SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Ankyrin repeat alignments in Heterocephalus glaber v1.7-2

These alignments are sequences aligned to the 0053922 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2fo1e1               espiklhteaagsyai..............................................................
HGL_H00000312988    gyv...........................................................................
HGL_H00000407057    ltplhvasfmghlpivknllqrgaspnasnvkve............................................
HGL_H00000280772    ltpihvaafmghvnivsqlmhhgaspnttnvrgetalhmaarsgqaevvrylvqdgaqveakakdd............
HGL_H00000349588    l.............................................................................
HGL_H00000281131    alcvpaskghasvvsllidrgaevdhcdkd................................................
HGL_H00000280772    nalhlaskeghvevvsellqreanvdaatkk...............................................
HGL_H00000407057    tkk...........................................................................
HGL_H00000306678    plhflvaqgsveqvrlllahevdvdcqtasgytplliaaqdqqpdlcalllthgadanlvdeddwaplhfaaqngddr
HGL_H00000282272    plvqaifsgdpeeirvlihktedvnaldsekr..............................................
HGL_H00000267116    plvqaifsrdveevrsllsqkeninvldqerrtplhaaayvgdvpilqlllmsganvnakdtlwltplhraaasrnek
HGL_H00000256707    palkallekckdvdernec...........................................................
HGL_H00000411147-2  ngh...........................................................................
HGL_H00000351416    esnh..........................................................................
HGL_H00000330161    dvdlvvdgsasllhlaveagqeecvkwlllnnanpnltnrk.....................................
HGL_H00000253810    esnhd.........................................................................
HGL_H00000351416    slaeacsegdvnavrklliegrsvnehteegesllclacsagyyelaqvllamhanvedrgikgd.............
HGL_H00000374171    nikvsrllilgganinyrtevlnnapilcvqshlgytemvalllefganvdasses......................
HGL_H00000373287    skdgktplhmtalhgrfsrsqtiiqsgavidcedkn..........................................
HGL_H00000262457    lnwqdye.......................................................................
HGL_H00000263635    nvkvsrllilaganvnyrtevlnnapilcvqshlgheeviilllefgacldgmsen......................
HGL_H00000386135    kaiihainddnvpglqhllgslsnydvnqpnkhg............................................
HGL_H00000373287    ..............................................................................
HGL_H00000267116    ehvlsagfdintpdnl..............................................................
HGL_H00000349588    p.............................................................................
HGL_H00000417980-1  q.............................................................................
HGL_H00000216797    dlaf..........................................................................
HGL_H00000369579    ldhrdkrgrtafhkaaehgqlealdflvgsgcdhsvrdke......................................
HGL_H00000373287    s.............................................................................
HGL_H00000345767    ..............................................................................
HGL_H00000311579    llqaareadlakvkktlaleiinfkqpqshe...............................................
HGL_H00000360689    ..............................................................................
HGL_H00000350297    ssaklnelleaiksrdllaliqvyaeg...................................................
HGL_H00000267116    rkrk..........................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000345065    talhfavggknfsavnfllnhkarvdiadkh...............................................
HGL_H00000282272    ..............................................................................
HGL_H00000281419    dsaaklhslcesvkaraifgllqayadgvdltekiplanghe....................................
HGL_H00000348081    wlswqvdtrnq...................................................................
HGL_H00000388725-2  nknddr........................................................................
HGL_H00000389168    kqkrneqlkrwigsetdleppvvkrqktkvk...............................................
HGL_H00000402044    p.............................................................................
HGL_H00000281131    keq...........................................................................
HGL_H00000353518    r.............................................................................
HGL_H00000217958-1  aysgklee......................................................................
HGL_H00000388725-1  nknddr........................................................................
HGL_H00000275015    ..............................................................................
HGL_H00000299824-1  feasv.........................................................................
HGL_H00000325355    ilavkngdvigvqklvakvkatktrppvpalaatghlpvctccgeavpqplclvpaqlsqepvgaevaedplrprgmv
HGL_H00000369434    d.............................................................................
HGL_H00000338769    acepqklqaaiynrdllsvleafasgqdfgqplpgpdgqap.....................................
HGL_H00000403397    iddystw.......................................................................
HGL_H00000226574    n.............................................................................
HGL_H00000349588    f.............................................................................
HGL_H00000382545-2  ..............................................................................
HGL_H00000328327-1  i.............................................................................
HGL_H00000356240    vfl...........................................................................
HGL_H00000301030    tkd...........................................................................
HGL_H00000391126-2  ia............................................................................
HGL_H00000351416    d.............................................................................
HGL_H00000417980-2  q.............................................................................
HGL_H00000333142    iscanstenee...................................................................
HGL_H00000411147-1  a.............................................................................
HGL_H00000160373    rp............................................................................
HGL_H00000350331-2  qlq...........................................................................
HGL_H00000345436    kk............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000378210    l.............................................................................
HGL_H00000304292-1  ciw...........................................................................
HGL_H00000314556    ddr...........................................................................
HGL_H00000263388    ..............................................................................
HGL_H00000260047    ..............................................................................
HGL_H00000342295    dltmvcqaasngdvnaltaviredpsileccdse............................................
HGL_H00000261537    e.............................................................................
HGL_H00000277541-1  m.............................................................................
HGL_H00000307298-2  qqggqrs.......................................................................
HGL_H00000386502    ..............................................................................
HGL_H00000347802    ..............................................................................
HGL_H00000296525    qgsw..........................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000262457    sslas.........................................................................
HGL_H00000256646    ..............................................................................
HGL_H00000400113    iv............................................................................
HGL_H00000277541-2  d.............................................................................
HGL_H00000274457-2  ek............................................................................
HGL_H00000262970    l.............................................................................
HGL_H00000401369    fwqavlagdvgsvsrilsdshtslapdsvfdtsdperwrdfryniralrlwsltyqeelttpl...............
HGL_H00000358983    ..............................................................................
HGL_H00000304586    ..............................................................................
HGL_H00000304292-2  vlvsskqk......................................................................
HGL_H00000360826    gne...........................................................................
HGL_H00000360762-1  k.............................................................................
HGL_H00000275699    aikqghilelqecmkykyaldeadekgwfplheavtqpvqqileiv................................
HGL_H00000325663    ..............................................................................
HGL_H00000339115    qd............................................................................
HGL_H00000364158    ..............................................................................
HGL_H00000417914    yivkgnrkeaariaeeiyggisd.......................................................
HGL_H00000306163    fl............................................................................
HGL_H00000337056    gdrls.........................................................................
HGL_H00000369855    y.............................................................................
HGL_H00000282272    d.............................................................................
HGL_H00000370259-3  kk............................................................................
HGL_H00000375690    htktglkkfl....................................................................
HGL_H00000164227    d.............................................................................
HGL_H00000263433    l.............................................................................
HGL_H00000391126-1  s.............................................................................
HGL_H00000357681    g.............................................................................
HGL_H00000360762-2  k.............................................................................
HGL_H00000357914-1  kr............................................................................
HGL_H00000284629-1  k.............................................................................
HGL_H00000320893    aairsfp.......................................................................
HGL_H00000217958-2  aysgkleelk....................................................................
HGL_H00000284629-2  ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000345193-1  tkanlkkfmdy...................................................................
HGL_H00000304292-2  idsvnalytrclhqllrdshlkvlakqeaqmtlmkqavemyvhhhiydlifkymgtmeasedaafnkitrslqdlqqk
HGL_H00000276925-1  ..............................................................................
HGL_H00000343362    plhkaikveredvvflyliemdsqlpgklnevdhngdlal......................................
HGL_H00000262209    vvfe..........................................................................
HGL_H00000217958-3  g.............................................................................
HGL_H00000343362    sntdapdt......................................................................
HGL_H00000276925-2  nrfgrrpiqv....................................................................
HGL_H00000320291    ll............................................................................
HGL_H00000262209    eikal.........................................................................
HGL_H00000321679    lemfl.........................................................................
HGL_H00000371734-2  ..............................................................................
HGL_H00000360689    r.............................................................................
HGL_H00000382545-1  k.............................................................................
HGL_H00000311579    r.............................................................................
HGL_H00000392839    fitkagdlas....................................................................
HGL_H00000252985    g.............................................................................
HGL_H00000392839    vd............................................................................
HGL_H00000217958-5  aysgkleelkesil................................................................
HGL_H00000303518-2  kdpn..........................................................................
HGL_H00000357914-2  kr............................................................................
HGL_H00000296785-1  ihqlaaqgemlylatrieq...........................................................
HGL_H00000405112-2  ..............................................................................
HGL_H00000349612    k.............................................................................
HGL_H00000260947    ly............................................................................
HGL_H00000403487    qc............................................................................
HGL_H00000415252    v.............................................................................
HGL_H00000398321    nglcclcpdavlgvqqtveemnferg....................................................
HGL_H00000305071    sihqlaaqge....................................................................
HGL_H00000379435    sllqpeeeeedidt................................................................
HGL_H00000262126    k.............................................................................
HGL_H00000264607    dhplehced.....................................................................
HGL_H00000303518-1  kl............................................................................
HGL_H00000331873    ..............................................................................
HGL_H00000274361    i.............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000414663-2  daipshl.......................................................................
HGL_H00000352358    rdelnllqqk....................................................................
HGL_H00000296785-2  hqlaaqgemly...................................................................
HGL_H00000215941-2  lrdsa.........................................................................
HGL_H00000352814    ..............................................................................
HGL_H00000386239    kw............................................................................
HGL_H00000320076    ..............................................................................
HGL_H00000328327-3  ..............................................................................
HGL_H00000360998    pi............................................................................
HGL_H00000351881    nv............................................................................
HGL_H00000265310    qdrdqqldeaymlqqkri............................................................
HGL_H00000294053    nkd...........................................................................
HGL_H00000274361    g.............................................................................
HGL_H00000340836-1  esi...........................................................................
HGL_H00000217958-4  nkln..........................................................................
HGL_H00000353796    k.............................................................................
HGL_H00000349140-1  cdke..........................................................................
HGL_H00000299234    l.............................................................................
HGL_H00000328327-2  ..............................................................................
HGL_H00000303570    t.............................................................................
HGL_H00000267339    fqd...........................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000368848    vkegq.........................................................................
HGL_H00000401089    gns...........................................................................
HGL_H00000350331-1  h.............................................................................
HGL_H00000265140    m.............................................................................
HGL_H00000414663-1  daipshl.......................................................................
HGL_H00000375751    lldssl........................................................................
HGL_H00000355827-2  ..............................................................................
HGL_H00000314103    h.............................................................................
HGL_H00000280758-2  nc............................................................................
HGL_H00000331065    dhirqgdleqv...................................................................
HGL_H00000378013    fgsdlqytnrvdkvvinpyfglgapdyskiqipkqekwqrsmssvtedkerqwvd.......................
HGL_H00000261312    hrqlidcirskdtdalidaidtga......................................................
HGL_H00000202556    l.............................................................................
HGL_H00000298992    cgrtdlisqaiealgpdg............................................................
HGL_H00000307541    na............................................................................
HGL_H00000349140-2  vefv..........................................................................
HGL_H00000371734-1  i.............................................................................
HGL_H00000370259-2  c.............................................................................
HGL_H00000324287    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000403902    ll............................................................................
HGL_H00000253810    seg...........................................................................
HGL_H00000384801    kk............................................................................
HGL_R00000013095    s.............................................................................
HGL_H00000277458    vase..........................................................................
HGL_H00000335147    dg............................................................................
HGL_H00000158762    ptmada........................................................................
HGL_H00000303518-3  ..............................................................................
HGL_H00000299824-2  i.............................................................................
HGL_H00000356685    pltkpaltgdveglqkifedpenph.....................................................
HGL_H00000240361    aq............................................................................
