y......................
ENSGACP00000021147  ...............--D.G..KVNFSKRWQQFNILDSMRRFQ..QVH.......Y......................
ENSGACP00000014548  ...............--D.K..LVNFEKVRMIAKTVKIVRGCR..SQP.......Yvpsspqrgladrmflegpstri
ENSGACP00000017351  ...............-DN.G..YINFDKRRREFEVLAQIRLLQ..SSC.......K......................
ENSGACP00000007783  ...............-ED.S..KVNVQKLQALYSHINELIQLQ..LIP.......P......................
ENSGACP00000008461  ...............-RG.G..LINFEKRRKEFEVLSQISVLQ..ACCsq.....Y......................
ENSGACP00000026457  ...............KEK.T..RVNLAKAQQLYAILQELALIQ..TTP.......P......................
ENSGACP00000002975  ...............-HDsS..QVNLVKMHQLYMTFNELVSLQ..SAV.......A......................
ENSGACP00000017143  ...............-NE.E..KINLSKLEHLYSNISDLVALH..SCT.......P......................
ENSGACP00000002977  ...............-HDsS..QVNLVKMHQLYMTFNELVSLQ..SAV.......A......................
ENSGACP00000014230  ...............SQG.S..KVNFSKRWQQFNILDTLRSYQ..QVLvp.....Y......................
ENSGACP00000001453  ...............--G.E..LVNFEKMHKVADMVRIIRRYR..SSQla.....M......................
ENSGACP00000000474  ...............---.-..------------SSGEIRQVQ..QAP.......Y......................
ENSGACP00000017355  ...............---.-..---------------------..---.......-......................
ENSGACP00000019246  ...............---.GsiLENEQRSNLMNNILRIISDLQ..RSCt......Y......................
ENSGACP00000024190  ...............-SD.Si.LETEQRTNQMNNLLRLISDLQ..MSCn......Y......................
ENSGACP00000000065  ...............---.-..---------------------..---.......-......................
ENSGACP00000009014  fvsdysgqhnfmsrsGPD.G..LHVPEKEATVSNILQIIRSCN..---.......-......................
ENSGACP00000027607  ...............---.-..---------------------..---.......-......................
ENSGACP00000007942  ...............---.-..---------------------..---.......-......................
ENSGACP00000022976  .artmahhggiyrsnTET.K..LQGFQERAEIHEIFQ------..---.......-......................
ENSGACP00000021883  ...............---.-..---------------------..---.......-......................
ENSGACP00000021889  ...............---.-..---------------------..---.......-......................
ENSGACP00000019373  ...............---.-..---------------------..---.......-......................

d1nvus_               ........C..L......................................................RVESD.IKRFFE
ENSGACP00000015613  ........C..L......................................................KVEHD.IRRFFE
ENSGACP00000015610  ........C..L......................................................KVEHD.IRRFFE
ENSGACP00000026443  ........C..L......................................................RVESDiRQRFFE
ENSGACP00000021731  ........K..I......................................................DYQPK.VAKYLL
ENSGACP00000014370  ........K..I......................................................DLQPK.VAQYLL
ENSGACP00000026446  ........C..L......................................................RVESDiRQRFFE
ENSGACP00000019508  ........S..F......................................................TQDAH.FREWFS
ENSGACP00000016331  ........C..L......................................................SPEPA.FLRWFK
ENSGACP00000007871  ........R..I......................................................EHQAK.VTQYLL
ENSGACP00000000064  ........P..F......................................................EKDRK.ILQYLL
ENSGACP00000023889  ........P..F......................................................EEDRA.ILHYLH
ENSGACP00000023888  ........P..F......................................................EEDRA.ILHYLH
ENSGACP00000020323  ........N..P......................................................EICQP.NKNQAD
ENSGACP00000023488  ........P..F......................................................DRDRR.ILQYLV
ENSGACP00000021958  ........D..PalmfrtrkkkwrslgnmsqgsanaavldvtqtgghkkrvrrssflnakklyedaQMARK.VKQYLS
ENSGACP00000021956  ........D..Palmfrtrslgqgsanaavldvtqtgghkkrvrrssflnakklyeda........QMARK.VKQYLS
ENSGACP00000021953  ........D..Palmfrtrkkkwrslgqgsanaavldvtqtgghkkrvrrssflnakklyeda...QMARK.VKQYLS
ENSGACP00000008098  ........D..S......................................................AEVRA.SVHYLH
ENSGACP00000010631  ........T..Q......................................................KSSSE.VRAYID