HGL_H00000265742    kalingdenlacqiyennpqlkesldpntsygep............................................
HGL_H00000320340    ..............................................................................
HGL_H00000308772    yhqaasdsylel..................................................................
HGL_H00000349041    avlrhfcvriapanifshsqtqr.......................................................
HGL_H00000378338    hisivkhlrhsawpptl.............................................................
HGL_H00000367705    vvlyclenki....................................................................
HGL_H00000396078    edhailqaviagdlmkliesy.........................................................
HGL_H00000419199    aikw..........................................................................
HGL_H00000385887    t.............................................................................
HGL_H00000396747    afv...........................................................................
HGL_M00000098100    rrvam.........................................................................
HGL_H00000365830    pgllakrdfi....................................................................
HGL_H00000407057    ts............................................................................
HGL_H00000350331-3  aq............................................................................
HGL_H00000368859    ne............................................................................
HGL_H00000347464    akdlskq.......................................................................
HGL_H00000274457-1  lwkyaldmqqnnldplspmtassllsfaelfsfmlqdrakgllgttvtfddlmgilcksvleieraikqtqcpadplq
HGL_H00000230792    f.............................................................................
HGL_H00000310447    ..............................................................................
HGL_H00000353732    nei...........................................................................
HGL_H00000305721    kgsenqika.....................................................................
HGL_H00000359982    y.............................................................................
HGL_H00000382659    mlnlhn........................................................................
HGL_H00000269856    gnfercihlwkyaldmqqmnleplspmtassflsfaelfsyvlqdraakgsqgtqigfadlmgvlgkgvreveralqm
HGL_H00000317379    ..............................................................................
HGL_H00000261740    diy...........................................................................
HGL_H00000386897    llr...........................................................................
HGL_H00000340913-2  fld...........................................................................
HGL_H00000378328    kv............................................................................
HGL_H00000386532    t.............................................................................
HGL_H00000261739    rdas..........................................................................
HGL_H00000215941-1  l.............................................................................
HGL_H00000334879    t.............................................................................
HGL_H00000380413    l.............................................................................
HGL_H00000368966    ld............................................................................
HGL_H00000328160    ql............................................................................
HGL_H00000262839    fln...........................................................................
HGL_H00000343362    v.............................................................................
HGL_H00000369003    nav...........................................................................
HGL_H00000232744    sd............................................................................
HGL_H00000419313    ntlnek........................................................................
HGL_H00000161863    vfhli.........................................................................
HGL_H00000402616-1  eaalh.........................................................................
HGL_M00000035452    qallqrhpgldvda................................................................
HGL_H00000416826    ktq...........................................................................
HGL_H00000373600    iy............................................................................
HGL_H00000321813    fr............................................................................
HGL_M00000056646    vdedkmtqwi....................................................................
HGL_H00000385887    elilk.........................................................................
HGL_H00000387907    vwdgwkeflmgcllgqklkvqrylskegpvlkyq............................................
HGL_H00000416826    pk............................................................................
HGL_N10020562       hvaakanhasiyqltletlen.........................................................
HGL_H00000350686    ynv...........................................................................
HGL_H00000321627    gn............................................................................
HGL_H00000386337    qlelwdvllaacragdirklrlqltagavdpevmsllnap......................................
HGL_H00000378871    ..............................................................................
HGL_N000000797401   l.............................................................................
HGL_H00000307298-1  hldp..........................................................................
HGL_H00000340913-1  a.............................................................................
HGL_H00000320509    ..............................................................................
HGL_H00000262547    rv............................................................................


                                                                                                    
                                                                                                    
d2fo1e1               ..............................................................................
HGL_H00000312988    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000306678    tarllldhgalvdaqehe............................................................
HGL_H00000282272    ..............................................................................
HGL_H00000267116    vlglllahsadvnardklwqtplhvaaanratkcaealapllsslnvadrs...........................
HGL_H00000256707    ..............................................................................
HGL_H00000411147-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000330161    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000374171    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000263635    ..............................................................................
HGL_H00000386135    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000417980-1  ..............................................................................
HGL_H00000216797    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000345767    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000350297    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000345065    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000348081    ..............................................................................
HGL_H00000388725-2  ..............................................................................
HGL_H00000389168    ..............................................................................
HGL_H00000402044    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000353518    ..............................................................................
HGL_H00000217958-1  ..............................................................................
HGL_H00000388725-1  ..............................................................................
HGL_H00000275015    ..............................................................................
HGL_H00000299824-1  ..............................................................................
HGL_H00000325355    gssslaprrgsmsttrml............................................................
HGL_H00000369434    ..............................................................................
HGL_H00000338769    ..............................................................................
HGL_H00000403397    ..............................................................................
HGL_H00000226574    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000382545-2  ..............................................................................
HGL_H00000328327-1  ..............................................................................
HGL_H00000356240    ..............................................................................
HGL_H00000301030    ..............................................................................
HGL_H00000391126-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000417980-2  ..............................................................................
HGL_H00000333142    ..............................................................................
HGL_H00000411147-1  ..............................................................................
HGL_H00000160373    ..............................................................................
HGL_H00000350331-2  ..............................................................................
HGL_H00000345436    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000378210    ..............................................................................
HGL_H00000304292-1  ..............................................................................
HGL_H00000314556    ..............................................................................
HGL_H00000263388    ..............................................................................
HGL_H00000260047    ..............................................................................
HGL_H00000342295    ..............................................................................
HGL_H00000261537    ..............................................................................
HGL_H00000277541-1  ..............................................................................
HGL_H00000307298-2  ..............................................................................
HGL_H00000386502    ..............................................................................
HGL_H00000347802    ..............................................................................
HGL_H00000296525    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000256646    ..............................................................................
HGL_H00000400113    ..............................................................................
HGL_H00000277541-2  ..............................................................................
HGL_H00000274457-2  ..............................................................................
HGL_H00000262970    ..............................................................................
HGL_H00000401369    ..............................................................................
HGL_H00000358983    ..............................................................................
HGL_H00000304586    ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000360826    ..............................................................................
HGL_H00000360762-1  ..............................................................................
HGL_H00000275699    ..............................................................................
HGL_H00000325663    ..............................................................................
HGL_H00000339115    ..............................................................................
HGL_H00000364158    ..............................................................................
HGL_H00000417914    ..............................................................................
HGL_H00000306163    ..............................................................................
HGL_H00000337056    ..............................................................................
HGL_H00000369855    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000370259-3  ..............................................................................
HGL_H00000375690    ..............................................................................
HGL_H00000164227    ..............................................................................
HGL_H00000263433    ..............................................................................
HGL_H00000391126-1  ..............................................................................
HGL_H00000357681    ..............................................................................
HGL_H00000360762-2  ..............................................................................
HGL_H00000357914-1  ..............................................................................
HGL_H00000284629-1  ..............................................................................
HGL_H00000320893    ..............................................................................
HGL_H00000217958-2  ..............................................................................
HGL_H00000284629-2  ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000345193-1  ..............................................................................
HGL_H00000304292-2  digvkpefsgsgghqldmvtteelqgtgkgdvtrasalqhpsckeragsaeqmllapaeaallaksgtahytvsqper
HGL_H00000276925-1  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000217958-3  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000276925-2  ..............................................................................
HGL_H00000320291    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000321679    ..............................................................................
HGL_H00000371734-2  ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000382545-1  ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000252985    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000217958-5  ..............................................................................
HGL_H00000303518-2  ..............................................................................
HGL_H00000357914-2  ..............................................................................
HGL_H00000296785-1  ..............................................................................
HGL_H00000405112-2  ..............................................................................
HGL_H00000349612    ..............................................................................
HGL_H00000260947    ..............................................................................
HGL_H00000403487    ..............................................................................
HGL_H00000415252    ..............................................................................
HGL_H00000398321    ..............................................................................
HGL_H00000305071    ..............................................................................
HGL_H00000379435    ..............................................................................
HGL_H00000262126    ..............................................................................
HGL_H00000264607    ..............................................................................
HGL_H00000303518-1  ..............................................................................
HGL_H00000331873    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000414663-2  ..............................................................................
HGL_H00000352358    ..............................................................................
HGL_H00000296785-2  ..............................................................................
HGL_H00000215941-2  ..............................................................................
HGL_H00000352814    ..............................................................................
HGL_H00000386239    ..............................................................................
HGL_H00000320076    ..............................................................................
HGL_H00000328327-3  ..............................................................................
HGL_H00000360998    ..............................................................................
HGL_H00000351881    ..............................................................................
HGL_H00000265310    ..............................................................................
HGL_H00000294053    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000340836-1  ..............................................................................
HGL_H00000217958-4  ..............................................................................
HGL_H00000353796    ..............................................................................
HGL_H00000349140-1  ..............................................................................
HGL_H00000299234    ..............................................................................
HGL_H00000328327-2  ..............................................................................
HGL_H00000303570    ..............................................................................
HGL_H00000267339    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000368848    ..............................................................................
HGL_H00000401089    ..............................................................................
HGL_H00000350331-1  ..............................................................................
HGL_H00000265140    ..............................................................................
HGL_H00000414663-1  ..............................................................................
HGL_H00000375751    ..............................................................................
HGL_H00000355827-2  ..............................................................................
HGL_H00000314103    ..............................................................................
HGL_H00000280758-2  ..............................................................................
HGL_H00000331065    ..............................................................................
HGL_H00000378013    ..............................................................................
HGL_H00000261312    ..............................................................................
HGL_H00000202556    ..............................................................................
HGL_H00000298992    ..............................................................................
HGL_H00000307541    ..............................................................................
HGL_H00000349140-2  ..............................................................................
HGL_H00000371734-1  ..............................................................................
HGL_H00000370259-2  ..............................................................................
HGL_H00000324287    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000403902    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000384801    ..............................................................................
HGL_R00000013095    ..............................................................................
HGL_H00000277458    ..............................................................................
HGL_H00000335147    ..............................................................................
HGL_H00000158762    ..............................................................................
HGL_H00000303518-3  ..............................................................................
HGL_H00000299824-2  ..............................................................................
HGL_H00000356685    ..............................................................................
HGL_H00000240361    ..............................................................................
HGL_H00000265742    ..............................................................................
HGL_H00000320340    ..............................................................................
HGL_H00000308772    ..............................................................................
HGL_H00000349041    ..............................................................................
HGL_H00000378338    ..............................................................................
HGL_H00000367705    ..............................................................................
HGL_H00000396078    ..............................................................................
HGL_H00000419199    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000396747    ..............................................................................
HGL_M00000098100    ..............................................................................
HGL_H00000365830    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000350331-3  ..............................................................................
HGL_H00000368859    ..............................................................................
HGL_H00000347464    ..............................................................................
HGL_H00000274457-1  lnkalsiilhlicllekvpctveqdhfkk.................................................
HGL_H00000230792    ..............................................................................
HGL_H00000310447    ..............................................................................
HGL_H00000353732    ..............................................................................
HGL_H00000305721    ..............................................................................
HGL_H00000359982    ..............................................................................
HGL_H00000382659    ..............................................................................
HGL_H00000269856    pkepgdsaqftkalaiilhllyllgkvecspsqehlkhqtvyrl..................................
HGL_H00000317379    ..............................................................................
HGL_H00000261740    ..............................................................................
HGL_H00000386897    ..............................................................................
HGL_H00000340913-2  ..............................................................................
HGL_H00000378328    ..............................................................................
HGL_H00000386532    ..............................................................................
HGL_H00000261739    ..............................................................................
HGL_H00000215941-1  ..............................................................................
HGL_H00000334879    ..............................................................................
HGL_H00000380413    ..............................................................................
HGL_H00000368966    ..............................................................................
HGL_H00000328160    ..............................................................................
HGL_H00000262839    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000369003    ..............................................................................
HGL_H00000232744    ..............................................................................
HGL_H00000419313    ..............................................................................
HGL_H00000161863    ..............................................................................
HGL_H00000402616-1  ..............................................................................
HGL_M00000035452    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_H00000373600    ..............................................................................
HGL_H00000321813    ..............................................................................
HGL_M00000056646    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000387907    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_N10020562       ..............................................................................
HGL_H00000350686    ..............................................................................
HGL_H00000321627    ..............................................................................
HGL_H00000386337    ..............................................................................
HGL_H00000378871    ..............................................................................
HGL_N000000797401   ..............................................................................
HGL_H00000307298-1  ..............................................................................
HGL_H00000340913-1  ..............................................................................
HGL_H00000320509    ..............................................................................
HGL_H00000262547    ..............................................................................


                                                                                                    
                                                                                                    
d2fo1e1               ......................................................................--------
HGL_H00000312988    ......................................................................--------
HGL_H00000407057    ......................................................................--TPLHMA
HGL_H00000280772    ......................................................................-QTPLHIS
HGL_H00000349588    ......................................................................--TPIHVA
HGL_H00000281131    ......................................................................GMTPLLVA
HGL_H00000280772    ......................................................................GNTALHIA
HGL_H00000407057    ......................................................................GNTALHIA
HGL_H00000306678    ......................................................................GWTPLHLA
HGL_H00000282272    ......................................................................--TPLHVA
HGL_H00000267116    ......................................................................GRSALHHA
HGL_H00000256707    ......................................................................GQTPLMIA
HGL_H00000411147-2  ......................................................................---SLINA
HGL_H00000351416    ......................................................................-DTALTLA
HGL_H00000330161    ......................................................................GSTPLHVA
HGL_H00000253810    ......................................................................--TALTLA
HGL_H00000351416    ......................................................................-ITPLMAA
HGL_H00000374171    ......................................................................GLTPLGYA
HGL_H00000373287    ......................................................................GNTPLHIA
HGL_H00000262457    ......................................................................GRTPLHFA
HGL_H00000263635    ......................................................................GMTALCYA
HGL_H00000386135    ......................................................................-TPPLLIA
HGL_H00000373287    ......................................................................--TPIHAA
HGL_H00000267116    ......................................................................GRTCLHAA
HGL_H00000349588    ......................................................................---ALHIA
HGL_H00000417980-1  ......................................................................----LYFS
HGL_H00000216797    ......................................................................--------
HGL_H00000369579    ......................................................................GNTALHLA
HGL_H00000373287    ......................................................................----LVQA
HGL_H00000345767    ......................................................................----LLIA
HGL_H00000311579    ......................................................................--TALHCA
HGL_H00000360689    ......................................................................----LLQA
HGL_H00000350297    ......................................................................--------
HGL_H00000267116    ......................................................................-WTPLHAA
HGL_H00000360689    ......................................................................----LFEA
HGL_H00000311579    ......................................................................----LLEA
HGL_H00000345065    ......................................................................GLTAIHLA
HGL_H00000282272    ......................................................................--TPLHAS
HGL_H00000281419    ......................................................................--------
HGL_H00000348081    ......................................................................GRTALQVA
HGL_H00000388725-2  ......................................................................--------
HGL_H00000389168    ......................................................................--------
HGL_H00000402044    ......................................................................----VLKA
HGL_H00000281131    ......................................................................--------
HGL_H00000353518    ......................................................................--------
HGL_H00000217958-1  ......................................................................--------
HGL_H00000388725-1  ......................................................................--------
HGL_H00000275015    ......................................................................--------
HGL_H00000299824-1  ......................................................................--------
HGL_H00000325355    ......................................................................--------
HGL_H00000369434    ......................................................................--TLLHCA
HGL_H00000338769    ......................................................................--------
HGL_H00000403397    ......................................................................--------
HGL_H00000226574    ......................................................................--------
HGL_H00000349588    ......................................................................-----LRA
HGL_H00000382545-2  ......................................................................-----FWA
HGL_H00000328327-1  ......................................................................-----QAA
HGL_H00000356240    ......................................................................--------
HGL_H00000301030    ......................................................................--------
HGL_H00000391126-2  ......................................................................--------
HGL_H00000351416    ......................................................................--------
HGL_H00000417980-2  ......................................................................----LYLS
HGL_H00000333142    ......................................................................GCTPLHLA
HGL_H00000411147-1  ......................................................................-WSRLLQA
HGL_H00000160373    ......................................................................--------
HGL_H00000350331-2  ......................................................................--------
HGL_H00000345436    ......................................................................--------
HGL_H00000343362    ......................................................................--TLLHRA
HGL_H00000378210    ......................................................................-------A
HGL_H00000304292-1  ......................................................................--------
HGL_H00000314556    ......................................................................--------
HGL_H00000263388    ......................................................................--------
HGL_H00000260047    ......................................................................----IHDA
HGL_H00000342295    ......................................................................GCTPLMHA
HGL_H00000261537    ......................................................................----LVKA
HGL_H00000277541-1  ......................................................................--------
HGL_H00000307298-2  ......................................................................--TPLIIA
HGL_H00000386502    ......................................................................--------
HGL_H00000347802    ......................................................................--------
HGL_H00000296525    ......................................................................--------
HGL_H00000274457-1  ......................................................................--TAVFNA
HGL_H00000262457    ......................................................................---QVHAA
HGL_H00000256646    ......................................................................--------
HGL_H00000400113    ......................................................................--------
HGL_H00000277541-2  ......................................................................--------
HGL_H00000274457-2  ......................................................................--------
HGL_H00000262970    ......................................................................--------
HGL_H00000401369    ......................................................................-------H
HGL_H00000358983    ......................................................................--------
HGL_H00000304586    ......................................................................--------
HGL_H00000304292-2  ......................................................................--------
HGL_H00000360826    ......................................................................--------
HGL_H00000360762-1  ......................................................................--------
HGL_H00000275699    ......................................................................-----LDA
HGL_H00000325663    ......................................................................--------
HGL_H00000339115    ......................................................................--------
HGL_H00000364158    ......................................................................--------
HGL_H00000417914    ......................................................................--------
HGL_H00000306163    ......................................................................--------
HGL_H00000337056    ......................................................................--------
HGL_H00000369855    ......................................................................--------
HGL_H00000282272    ......................................................................--------
HGL_H00000370259-3  ......................................................................--------
HGL_H00000375690    ......................................................................--------
HGL_H00000164227    ......................................................................--------
HGL_H00000263433    ......................................................................--------
HGL_H00000391126-1  ......................................................................--------
HGL_H00000357681    ......................................................................--------
HGL_H00000360762-2  ......................................................................--------
HGL_H00000357914-1  ......................................................................--------
HGL_H00000284629-1  ......................................................................--------
HGL_H00000320893    ......................................................................--------
HGL_H00000217958-2  ......................................................................--------
HGL_H00000284629-2  ......................................................................--------
HGL_H00000269856    ......................................................................--TAVYNA
HGL_H00000345193-1  ......................................................................--------
HGL_H00000304292-2  manlsyiknfrfsssakdelgycltsveaaieyirqgslsikppesegfddrlflkqrmsllsqmtstpi--DCLFKH
HGL_H00000276925-1  ......................................................................--------
HGL_H00000343362    ......................................................................-----DLA
HGL_H00000262209    ......................................................................--------
HGL_H00000217958-3  ......................................................................--------
HGL_H00000343362    ......................................................................--------
HGL_H00000276925-2  ......................................................................--------
HGL_H00000320291    ......................................................................------H-
HGL_H00000262209    ......................................................................--------
HGL_H00000321679    ......................................................................--------
HGL_H00000371734-2  ......................................................................--------
HGL_H00000360689    ......................................................................--------
HGL_H00000382545-1  ......................................................................--------
HGL_H00000311579    ......................................................................--------
HGL_H00000392839    ......................................................................--------
HGL_H00000252985    ......................................................................--------
HGL_H00000392839    ......................................................................GLSALHLA
HGL_H00000217958-5  ......................................................................--------
HGL_H00000303518-2  ......................................................................--------
HGL_H00000357914-2  ......................................................................--------
HGL_H00000296785-1  ......................................................................--------
HGL_H00000405112-2  ......................................................................--------
HGL_H00000349612    ......................................................................--------
HGL_H00000260947    ......................................................................--------
HGL_H00000403487    ......................................................................--------
HGL_H00000415252    ......................................................................--------
HGL_H00000398321    ......................................................................--------
HGL_H00000305071    ......................................................................--------
HGL_H00000379435    ......................................................................--------
HGL_H00000262126    ......................................................................--------
HGL_H00000264607    ......................................................................--TRLHDA