ENSGACP00000025307  ........S..L......................................................PVNAQ.ITTWLQ
ENSGACP00000006371  ........S..P......................................................DSTQA.SKNQAE
ENSGACP00000025304  ........S..L......................................................PVNAQ.ITTWLQ
ENSGACP00000021147  ........D..L......................................................KRNED.IVCFFN
ENSGACP00000014548  styselafP..L......................................................RSPSS.IRHYIQ
ENSGACP00000017351  ........NcvF......................................................TTDEA.FARWYQ
ENSGACP00000007783  ........R..L......................................................DANKD.LVHLLT
ENSGACP00000008461  ........N..L......................................................PHSPG.IAAWLR
ENSGACP00000026457  ........H..V......................................................DANTD.LLNLLT
ENSGACP00000002975  ........Q..V......................................................EPNMD.LIYLLT
ENSGACP00000017143  ........P..F......................................................EANKD.LLHLLT
ENSGACP00000002977  ........Q..V......................................................EPNMD.LIYLLT
ENSGACP00000014230  ........T..L......................................................QPNDD.IISFFN
ENSGACP00000001453  ........D..T......................................................ETSPP.HLQTKA
ENSGACP00000000474  ........R..I......................................................EHQPQ.VTQFLL
ENSGACP00000017355  ........-..-......................................................-----.------
ENSGACP00000019246  ........D..V......................................................AVLPH.VQKYLN
ENSGACP00000024190  ........Dh.L......................................................VTLPH.VQKYLL
ENSGACP00000000065  ........-..-......................................................-----.------
ENSGACP00000009014  ........-..-......................................................-----.------
ENSGACP00000027607  ........-..-......................................................-----.------
ENSGACP00000007942  ........-..-......................................................-----.------
ENSGACP00000022976  ........-..-......................................................-----.------
ENSGACP00000021883  ........-..-......................................................-----.------
ENSGACP00000021889  ........-..-......................................................-----.------
ENSGACP00000019373  ........-..-......................................................-----.------

                      430       440       450           460       470       480                     
                        |         |         |             |         |         |                     
ENSGACP00000015613  NLNPMDNRSEKEFSDYLFKMSLDIEPRNc...RQAPRFPRKT----------------vyp.................
ENSGACP00000015610  NLNPMDNRSEKEFSDYLFKMSLDIEPRNc...RQAPRFPRKT----------------vyp.................
ENSGACP00000021731  DSSTA------LDEESLYDASLRIEPK-....--------------------------t...................
ENSGACP00000014370  DNSFV------LDEESMYEASLRIEPK-....--------------------------v...................
ENSGACP00000019508  GVEKL-------SEAESYNLSCEIEPLSesa.SNTLRAKKNGGIMKRWSD--------rql.................
ENSGACP00000016331  GQAQL-------SEEESYALSCEIEGLG....DSSPTSPKPRKSMVKRLS--------lmfl................
ENSGACP00000007871  DKTLI------MDEDTLYDLSLKIEPR-....--------------------------....................
ENSGACP00000000064  TAPVF-------TEDALYLASYESEGPE....NHMEKDRWKSLRSSL-----------ls..................
ENSGACP00000023889  TAPIF-------SEDGLYLASYESESPE....NQVEKDRWKA----------------lr..................
ENSGACP00000023888  TAPIF-------SEDGLYLASYESESPE....NQVEKDRWKA----------------l...................
ENSGACP00000020323  VRGYVRKLCVIDNQRALTQLSYRMEPR-....--------------------------....................
ENSGACP00000023488  TTPVF-------TEDELHLASYESEGPE....NNMEKDSRRS----------------lrwv................
ENSGACP00000021958  HLSLE------SNEESLQTLSMQCEPS-....--------------------------....................
ENSGACP00000021956  HLSLE------SNEESLQTLSMQCEPS-....--------------------------....................
ENSGACP00000021953  HLSLE------SNEESLQTLSMQCEPS-....--------------------------....................
ENSGACP00000008098  II---------DNQQTLFELSHKLEPR-....--------------------------....................
ENSGACP00000010631  YLHII------DNQQTLFELSHGLEPR-....--------------------------....................
ENSGACP00000025307  AHTLL-------TDQESYELSRDLEPPV....DPCPTSPSSWSS--------------llt.................
ENSGACP00000006371  VRTYVRQFKVIDNQRTLSQLSHRLEPR-....--------------------------r...................
ENSGACP00000025304  AHTLL-------TDQESYELSRDLEPPV....DPCPTSPSSWS---------------sll.................
ENSGACP00000021147  DFSDH------LAEEALWELSLKIKPRN....--------------------------....................
ENSGACP00000014548  NLKVI------DNQRKLTQLSRTIE---....--------------------------....................
ENSGACP00000017351  SVPLL-------TEAESYRLSNEIEAPG....EP------------------------sprgvppt............
ENSGACP00000008461  GHKLL-------SDQESYELSKQLEPPL....DLCSPTPWSHRA--------------lskkls..............
ENSGACP00000026457  VSLDQYH-----TEEEIYQMSLHREPRK....PAQ-----------------------nsspas..............
ENSGACP00000014230  DFSDH------LAEEALWELSLRLRPRN....--------------------------a...................
ENSGACP00000001453  YVRQL---QVIDNQNLLFDMSCKLEPK-....--------------------------d...................
ENSGACP00000000474  DKTLV------MDEDTLYELSLKIEPR-....--------------------------v...................
ENSGACP00000017355  ----------------------------....--------------------------e...................
ENSGACP00000019246  SVRYIEEL-QKFVEDDNYKLSQKIEPGS....S-------------------------tprv................
ENSGACP00000024190  SVRYIEEL-QKFVEDDNFKLSLKIEPGN....SSPRI---------------------assk................
ENSGACP00000000065  ----------------------------....--------------------------....................
ENSGACP00000009014  -------------------RSLEAEDP-....--------------------------deastdpsstcpasannsfr
ENSGACP00000027607  ----------------------------....--------------------------gsergfgifv..........
ENSGACP00000007942  ----------------------------....--------------------------ye..................
ENSGACP00000022976  ----------------------------....--------------------------tefqmrllwgsrgsegsqse
ENSGACP00000021883  ----------------------------....--------------------------fmnl................
ENSGACP00000021889  ----------------------------....--------------------------fmnl................
ENSGACP00000019373  ----------------------------....--------------------------gvtvgewaepw.........

d1nvus_               ....................
ENSGACP00000015613  ....................
ENSGACP00000015610  ....................
ENSGACP00000026443  ....................
ENSGACP00000021731  ....................
ENSGACP00000014370  ....................
ENSGACP00000026446  ....................
ENSGACP00000019508  ....................
ENSGACP00000016331  ....................
ENSGACP00000007871  ....................
ENSGACP00000000064  ....................
ENSGACP00000023889  ....................
ENSGACP00000023888  ....................
ENSGACP00000020323  ....................
ENSGACP00000023488  ....................
ENSGACP00000021958  ....................
ENSGACP00000021956  ....................
ENSGACP00000021953  ....................
ENSGACP00000008098  ....................
ENSGACP00000010631  ....................
ENSGACP00000025307  ....................
ENSGACP00000006371  ....................
ENSGACP00000025304  ....................
ENSGACP00000021147  ....................
ENSGACP00000014548  ....................
ENSGACP00000017351  ....................
ENSGACP00000007783  ....................
ENSGACP00000008461  ....................
ENSGACP00000026457  ....................
ENSGACP00000002975  ....................
ENSGACP00000017143  ....................
ENSGACP00000002977  ....................
ENSGACP00000014230  ....................
ENSGACP00000001453  ....................
ENSGACP00000000474  ....................
ENSGACP00000017355  ....................
ENSGACP00000019246  ....................
ENSGACP00000024190  ....................
ENSGACP00000000065  ....................
ENSGACP00000009014  drcrnqfmv...........
ENSGACP00000027607  ....................
ENSGACP00000007942  ....................
ENSGACP00000022976  ryekfdkvltalsykleppv
ENSGACP00000021883  ....................
ENSGACP00000021889  ....................
ENSGACP00000019373  ....................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0041591 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila str. Lens
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]