HGL_H00000303518-1  ......................................................................--------
HGL_H00000331873    ......................................................................--------
HGL_H00000274361    ......................................................................--------
HGL_H00000282272    ......................................................................--------
HGL_H00000414663-2  ......................................................................--------
HGL_H00000352358    ......................................................................--------
HGL_H00000296785-2  ......................................................................--------
HGL_H00000215941-2  ......................................................................--------
HGL_H00000352814    ......................................................................--------
HGL_H00000386239    ......................................................................--------
HGL_H00000320076    ......................................................................--------
HGL_H00000328327-3  ......................................................................--------
HGL_H00000360998    ......................................................................--------
HGL_H00000351881    ......................................................................--------
HGL_H00000265310    ......................................................................--------
HGL_H00000294053    ......................................................................--------
HGL_H00000274361    ......................................................................--------
HGL_H00000340836-1  ......................................................................--------
HGL_H00000217958-4  ......................................................................--------
HGL_H00000353796    ......................................................................--------
HGL_H00000349140-1  ......................................................................--------
HGL_H00000299234    ......................................................................--------
HGL_H00000328327-2  ......................................................................--------
HGL_H00000303570    ......................................................................--------
HGL_H00000267339    ......................................................................--------
HGL_H00000369579    ......................................................................--------
HGL_H00000368848    ......................................................................--------
HGL_H00000401089    ......................................................................--------
HGL_H00000350331-1  ......................................................................--------
HGL_H00000265140    ......................................................................--------
HGL_H00000414663-1  ......................................................................--------
HGL_H00000375751    ......................................................................--------
HGL_H00000355827-2  ......................................................................--------
HGL_H00000314103    ......................................................................--------
HGL_H00000280758-2  ......................................................................--------
HGL_H00000331065    ......................................................................--------
HGL_H00000378013    ......................................................................--------
HGL_H00000261312    ......................................................................--------
HGL_H00000202556    ......................................................................--------
HGL_H00000298992    ......................................................................--------
HGL_H00000307541    ......................................................................--------
HGL_H00000349140-2  ......................................................................--------
HGL_H00000371734-1  ......................................................................--------
HGL_H00000370259-2  ......................................................................--------
HGL_H00000324287    ......................................................................--------
HGL_H00000346733    ......................................................................--------
HGL_H00000403902    ......................................................................--------
HGL_H00000253810    ......................................................................--------
HGL_H00000384801    ......................................................................--------
HGL_R00000013095    ......................................................................--------
HGL_H00000277458    ......................................................................--------
HGL_H00000335147    ......................................................................--------
HGL_H00000158762    ......................................................................--------
HGL_H00000303518-3  ......................................................................--------
HGL_H00000299824-2  ......................................................................--------
HGL_H00000356685    ......................................................................--------
HGL_H00000240361    ......................................................................--------
HGL_H00000265742    ......................................................................--------
HGL_H00000320340    ......................................................................--------
HGL_H00000308772    ......................................................................--------
HGL_H00000349041    ......................................................................--------
HGL_H00000378338    ......................................................................--------
HGL_H00000367705    ......................................................................--------
HGL_H00000396078    ......................................................................--------
HGL_H00000419199    ......................................................................--------
HGL_H00000385887    ......................................................................--------
HGL_H00000396747    ......................................................................--------
HGL_M00000098100    ......................................................................--------
HGL_H00000365830    ......................................................................--------
HGL_H00000407057    ......................................................................----FLRA
HGL_H00000350331-3  ......................................................................--------
HGL_H00000368859    ......................................................................--------
HGL_H00000347464    ......................................................................--------
HGL_H00000274457-1  ......................................................................--------
HGL_H00000230792    ......................................................................--------
HGL_H00000310447    ......................................................................--------
HGL_H00000353732    ......................................................................--------
HGL_H00000305721    ......................................................................--------
HGL_H00000359982    ......................................................................--------
HGL_H00000382659    ......................................................................--------
HGL_H00000269856    ......................................................................--------
HGL_H00000317379    ......................................................................--------
HGL_H00000261740    ......................................................................--------
HGL_H00000386897    ......................................................................--------
HGL_H00000340913-2  ......................................................................--------
HGL_H00000378328    ......................................................................--------
HGL_H00000386532    ......................................................................--------
HGL_H00000261739    ......................................................................--------
HGL_H00000215941-1  ......................................................................--------
HGL_H00000334879    ......................................................................--------
HGL_H00000380413    ......................................................................--------
HGL_H00000368966    ......................................................................--------
HGL_H00000328160    ......................................................................--------
HGL_H00000262839    ......................................................................--------
HGL_H00000343362    ......................................................................--------
HGL_H00000369003    ......................................................................--------
HGL_H00000232744    ......................................................................--------
HGL_H00000419313    ......................................................................--------
HGL_H00000161863    ......................................................................--------
HGL_H00000402616-1  ......................................................................--------
HGL_M00000035452    ......................................................................--------
HGL_H00000416826    ......................................................................--------
HGL_H00000373600    ......................................................................--------
HGL_H00000321813    ......................................................................--------
HGL_M00000056646    ......................................................................--------
HGL_H00000385887    ......................................................................--------
HGL_H00000387907    ......................................................................--------
HGL_H00000416826    ......................................................................--------
HGL_N10020562       ......................................................................--------
HGL_H00000350686    ......................................................................--------
HGL_H00000321627    ......................................................................--------
HGL_H00000386337    ......................................................................--------
HGL_H00000378871    ......................................................................--------
HGL_N000000797401   ......................................................................--------
HGL_H00000307298-1  ......................................................................--------
HGL_H00000340913-1  ......................................................................--------
HGL_H00000320509    ......................................................................--------
HGL_H00000262547    ......................................................................--------


                      10           20                           30        40                       5
                       |            |                            |         |                        
d2fo1e1               ---...-----TEPITRE....SVNII...D............PRHNRTVLHWIASNS...............SAEKS
HGL_H00000312988    ---...------------....-----...-............TEDGDTALHLAVIHQ...............HEPFL
HGL_H00000407057    ARA...GHTEVAKYLLQN....KAKVNa..K............AKDDQTPLHCAARVG...............HTNMA
HGL_H00000280772    ARL...GKADIVQQLLQQ....GASPNa..A............TTSGYTPLHLSAREG...............HEDVA
HGL_H00000349588    AFM...GHLNIVLLLLQN....GASPDv..T............NIRGETALHMAARAG...............QVEVV
HGL_H00000281131    AYE...GHVDVVDLLLEG....GADVDh..T............DNNGRTPLLAAASMG...............HASVV
HGL_H00000280772    SLA...GQAEVVKVLVTN....GANVNa..Q............SQNGFTPLYMAAQEN...............HLEVV
HGL_H00000407057    ALA...GQNEVVRELVNY....GANVNa..Q............SQKGFTPLYMAAQEN...............HLEVV
HGL_H00000306678    TQN...NFENVARLLVSR....HADPNl..R............EAEGKTPLHVAAYFG...............HVSLV
HGL_H00000282272    AFL...GDAEIIELLILS....GARVNa..K............DNMWLTPLHRAVASR...............SEEAV
HGL_H00000267116    VHS...------------....-----...-............--------------G...............HLE--
HGL_H00000256707    AEQ...GNLEIVKELIKN....GANCNl..E............DLDNWTALISASKEG...............HLHIV
HGL_H00000411147-2  VKN...KDVNQIEQLLKI....GASVNfq.E............EEGGWTPLHNAVQGG...............SKDIV
HGL_H00000351416    CAG...GHEELVQTLLER....GASIEh..R............DKKGFTPLILAATAG...............HVGVV
HGL_H00000330161    VER...RARAVVELLLAR....KSSVNt..K............DEDQWTALHFAAQNG...............DESST
HGL_H00000253810    CAG...GHEELVSVLIAR....DAKIEh..R............DKKGFTPLILAATAG...............HVGVV
HGL_H00000351416    ANG...GHVKIVKLLLAH....KADVNa..Q............SSTGNTALTYACAGG...............YVDVV
HGL_H00000374171    AAA...GFLSIVVLLCKK....RAKVDh..L............DKNGQCALVHAALRG...............HLEVV
HGL_H00000373287    ARY...GHELLINTLITS....GADTAk..R............GIHGMFPLHLAALSG...............FSDCC
HGL_H00000262457    VAD...GNVTVVDVLTSYe...SCNITs..Y............DNLFRTPLHWAALLG...............HAQIV
HGL_H00000263635    AAA...GHMKLVCLLIKK....GAKVDh..L............DKKGQCALVHSALRG...............HGDIL
HGL_H00000386135    AGC...GNIQILQLLLKR....GSRIDv..Q............DKGGSNAVYWASRHG...............HVDTL
HGL_H00000373287    ATN...GHSECLRLLIGNaep.QNAVDi..Q............DGNGQTPLMLSVLNG...............HTDCV
HGL_H00000267116    ASG...GNVECLNLLLSS....GADLRr..R............DKFGRTPLHYAAANG...............SYQCA
HGL_H00000349588    ARK...DDTKSAALLLQN....DHNADv..Qskmmvnrt....TESGFTPLHIAAHYG...............NVNVA
HGL_H00000417980-1  ARQ...GELQKVLLMLVD....GIDPNfkmE............HQNKRSPLHAAAEAG...............HVDIC
HGL_H00000216797    ---...------------....-----...-............---------------...............-----
HGL_H00000369579    AGQ...GHTAVLQRLVDI....GLDLEe..Q............NAEGLTALHAAAEGT...............HPDCV
HGL_H00000373287    IFN...GDPDEVRALIFK....KEDVNf..Q............DNEKRTPLHAAAYLG...............DAEII
HGL_H00000345767    AYK...GQAENVVQLINK....GAKVA...V............TKHGRTPLHLAANKG...............HLSVV
HGL_H00000311579    VASlhpKRKQVTELLLRK....GANVNe..K............NKDFMTPLHVAAERA...............HNDVM
HGL_H00000360689    ARE...ADVTRIKKHLSLe...MVNFK...H............PQTHETALHCAAGSPypk............RKQIC
HGL_H00000350297    ---...------------....-----...-............---------------...............-----
HGL_H00000267116    AAS...GHTDSLHLLIDSge..RADITdv.M............DAYGQTPLMLAIMNG...............HVDCV
HGL_H00000360689    CRN...GDVERVKRLVTPe...KVNSRd..T............AGRKSTPLHFAAGFG...............RKDVV
HGL_H00000311579    CRN...GDVSRVKRLVDAa...NVNAKd..M............AGRKSSPLHFAAGFG...............RKDVV
HGL_H00000345065    AWS...GSFEIMLMLVKA....GADQRa..T............SQDGWNALHFAAQSN...............SVHIV
HGL_H00000282272    VIN...GHTLCLRLLLEMsd..NPEVVdv.K............DAKGQTPLMLAVAYG...............HIDAV
HGL_H00000281419    ---...------------....-----...-............---------------...............-----
HGL_H00000348081    TYL...GQLELVHLLLQA....QADVDl..L............DEEGNTALHYAALGN...............QPEAA
HGL_H00000388725-2  ---...------------....-----...-............-------LLQAVENG...............DVEKV
HGL_H00000389168    ---...------------....-----...-............-FDDGAVFLAACSSG...............DTDEV
HGL_H00000402044    IKE...GNEEALKAMIKD....GKNLGe..P............NKEGWLPLHEAAYYG...............QLGCL
HGL_H00000281131    ---...---EVLQLLVKA....GAHVNs..E............D--DRTSCIVRQALE...............REDSI
HGL_H00000353518    ---...------------....GPNVNc..V............DSTGYTPLHHAALNG...............HKDVV
HGL_H00000217958-1  ---...------------....-----...-............---------------...............----L
HGL_H00000388725-1  ---...------------....-----...-............-------LLQAVENG...............DVEKV
HGL_H00000275015    ---...------------....-----...-............--DGDTLVHLAVIHE...............APDVL
HGL_H00000299824-1  ---...------------....-----...-............------ALLEASLRN...............DTEEV
HGL_H00000325355    ---...------MELLGStk..RLNVNy..Q............DADGFSALHHAALGG...............SLELI
HGL_H00000369434    ARH...GRLDILAYLVEAw...GMDIEa..A............NRDYKRPLHEAASMG...............HRDCV
HGL_H00000338769    ---...------------....-----...-............---------------...............-----
HGL_H00000403397    ---...------------....-----...-............------DIIKATQYG...............IYERC
HGL_H00000226574    ---...------------....-----...-............---GDSILHLAVIHL...............HAQLV
HGL_H00000349588    ARA...GNLDKVVEYLKG....GIDINt..C............NQNGLNALHLAAKEG...............HVGLV
HGL_H00000382545-2  ARR...GNLALLKLLLNSg...RVDVDc..R............DSHGTTLLMVASYAG...............HIDCV
HGL_H00000328327-1  VAA...GDVHTVRKMLEQ....GYSPNg..R............DANGWTLLHFSAARG...............KERCV
HGL_H00000356240    ---...------------....-----...-............---------AACSSG...............DTEEV
HGL_H00000301030    ---...------------....--KVNk..R............NERGETRLHRAAIRG...............DARRI
HGL_H00000391126-2  ---...------------....-----...-............-------LLEAAARN...............DLEEV
HGL_H00000351416    ---...------------....-----...-............--EGYTPLMEAAREG...............HEEMV
HGL_H00000417980-2  VKQ...GELQKVILMLLD....NLDPNfqsD............QQSKRTPLHAAAQKG...............SVEIC
HGL_H00000333142    CRK...GDGEILVELVQYc...HAQMDv..T............DSKGETAFHYAVQGD...............SSQVL
HGL_H00000411147-1  VCC...GSPGLVMQLLRK....GASIEe..R............DGMGRTPLHLAVLRG...............HAPLL
HGL_H00000160373    ---...------------....-----...-............-----TLLQQAAAQG...............NVTLL
HGL_H00000350331-2  ---...------------....-----...-............---------------...............-----
HGL_H00000345436    ---...------------....-INVNf..Q............DPDGFSALHHAALNG...............NTELI
HGL_H00000343362    IDE...NNESTACFLIRS....GCDVNs..PrqpgadgegeeeARDGQTPLHLAASWG...............LEETV
HGL_H00000378210    VRE...DNVKILRKLLKK....GRSIDv..A............DNRGWMPIHEAAYHN...............SIECL
HGL_H00000304292-1  ---...-----------R....GPNVNc..T............DSSGYTALHHAALNG...............HKDIV
HGL_H00000314556    ---...------------....-----...-............-------LMKAAERG...............DVEKV
HGL_H00000263388    ---...------------....GMDVNv..R............GPDGFTPLMLASFCGgalepvpa.......EEEEV
HGL_H00000260047    VRA...GDIKQLSEMVER....GASINev.D............VLHKFTPLHWAAHSG...............SLEAL
HGL_H00000342295    VSG...RQVDTVKLLLKM....GANINm..Q............DAYGRTSLCLATYLG...............WLEGC
HGL_H00000261537    AAN...GDVAKVEDLLKRp...DVDVN...G............QCAGHTAMQAASQNG...............HVDIL
HGL_H00000277541-1  ---...------------....--DVNv..R............GPDGFTPLMIASCSGggletgnseeeed..A----
HGL_H00000307298-2  ARN...GHAKVVRLLLEHy...RVQTQq..Tgtvrfdgy....VIDGATALWCAAGAG...............HFEVV
HGL_H00000386502    ---...------------....-----...-............---------------...............-----
HGL_H00000347802    ---...------------....-----...-............---------------...............-----
HGL_H00000296525    ---...------------....-----...-............--ADRSPLHEVASQG...............RLLAL
HGL_H00000274457-1  ARD...GKLRLLTKLLAS....KSKEEv..Splsse.......KTNGATPLSMAARYG...............HLDVV
HGL_H00000262457    AVN...GDKGTLQRLIIGn...SALKDk..E............DQFGRTPLMYCMLAD...............RLDCA
HGL_H00000256646    ---...------------....--DVNv..R............GPDGCTPLMLASLRGgssdmsdededgedsSANII
HGL_H00000400113    ---...------------....-----...-............---------KATQYG...............IFERC
HGL_H00000277541-2  ---...------------....---VDt..F............GPDGGTPLMSAVCCG...............AVASR
HGL_H00000274457-2  ---...------------....-----...-............-TNGATPLLMAARYG...............HLNMV
HGL_H00000262970    ---...------------....-----...-............--------LQAVENN...............DSARV
HGL_H00000401369    VXR...GHTEVLQLLLRR....RAQPD...S............APGGRTALHEACAAG...............HTACV
HGL_H00000358983    ---...------------....-----...-............--------HLAIIHG...............QAAVT
HGL_H00000304586    ---...------------....-----...-............---------------...............-----
HGL_H00000304292-2  ---...------------....--DPK...K............DYREVEKLLRAVADG...............DLEMV
HGL_H00000360826    ---...------------....-----...-............---------------...............-----
HGL_H00000360762-1  ---...------------....-----...-............---------------...............-----
HGL_H00000275699    VKK...GSFDMVSALIKH....NTSLDq..P............CVKRWSAMHEAAKQG...............RKDII
HGL_H00000325663    ---...------------....-----...-............--DGDTFLHIAVAQG...............RRALS
HGL_H00000339115    ---...------------....-----...R............DASGISPLHLAARFG...............HPALV
HGL_H00000364158    ---...------------....-----...-............--------------G...............HVSVA
HGL_H00000417914    ---...------------....-----...-............CWADRSPLHEAAAQG...............RLLAL
HGL_H00000306163    ---...------------....-----...-............---------------...............-----
HGL_H00000337056    ---...------------....-----...-............---------------...............-----
HGL_H00000369855    ---...------------....-----...-............----WSPVHEAAIHG...............RLFYL
HGL_H00000282272    ---...------------....-----...-............---GKSPLHMTAVHG...............RFTRS
HGL_H00000370259-3  ---...------------....-----...-............---------------...............-----
HGL_H00000375690    ---...------------....-----...-............---------EYVQLG...............TSDKV
HGL_H00000164227    ---...------------....-----...-............---------------...............-----
HGL_H00000263433    ---...------------....-----...-............---------------...............-----
HGL_H00000391126-1  ---...------------....-----...-............----WSTLDTCARYD...............NSFIA
HGL_H00000357681    ---...------------....-----...-............---------------...............-----
HGL_H00000360762-2  ---...------------....-----...-............---------------...............-----
HGL_H00000357914-1  ---...------------....-----...-............---------------...............-----
HGL_H00000284629-1  ---...------------....-----...-............---------------...............-----
HGL_H00000320893    ---...------------....-----...-............---------------...............-----
HGL_H00000217958-2  ---...------------....-----...-............---------------...............-----
HGL_H00000284629-2  ---...------------....-----...-............---------------...............-----
HGL_H00000269856    AHD...GKLQLLQKLLSGrsreELDELmg.E............VTTGGTPLLIAARYG...............HLDVV
HGL_H00000345193-1  ---...------------....-----...-............-----------VQLH...............STDKV
HGL_H00000304292-2  IAS...GNQKEVERLLSQe...DHDKD...A............VQKMCHPLCFCDDCE...............KL--V
HGL_H00000276925-1  ---...------------....-----...-............---------------...............-----
HGL_H00000343362    LSR...RLESIATTLVSH....KADVDm..V............DKNGWSLLHKGIQRG...............DVFAS
HGL_H00000262209    ---...GNKCRLQHFVKN....RWKLN...-............---------------...............-----
HGL_H00000217958-3  ---...-NQSHIRALMLK....GLCPSl..L............TRNGFTALHLAVYK-...............---AP
HGL_H00000343362    ---...------------....-----...-............-VTGNCLLQRAAGAG...............NEAAA
HGL_H00000276925-2  ---...------------....-----...-............---------------...............-----
HGL_H00000320291    ---...------------....-----...-............----------HARNG...............NAEEV
HGL_H00000262209    ---...------------....-----...-............---------------...............-----
HGL_H00000321679    ---...------------....-----...-............---------------...............-----
HGL_H00000371734-2  ---...------------....-----...-............---------------...............-----
HGL_H00000360689    ---...------------....-----...-............---------------...............-----
HGL_H00000382545-1  ---...------------....-----...-............---------------...............-----
HGL_H00000311579    ---...------------....-----...-............---------------...............-----
HGL_H00000392839    ---...------------....-----...-............---------------...............-----
HGL_H00000252985    ---...------------....-----...-............----DTLLHLFAARG...............LRWAA
HGL_H00000392839    SVS...NDVDMVSFLLEL....GAHPDv..Q............DHKGCTPTMRAAELG...............HELSM
HGL_H00000217958-5  ---...------------....-----...-............---------------...............-----
HGL_H00000303518-2  ---...------------....-----...-............---------------...............-----
HGL_H00000357914-2  ---...------------....-----...-............---------------...............-----
HGL_H00000296785-1  ---...------------....-----...-............---------------...............-----
HGL_H00000405112-2  ---...------------....-----...-............---------------...............-----
HGL_H00000349612    ---...------------....-----...-............-------LHKAASVG...............DTGKM
HGL_H00000260947    ---...------------....-----...-............---------------...............-----
HGL_H00000403487    ---...------------....-----...-............---------------...............-----
HGL_H00000415252    ---...------------....-----...-............---------------...............-----
HGL_H00000398321    ---...------------....-----...-............---------------...............-----
HGL_H00000305071    ---...------------....-----...-............---------------...............-----
HGL_H00000379435    ---...------------....-----...-............--GEKQALNQAVYDN...............DSHTL
HGL_H00000262126    ---...------------....-----...-............---------------...............-----
HGL_H00000264607    AYV...GDLQTLRNLLQEesy.QSRINe..Ksvwcc.......GWLPCTPLRIAATAG...............HGNCV
HGL_H00000303518-1  ---...------------....-----...-............---------------...............-----
HGL_H00000331873    ---...------------....-----...-............-------LHKAASVG...............DTSRV
HGL_H00000274361    ---...------------....-----...-............---------------...............-----
HGL_H00000282272    ---...------------....-----...-............---------------...............-----
HGL_H00000414663-2  ---...------------....-----...-............---------------...............-----
HGL_H00000352358    ---...------------....-----...-............---------------...............-----
HGL_H00000296785-2  ---...------------....-----...-............---------------...............-----
HGL_H00000215941-2  ---...------------....-----...-............---------------...............-----
HGL_H00000352814    ---...------------....-----...-............---------------...............-----
HGL_H00000386239    ---...------------....-----...-............---------------...............-----
HGL_H00000320076    ---...------------....-----...-............---------------...............-----
HGL_H00000328327-3  ---...------------....-----...-............---------------...............-----
HGL_H00000360998    ---...------------....-----...-............---------------...............-----
HGL_H00000351881    ---...------------....-----...-............---------------...............-----
HGL_H00000265310    ---...------------....-----...-............---------------...............-----
HGL_H00000294053    ---...------------....-----...-............---------------...............-----
HGL_H00000274361    ---...------------....-----...-............---------------...............-----
HGL_H00000340836-1  ---...------------....-----...-............---------------...............-----
HGL_H00000217958-4  ---...------------....-----...-............---------------...............-----
HGL_H00000353796    ---...------------....-----...-............---------------...............-----
HGL_H00000349140-1  ---...------------....-----...-............---------------...............-----
HGL_H00000299234    ---...------------....-----...-............---------------...............-----
HGL_H00000328327-2  ---...------------....-----...-............---------------...............-----
HGL_H00000303570    ---...------------....-----...-............---------------...............-----
HGL_H00000267339    ---...------------....-----...-............---------------...............-----
HGL_H00000369579    ---...------------....-----...-............---------------...............-----
HGL_H00000368848    ---...--ISLLPHLAAD....NLDKI...H............DENGNNLLHITASRG...............HVECL
HGL_H00000401089    ---...------------....-----...-............---------------...............-----
HGL_H00000350331-1  ---...------------....-----...-............---------------...............-----
HGL_H00000265140    ---...------------....-----...-............---------------...............-----
HGL_H00000414663-1  ---...------------....-----...-............---------------...............-----
HGL_H00000375751    ---...------------....-----...-............---------------...............-----
HGL_H00000355827-2  ---...------------....-----...-............---------------...............-----
HGL_H00000314103    ---...------------....-----...-............---------------...............-----
HGL_H00000280758-2  ---...------------....-----...-............---------------...............-----
HGL_H00000331065    ---...------------....-----...-............---------------...............-----
HGL_H00000378013    ---...------------....-----...-............---------------...............-----
HGL_H00000261312    ---...------------....-----...-............---------------...............-----
HGL_H00000202556    ---...------------....-----...-............---------------...............-----
HGL_H00000298992    ---...------------....-----...-............---------------...............-----
HGL_H00000307541    ---...------------....-----...-............---------------...............-----
HGL_H00000349140-2  ---...------------....-----...-............---------------...............-----
HGL_H00000371734-1  ---...------------....-----...-............---------------...............-----
HGL_H00000370259-2  ---...------------....-----...-............---------------...............-----
HGL_H00000324287    ---...------------....-----...-............---------------...............-----
HGL_H00000346733    ---...------------....-----...-............---------------...............-----
HGL_H00000403902    ---...------------....-----...-............---------------...............-----
HGL_H00000253810    ---...------------....-----...-............---------------...............-----
HGL_H00000384801    ---...------------....-----...-............---------------...............-----
HGL_R00000013095    ---...------------....-----...-............---------------...............-----
HGL_H00000277458    --E...SRLHVLRELLEK....KAHSPf..Y............QEGVSNALLKMAELG...............LTQAA
HGL_H00000335147    ---...------------....-----...-............---------------...............-----
HGL_H00000158762    ---...------------....-----...-............---------------...............-----
HGL_H00000303518-3  ---...------------....-----...-............---------------...............-----
HGL_H00000299824-2  ---...------------....-----...-............---------------...............-----
HGL_H00000356685    ---...------------....-----...-............---------------...............-----
HGL_H00000240361    ---...------------....-----...-............---------------...............-----
HGL_H00000265742    ---...------------....-----...-............---------------...............-----
HGL_H00000320340    ---...------------....-----...-............---------------...............-----
HGL_H00000308772    ---...------------....-----...-............---------------...............-----
HGL_H00000349041    ---...------------....-----...-............------IFQEAVRRG...............NTREL
HGL_H00000378338    ---...------------....-----...-............---------------...............-----
HGL_H00000367705    ---...------------....-----...-............---------------...............-----
HGL_H00000396078    ---...------------....-----...-............---------------...............-----
HGL_H00000419199    ---...------------....-----...-............---------------...............-----
HGL_H00000385887    ---...------------....-----...-............---------------...............-----
HGL_H00000396747    ---...------------....-----...-............---------------...............-----
HGL_M00000098100    ---...------------....-----...-............---------------...............-----
HGL_H00000365830    ---...------------....-----...-............---------------...............-----
HGL_H00000407057    ARS...GNLDKALDHLRN....GVDINt..C............NQNGLNGLHLASKEG...............HVKMV
HGL_H00000350331-3  ---...------------....-----...-............---------------...............-----
HGL_H00000368859    ---...------------....-----...-............---------------...............-----
HGL_H00000347464    ---...------------....-----...-............---------------...............-----
HGL_H00000274457-1  ---...------------....-----...-............---------------...............-----
HGL_H00000230792    ---...------------....-----...-............---------------...............-----
HGL_H00000310447    ---...------------....-----...-............---------------...............-----
HGL_H00000353732    ---...------------....-----...-............---------------...............-----
HGL_H00000305721    ---...------------....-----...-............---------------...............-----
HGL_H00000359982    ---...------------....-----...-............---------------...............-----
HGL_H00000382659    ---...------------....-----...-............--------------G...............QNDTI
HGL_H00000269856    ---...------------....-----...-............---------------...............-----
HGL_H00000317379    ---...------------....-----...-............---------------...............-----
HGL_H00000261740    ---...------------....-----...-............---------------...............-----
HGL_H00000386897    ---...------------....-----...-............---------------...............-----
HGL_H00000340913-2  ---...------------....-----...-............---------------...............-----
HGL_H00000378328    ---...------------....-----...-............---------------...............-----
HGL_H00000386532    ---...------------....-----...-............---------------...............-----
HGL_H00000261739    ---...------------....-----...-............---SHFPLHLLVWNN...............DYRQL
HGL_H00000215941-1  ---...------------....-----...-............---------------...............-----
HGL_H00000334879    ---...------------....-----...-............---------------...............-----
HGL_H00000380413    ---...------------....-----...-............---------------...............-----
HGL_H00000368966    ---...------------....-----...-............----------AAEYG...............NIPVV
HGL_H00000328160    ---...------------....-----...-............---------------...............-----
HGL_H00000262839    ---...------------....-----...-............----------AVEKG...............DYATV
HGL_H00000343362    ---...------------....-----...-............---------------...............-----
HGL_H00000369003    ---...------------....-----...-............------------EKG...............DYASV
HGL_H00000232744    ---...------------....-----...-............---------------...............-----
HGL_H00000419313    ---...------------....-----...-............------LFLLACDKG...............DYYMV
HGL_H00000161863    ---...------------....-----...-............---------------...............-----
HGL_H00000402616-1  ---...------------....-----...-............---------------...............-----
HGL_M00000035452    ---...------------....-----...-............---------------...............-----
HGL_H00000416826    ---...------------....-----...-............---------------...............-----
HGL_H00000373600    ---...------------....-----...-............---------------...............-----
HGL_H00000321813    ---...------------....-----...-............---------------...............-----
HGL_M00000056646    ---...------------....-----...-............---------------...............-----
HGL_H00000385887    ---...------------....-----...-............---------------...............-----
HGL_H00000387907    ---...------------....-----...-............---------------...............-----
HGL_H00000416826    ---...------------....-----...-............---------------...............-----
HGL_N10020562       ---...------------....-----...-............---------------...............-----
HGL_H00000350686    ---...------------....-----...-............---------------...............-----
HGL_H00000321627    ---...------------....-----...-............---------------...............-----
HGL_H00000386337    ---...------------....-----...-............---------------...............-----
HGL_H00000378871    ---...------------....-----...-............---------------...............-----
HGL_N000000797401   ---...------------....-----...-............---------------...............-----
HGL_H00000307298-1  ---...------------....-----...-............---------------...............-----
HGL_H00000340913-1  ---...------------....-----...-............---------------...............-----
HGL_H00000320509    ---...------------....-----...-............---------------...............-----
HGL_H00000262547    ---...------------....-----...-............---------------...............-----


                      0                                                                             
                      |                                                                             
d2fo1e1               EDLIVH........................................................................
HGL_H00000312988    DFLLG-........................................................................
HGL_H00000407057    KLLLESnanpnlattaghtplhiaareghvdtalallekeasqacmtkkgftplhvaakygkar..............
HGL_H00000280772    AFLLD-........................................................................
HGL_H00000349588    RCLLRNgalvdarareeqtplhiasrlgkteivqlllqhmahpdaattngytplhisaregqvdvasvlleagaahsl
HGL_H00000281131    NTLLFWgaavdsidsegrtvlsiasaqgnve...............................................
HGL_H00000280772    KFLLDNgasqslatedgftplavalqqghdqvvslllendtkgkvrlpalhiaarkddtkaaalllqndnnadvesks
HGL_H00000407057    KFLLE-........................................................................
HGL_H00000306678    KLLTS-........................................................................
HGL_H00000282272    QVLIK-........................................................................
HGL_H00000267116    ------........................................................................
HGL_H00000256707    DELLR-........................................................................
HGL_H00000411147-2  ELLLD-........................................................................
HGL_H00000351416    EILLDSgadieaqsertkdtplslacsggrqevvelllargankehrnvsdytplslaasggyvn.............
HGL_H00000330161    RLLLE-........................................................................
HGL_H00000253810    EILLDKggdieaqsertkdtplslacsggrqevvdlllargankehrnvsdytplslaasggyvn.............
HGL_H00000351416    KVLLE-........................................................................
HGL_H00000374171    KFLIQCdwtmagqqqgvfkkshaiqqaliaaasmgyteivsylldlp...............................
HGL_H00000373287    RKLLS-........................................................................
HGL_H00000262457    HLLLERnksgtipsdsqgatplhyaaqsnfaetvkvflkhpsvkddsdlegrtsfmwasgkgsddvl...........
HGL_H00000263635    QYLLTCewsmgppqpstlrksqalqqaltaaasmghslvvqc....................................
HGL_H00000386135    KFLNE-........................................................................
HGL_H00000373287    YSLLN-........................................................................
HGL_H00000267116    VTLVTAgagvneadckgcsplhyaaasdtyrraephttshdaeedeplkesrrkeaff....................
HGL_H00000349588    TLLLN-........................................................................
HGL_H00000417980-1  HMLVQ-........................................................................
HGL_H00000216797    ------........................................................................
HGL_H00000369579    QRLLG-........................................................................
HGL_H00000373287    ELLIL-........................................................................
HGL_H00000345767    QILLK-........................................................................
HGL_H00000311579    EVLHK-........................................................................
HGL_H00000360689    ELLLR-........................................................................
HGL_H00000350297    ------........................................................................
HGL_H00000267116    HLLLE-........................................................................
HGL_H00000360689    EYLLQ-........................................................................
HGL_H00000311579    EHLLQ-........................................................................
HGL_H00000345065    EYLIQ-........................................................................
HGL_H00000282272    SLLLE-........................................................................
HGL_H00000281419    ------........................................................................
HGL_H00000348081    RVLLS-........................................................................
HGL_H00000388725-2  ASLLG-........................................................................
HGL_H00000389168    LKLLH-........................................................................
HGL_H00000402044    KVLQQ-........................................................................
HGL_H00000281131    RTLLD-........................................................................
HGL_H00000353518    EVLLR-........................................................................
HGL_H00000217958-1  KESIL-........................................................................
HGL_H00000388725-1  ASLLG-........................................................................
HGL_H00000275015    LCCLA-........................................................................
HGL_H00000299824-1  RYFLK-........................................................................
HGL_H00000325355    ALLLE-........................................................................
HGL_H00000369434    GYLLD-........................................................................
HGL_H00000338769    ------........................................................................
HGL_H00000403397    RELVE-........................................................................
HGL_H00000226574    RDLLQ-........................................................................
HGL_H00000349588    QELLG-........................................................................
HGL_H00000382545-2  RELVL-........................................................................
HGL_H00000328327-1  RVFLE-........................................................................
HGL_H00000356240    KKLLA-........................................................................
HGL_H00000301030    KELIS-........................................................................
HGL_H00000391126-2  CQFLR-........................................................................
HGL_H00000351416    ALLLG-........................................................................
HGL_H00000417980-2  HVLLQ-........................................................................
HGL_H00000333142    QLLGK-........................................................................
HGL_H00000411147-1  LVA---........................................................................
HGL_H00000160373    SMLLN-........................................................................
HGL_H00000350331-2  -QLIE-........................................................................
HGL_H00000345436    SLLLE-........................................................................
HGL_H00000343362    QCLLE-........................................................................
HGL_H00000378210    QILIH-........................................................................
HGL_H00000304292-1  LKLLQ-........................................................................
HGL_H00000314556    SSILA-........................................................................
HGL_H00000263388    EDTSAS........................................................................
HGL_H00000260047    II----........................................................................
HGL_H00000342295    VSLLR-........................................................................
HGL_H00000261537    KLLLKQnvdveaereggrraxxxksafgdega..............................................
HGL_H00000277541-1  ---PAV........................................................................
HGL_H00000307298-2  KLLVS-........................................................................
HGL_H00000386502    ------........................................................................
HGL_H00000347802    ------........................................................................
HGL_H00000296525    RTLLS-........................................................................
HGL_H00000274457-1  EFLLE-........................................................................
HGL_H00000262457    DALLK-........................................................................
HGL_H00000256646    TDLVY-........................................................................
HGL_H00000400113    KELVE-........................................................................
HGL_H00000277541-2  TFQGTWlgspe...................................................................
HGL_H00000274457-2  EFLLEQ........................................................................
HGL_H00000262970    AVLIS-........................................................................
HGL_H00000401369    HVLLV-........................................................................
HGL_H00000358983    EQIAH-........................................................................
HGL_H00000304586    ------........................................................................
HGL_H00000304292-2  RYLLEW........................................................................
HGL_H00000360826    ------........................................................................
HGL_H00000360762-1  ------........................................................................
HGL_H00000275699    SLLLN-........................................................................
HGL_H00000325663    YVLAR-........................................................................
HGL_H00000339115    EWLLQ-........................................................................
HGL_H00000364158    HLLLD-........................................................................
HGL_H00000417914    KTLIT-........................................................................
HGL_H00000306163    ------........................................................................
HGL_H00000337056    ------........................................................................
HGL_H00000369855    RNLIN-........................................................................
HGL_H00000282272    QTLIQ-........................................................................
HGL_H00000370259-3  ------........................................................................
HGL_H00000375690    ARLLD-........................................................................
HGL_H00000164227    ------........................................................................
HGL_H00000263433    ------........................................................................
HGL_H00000391126-1  EVLID-........................................................................
HGL_H00000357681    ------........................................................................
HGL_H00000360762-2  ------........................................................................
HGL_H00000357914-1  ------........................................................................
HGL_H00000284629-1  ------........................................................................
HGL_H00000320893    ------........................................................................
HGL_H00000217958-2  -ESIL-........................................................................
HGL_H00000284629-2  ------........................................................................
HGL_H00000269856    RSLLR-........................................................................
HGL_H00000345193-1  ARLLD-........................................................................
HGL_H00000304292-2  SGRLN-........................................................................
HGL_H00000276925-1  ------........................................................................
HGL_H00000343362    TFLIK-........................................................................
HGL_H00000262209    ------........................................................................
HGL_H00000217958-3  DVLLQ-........................................................................
HGL_H00000343362    LFLAT-........................................................................
HGL_H00000276925-2  ------........................................................................
HGL_H00000320291    RQLLES........................................................................
HGL_H00000262209    ------........................................................................
HGL_H00000321679    ------........................................................................
HGL_H00000371734-2  ------........................................................................
HGL_H00000360689    ------........................................................................
HGL_H00000382545-1  ------........................................................................
HGL_H00000311579    ------........................................................................
HGL_H00000392839    ------........................................................................
HGL_H00000252985    YAAAE-........................................................................
HGL_H00000392839    EILAK-........................................................................
HGL_H00000217958-5  ------........................................................................
HGL_H00000303518-2  ------........................................................................
HGL_H00000357914-2  ------........................................................................
HGL_H00000296785-1  ------........................................................................
HGL_H00000405112-2  ------........................................................................
HGL_H00000349612    MYLLG-........................................................................
HGL_H00000260947    ------........................................................................
HGL_H00000403487    ------........................................................................
HGL_H00000415252    ------........................................................................
HGL_H00000398321    ------........................................................................
HGL_H00000305071    ------........................................................................
HGL_H00000379435    DQLLC-........................................................................
HGL_H00000262126    ------........................................................................
HGL_H00000264607    DFLIR-........................................................................
HGL_H00000303518-1  ------........................................................................
HGL_H00000331873    MYLLH-........................................................................
HGL_H00000274361    ------........................................................................
HGL_H00000282272    ------........................................................................
HGL_H00000414663-2  ------........................................................................
HGL_H00000352358    ------........................................................................
HGL_H00000296785-2  ------........................................................................
HGL_H00000215941-2  ------........................................................................
HGL_H00000352814    ------........................................................................
HGL_H00000386239    ------........................................................................
HGL_H00000320076    ------........................................................................
HGL_H00000328327-3  ------........................................................................
HGL_H00000360998    ------........................................................................
HGL_H00000351881    ------........................................................................
HGL_H00000265310    ------........................................................................
HGL_H00000294053    ------........................................................................
HGL_H00000274361    ------........................................................................
HGL_H00000340836-1  ------........................................................................
HGL_H00000217958-4  ------........................................................................
HGL_H00000353796    ------........................................................................
HGL_H00000349140-1  ------........................................................................
HGL_H00000299234    ------........................................................................
HGL_H00000328327-2  ------........................................................................
HGL_H00000303570    ------........................................................................
HGL_H00000267339    ------........................................................................
HGL_H00000369579    ------........................................................................
HGL_H00000368848    QHLTS-........................................................................
HGL_H00000401089    ------........................................................................
HGL_H00000350331-1  ------........................................................................
HGL_H00000265140    ------........................................................................
HGL_H00000414663-1  ------........................................................................
HGL_H00000375751    ------........................................................................
HGL_H00000355827-2  ------........................................................................
HGL_H00000314103    ------........................................................................
HGL_H00000280758-2  ------........................................................................
HGL_H00000331065    ------........................................................................
HGL_H00000378013    ------........................................................................
HGL_H00000261312    ------........................................................................
HGL_H00000202556    ------........................................................................
HGL_H00000298992    ------........................................................................
HGL_H00000307541    ------........................................................................
HGL_H00000349140-2  ------........................................................................
HGL_H00000371734-1  ------........................................................................
HGL_H00000370259-2  ------........................................................................
HGL_H00000324287    ------........................................................................
HGL_H00000346733    ------........................................................................
HGL_H00000403902    ------........................................................................
HGL_H00000253810    ------........................................................................
HGL_H00000384801    ------........................................................................
HGL_R00000013095    ------........................................................................
HGL_H00000277458    AILLR-........................................................................
HGL_H00000335147    ------........................................................................
HGL_H00000158762    ------........................................................................
HGL_H00000303518-3  ------........................................................................
HGL_H00000299824-2  ------........................................................................
HGL_H00000356685    ------........................................................................
HGL_H00000240361    ------........................................................................
HGL_H00000265742    ------........................................................................
HGL_H00000320340    ------........................................................................
HGL_H00000308772    ------........................................................................
HGL_H00000349041    QSLLQ-........................................................................
HGL_H00000378338    ------........................................................................
HGL_H00000367705    ------........................................................................
HGL_H00000396078    ------........................................................................
HGL_H00000419199    ------........................................................................
HGL_H00000385887    ------........................................................................
HGL_H00000396747    ------........................................................................
HGL_M00000098100    ------........................................................................
HGL_H00000365830    ------........................................................................
HGL_H00000407057    VELLH-........................................................................
HGL_H00000350331-3  ------........................................................................
HGL_H00000368859    ------........................................................................
HGL_H00000347464    ------........................................................................
HGL_H00000274457-1  ------........................................................................
HGL_H00000230792    ------........................................................................
HGL_H00000310447    ------........................................................................
HGL_H00000353732    ------........................................................................
HGL_H00000305721    ------........................................................................
HGL_H00000359982    ------........................................................................
HGL_H00000382659    SLLLDIaqe.....................................................................
HGL_H00000269856    ------........................................................................
HGL_H00000317379    ------........................................................................
HGL_H00000261740    ------........................................................................
HGL_H00000386897    ------........................................................................
HGL_H00000340913-2  ------........................................................................
HGL_H00000378328    ------........................................................................
HGL_H00000386532    ------........................................................................
HGL_H00000261739    EKVLR-........................................................................
HGL_H00000215941-1  ------........................................................................
HGL_H00000334879    ------........................................................................
HGL_H00000380413    ------........................................................................
HGL_H00000368966    RKMLE-........................................................................
HGL_H00000328160    ------........................................................................
HGL_H00000262839    KQALQ-........................................................................
HGL_H00000343362    ------........................................................................
HGL_H00000369003    KKSLE-........................................................................
HGL_H00000232744    ------........................................................................
HGL_H00000419313    KKILE-........................................................................
HGL_H00000161863    ------........................................................................
HGL_H00000402616-1  ------........................................................................
HGL_M00000035452    ------........................................................................
HGL_H00000416826    ------........................................................................
HGL_H00000373600    ------........................................................................
HGL_H00000321813    ------........................................................................
HGL_M00000056646    ------........................................................................
HGL_H00000385887    ------........................................................................
HGL_H00000387907    ------........................................................................
HGL_H00000416826    ------........................................................................
HGL_N10020562       ------........................................................................
HGL_H00000350686    ------........................................................................
HGL_H00000321627    ------........................................................................
HGL_H00000386337    ------........................................................................
HGL_H00000378871    ------........................................................................
HGL_N000000797401   ------........................................................................
HGL_H00000307298-1  ------........................................................................
HGL_H00000340913-1  ------........................................................................
HGL_H00000320509    ------........................................................................
HGL_H00000262547    ------........................................................................


                                                                               60           70      
                                                                                |            |      
d2fo1e1               ....................................................EAKE..CIAAGAD...VNAM...DC.
HGL_H00000312988    ....................................................----..---FSAGteyLDLQ...ND.
HGL_H00000407057    ....................................................VAEL..LLERDAH...PNAA...GK.
HGL_H00000280772    ....................................................----..---HGAS...LSIT...TK.
HGL_H00000349588    atkkgftplhvaakygsldvaklllqrraaadsagkngltplhvaahydnqkVALL..LLEKGAS...PHAT...AK.
HGL_H00000281131    ....................................................VVRT..LLDRGLD...ENHR...DD.
HGL_H00000280772    .....................................gftplhiaahygninV---..-------...----...--.
HGL_H00000407057    ....................................................----..---NGAN...QNVA...TE.
HGL_H00000306678    ....................................................----..---QGAE...LDAQ...QR.
HGL_H00000282272    ....................................................----..---HSAD...VNAR...DK.
HGL_H00000267116    ....................................................TVNL..LLNKGAS...LNVC...DK.
HGL_H00000256707    ....................................................----..---CGVN...LEHR...DM.
HGL_H00000411147-2  ....................................................----..---HGAD...PHQR...KK.
HGL_H00000351416    ....................................................IIKI..LLNAGAE...INSRqtgSK.
HGL_H00000330161    ....................................................----..---RNAS...VHEV...DF.
HGL_H00000253810    ....................................................IIKI..LLNAGAE...INSRtg.SK.
HGL_H00000351416    ....................................................----..---SGAS...IEDH...NE.
HGL_H00000374171    ....................................................EKDE..EEVERAQ...INSF...DSl
HGL_H00000373287    ....................................................----..---SGFD...IDTP...DD.
HGL_H00000262457    ....................................................RAML..SLKSDID...INMA...DK.
HGL_H00000263635    ....................................................LLGM..EEEHEIE...VNGT...DTl
HGL_H00000386135    ....................................................----..---NKCP...LDVT...DK.
HGL_H00000373287    ....................................................----..---KGAN...VDAK...DK.
HGL_H00000267116    ....................................................CLEF..LLDNGAD...PSLR...DR.
HGL_H00000349588    ....................................................----..---RGAA...VDFT...AR.
HGL_H00000417980-1  ....................................................----..---AGAN...IDTC...SE.
HGL_H00000216797    ....................................................----..-------...LNFQ...NN.
HGL_H00000369579    ....................................................----..---AGSH...VNAL...TQ.
HGL_H00000373287    ....................................................----..---SGAR...VNAK...DS.
HGL_H00000345767    ....................................................----..---AGCD...LDVQ...DD.
HGL_H00000311579    ....................................................----..---HGAK...MNAL...DT.
HGL_H00000360689    ....................................................----..---KGAN...INEK...TK.
HGL_H00000350297    ....................................................----..-------...----...--.
HGL_H00000267116    ....................................................----..---KGST...ADAA...DL.
HGL_H00000360689    ....................................................----..---NGAN...VQAR...DD.
HGL_H00000311579    ....................................................----..---MGAN...VHAR...DD.
HGL_H00000345065    ....................................................----..-DLHLQE...LNQS...DQ.
HGL_H00000282272    ....................................................----..---KEAN...MDAA...DV.
HGL_H00000281419    ....................................................----..-------...----...--.
HGL_H00000348081    ....................................................----..---AGCG...ANAL...NG.
HGL_H00000388725-2  ....................................................----..--KKGAS...ATKQ...DS.
HGL_H00000389168    ....................................................----..---RGAD...INYA...NV.
HGL_H00000402044    ....................................................----..--AYPGA...IDQR...TL.
HGL_H00000281131    ....................................................----..---NGAS...VNQC...DS.
HGL_H00000353518    ....................................................----..---NDAL...TNVA...DS.
HGL_H00000217958-1  ....................................................----..--ANKSL...ATRT...DQ.
HGL_H00000388725-1  ....................................................----..--KKGAS...ATKQ...NS.
HGL_H00000275015    ....................................................----..-LLPQEV...LDIQ...NN.
HGL_H00000299824-1  ....................................................----..---NKVS...PDLC...NE.
HGL_H00000325355    ....................................................----..---AQAT...VDIK...DS.
HGL_H00000369434    ....................................................----..---RGVA...VDCL...KK.
HGL_H00000338769    ....................................................----..-------...----...--.
HGL_H00000403397    ....................................................----..---AGYD...VRQP...DK.
HGL_H00000226574    ....................................................-VTA..GVISEDI...INMR...ND.
HGL_H00000349588    ....................................................----..---RGSA...VDSA...TK.
HGL_H00000382545-2  ....................................................----..---QGAD...INLQ...RE.
HGL_H00000328327-1  ....................................................----..---HGAD...PTVK...DLi
HGL_H00000356240    ....................................................----..---RGAD...INTV...NV.
HGL_H00000301030    ....................................................----..---EGAD...VNVK...DF.
HGL_H00000391126-2  ....................................................----..---NGVS...PDLA...NE.
HGL_H00000351416    ....................................................----..---QGAN...INAQ...TEe
HGL_H00000417980-2  ....................................................----..---AGAN...INAV...DK.
HGL_H00000333142    ....................................................----..--NTSSG...LNQA...NH.
HGL_H00000411147-1  ....................................................----..---WGAA...VDAQ...DS.
HGL_H00000160373    ....................................................----..--EEGLD...INYS...CE.
HGL_H00000350331-2  ....................................................----..---SGAC...VNQV...TV.
HGL_H00000345436    ....................................................----..---AQAA...VDIK...DN.
HGL_H00000343362    ....................................................----..---FGAN...VNAQ...DA.
HGL_H00000378210    ....................................................----..TDSSENY...IKTK...TF.
HGL_H00000304292-1  ....................................................----..---YEAS...TNVA...DN.
HGL_H00000314556    ....................................................----..--KKGVN...PGKL...DV.
HGL_H00000263388    ....................................................IISD..LICQGAQ...LGARt..DR.
HGL_H00000260047    ....................................................----..---NGAN...LATQ...DD.
HGL_H00000342295    ....................................................----..---NGAK...HNIP...DK.
HGL_H00000261537    ....................................................VIEV..LHRGSAD...LNAR...NK.
HGL_H00000277541-1  ....................................................ISDF..IYQGASL...HNQT...DR.
HGL_H00000307298-2  ....................................................----..---HGAN...VNHT...TV.
HGL_H00000386502    ....................................................----..-------...----...--.
HGL_H00000347802    ....................................................----..-------...----...--.
HGL_H00000296525    ....................................................----..---QGYN...VNAV...TI.
HGL_H00000274457-1  ....................................................QCSA..SIEVGGS...VNFDge.TI.
HGL_H00000262457    ....................................................----..---AGAE...VNKT...DH.
HGL_H00000256646    ....................................................----..---QGAS...LQAQt..DR.
HGL_H00000400113    ....................................................----..---AGYD...VRQP...DK.
HGL_H00000277541-2  ....................................................PWEP..LPDGGAC...PQAH...PSg
HGL_H00000274457-2  ....................................................CSAS..IEVGGSVi..FDGE...TI.
HGL_H00000262970    ....................................................----..--RKGLV...PTKL...DP.
HGL_H00000401369    ....................................................----..---AGAD...PNLP...DQ.
HGL_H00000358983    ....................................................-IIY..HAPHLGV...ANLT...NH.
HGL_H00000304586    ....................................................----..-------...----...--.
HGL_H00000304292-2  ....................................................TEED..LDEVEDA...VSAV...DL.
HGL_H00000360826    ....................................................----..-------...----...--.
HGL_H00000360762-1  ....................................................----..-------...----...--.
HGL_H00000275699    ....................................................----..---HGGN...VHLR...DG.
HGL_H00000325663    ....................................................----..--KMNVLhm.LDIK...EH.
HGL_H00000339115    ....................................................----..---EGHA...ATLE...TL.
HGL_H00000364158    ....................................................----..---HGAD...VNAQ...NR.
HGL_H00000417914    ....................................................----..---QGVN...VNLV...TI.
HGL_H00000306163    ....................................................----..-------...----...--.
HGL_H00000337056    ....................................................----..-------...----...--.
HGL_H00000369855    ....................................................----..---QGWP...VNIN...TA.
HGL_H00000282272    ....................................................----..---NGGE...IDCV...DK.
HGL_H00000370259-3  ....................................................----..-------...----...--.
HGL_H00000375690    ....................................................----..---KGLD...PNYH...DSd
HGL_H00000164227    ....................................................----..-------...----...--.
HGL_H00000263433    ....................................................----..-------...-DST...NA.
HGL_H00000391126-1  ....................................................----..---KGVN...VNHQ...DE.
HGL_H00000357681    ....................................................----..-------...----...--.
HGL_H00000360762-2  ....................................................----..-------...----...--.
HGL_H00000357914-1  ....................................................----..-------...----...--.
HGL_H00000284629-1  ....................................................----..-------...----...--.
HGL_H00000320893    ....................................................----..-------...----...--.
HGL_H00000217958-2  ....................................................----..--ANKSL...ATRT...DQ.
HGL_H00000284629-2  ....................................................----..-------...----...--.
HGL_H00000269856    ....................................................----..---RGAS...VNRT...TR.
HGL_H00000345193-1  ....................................................----..---KGLD...PNFH...DPd
HGL_H00000304292-2  ....................................................----..---DPSI...V---...--.
HGL_H00000276925-1  ....................................................----..-------...----...--.
HGL_H00000343362    ....................................................----..---NGAL...VNAA...TLg
HGL_H00000262209    ....................................................----..-------...--KY...KE.
HGL_H00000217958-3  ....................................................----..---HGAN...VNVQ...DA.
HGL_H00000343362    ....................................................----..---NGAH...VNHK...NK.
HGL_H00000276925-2  ....................................................----..-------...----...--.
HGL_H00000320291    ....................................................MERNevMADINCK...GRSK...SN.
HGL_H00000262209    ....................................................----..-------...VMDE...DN.
HGL_H00000321679    ....................................................----..-------...----...--.
HGL_H00000371734-2  ....................................................----..-------...----...--.
HGL_H00000360689    ....................................................----..-------...----...--.
HGL_H00000382545-1  ....................................................----..-------...----...--.
HGL_H00000311579    ....................................................----..-------...----...--.
HGL_H00000392839    ....................................................----..-------...----...--.
HGL_H00000252985    ....................................................----..VLQMYRH...LDIR...EH.
HGL_H00000392839    ....................................................----..---AKAD...MTIV...DN.
HGL_H00000217958-5  ....................................................----..--ANKSL...ATRT...DQ.
HGL_H00000303518-2  ....................................................----..-------...----...--.
HGL_H00000357914-2  ....................................................----..-------...----...--.
HGL_H00000296785-1  ....................................................----..-------...----...--.
HGL_H00000405112-2  ....................................................----..-------...----...--.
HGL_H00000349612    ....................................................----..--LRKCL...VTDR...DK.
HGL_H00000260947    ....................................................----..-------...----...--.
HGL_H00000403487    ....................................................----..-------...----...--.
HGL_H00000415252    ....................................................----..-------...----...--.
HGL_H00000398321    ....................................................----..-------...----...--.
HGL_H00000305071    ....................................................----..-------...----...--.
HGL_H00000379435    ....................................................----..QERYKRF...INSR...SG.
HGL_H00000262126    ....................................................----..-------...----...--.
HGL_H00000264607    ....................................................----..---KGAE...VDLV...DV.
HGL_H00000303518-1  ....................................................----..-------...----...--.
HGL_H00000331873    ....................................................----..--LWKSL...VTDR...DK.
HGL_H00000274361    ....................................................----..-------...----...--.
HGL_H00000282272    ....................................................----..-------...----...--.
HGL_H00000414663-2  ....................................................----..-------...----...--.
HGL_H00000352358    ....................................................----..-------...----...-R.
HGL_H00000296785-2  ....................................................----..-------...----...--.
HGL_H00000215941-2  ....................................................----..-------...----...--.
HGL_H00000352814    ....................................................----..-------...----...--.
HGL_H00000386239    ....................................................----..-------...----...--.
HGL_H00000320076    ....................................................----..-------...----...--.
HGL_H00000328327-3  ....................................................----..-------...----...--.
HGL_H00000360998    ....................................................----..-------...----...--.
HGL_H00000351881    ....................................................----..-------...----...--.
HGL_H00000265310    ....................................................----..-------...----...--.
HGL_H00000294053    ....................................................----..-------...----...--.
HGL_H00000274361    ....................................................----..-------...----...--.
HGL_H00000340836-1  ....................................................----..-------...----...--.
HGL_H00000217958-4  ....................................................----..-------...----...--.
HGL_H00000353796    ....................................................----..-------...----...--.
HGL_H00000349140-1  ....................................................----..-------...----...--.
HGL_H00000299234    ....................................................----..-------...----...--.
HGL_H00000328327-2  ....................................................----..-------...----...--.
HGL_H00000303570    ....................................................----..-------...----...--.
HGL_H00000267339    ....................................................----..-------...----...--.
HGL_H00000369579    ....................................................----..-------...----...--.
HGL_H00000368848    ....................................................----..-------...----...--.
HGL_H00000401089    ....................................................----..-------...----...--.
HGL_H00000350331-1  ....................................................----..-------...----...--.
HGL_H00000265140    ....................................................----..-------...----...--.
HGL_H00000414663-1  ....................................................----..-------...----...--.
HGL_H00000375751    ....................................................----..-------...----...--.
HGL_H00000355827-2  ....................................................----..-------...----...--.
HGL_H00000314103    ....................................................----..-------...----...--.
HGL_H00000280758-2  ....................................................----..-------...----...--.
HGL_H00000331065    ....................................................----..-------...----...--.
HGL_H00000378013    ....................................................----..-------...----...--.
HGL_H00000261312    ....................................................----..-------...----...--.
HGL_H00000202556    ....................................................----..-------...----...--.
HGL_H00000298992    ....................................................----..-------...VNTM...DD.
HGL_H00000307541    ....................................................----..-------...----...--.
HGL_H00000349140-2  ....................................................----..-------...----...--.
HGL_H00000371734-1  ....................................................----..-------...----...--.
HGL_H00000370259-2  ....................................................----..-------...----...--.
HGL_H00000324287    ....................................................----..-------...----...--.
HGL_H00000346733    ....................................................----..-------...----...--.
HGL_H00000403902    ....................................................----..-------...----...--.
HGL_H00000253810    ....................................................----..-------...----...--.
HGL_H00000384801    ....................................................----..-------...----...--.
HGL_R00000013095    ....................................................----..-------...----...--.
HGL_H00000277458    ....................................................----..---SGAN...LNFE...DPv
HGL_H00000335147    ....................................................----..-------...----...--.
HGL_H00000158762    ....................................................----..-------...----...--.
HGL_H00000303518-3  ....................................................----..-------...----...--.
HGL_H00000299824-2  ....................................................----..-------...----...--.
HGL_H00000356685    ....................................................----..-------...----...--.
HGL_H00000240361    ....................................................----..-------...----...--.
HGL_H00000265742    ....................................................----..-------...----...--.
HGL_H00000320340    ....................................................----..-------...----...--.
HGL_H00000308772    ....................................................----..-------...----...--.
HGL_H00000349041    ....................................................---N..MTNCEFN...VNSV...AP.
HGL_H00000378338    ....................................................----..-------...----...--.
HGL_H00000367705    ....................................................----..-------...----...--.
HGL_H00000396078    ....................................................----..-------...----...--.
HGL_H00000419199    ....................................................----..-------...----...--.
HGL_H00000385887    ....................................................----..-------...----...--.
HGL_H00000396747    ....................................................----..-------...----...--.
HGL_M00000098100    ....................................................----..-------...----...--.
HGL_H00000365830    ....................................................----..-------...----...--.
HGL_H00000407057    ....................................................----..---KEII...LETT...TK.
HGL_H00000350331-3  ....................................................----..-------...----...--.
HGL_H00000368859    ....................................................----..-------...----...--.
HGL_H00000347464    ....................................................----..-------...----...--.
HGL_H00000274457-1  ....................................................----..-------...----...--.
HGL_H00000230792    ....................................................----..-------...----...--.
HGL_H00000310447    ....................................................----..-------...----...--.
HGL_H00000353732    ....................................................----..-------...----...--.
HGL_H00000305721    ....................................................----..-------...----...--.
HGL_H00000359982    ....................................................----..-------...----...--.
HGL_H00000382659    ....................................................TDSL..REFVNAS...YTDS...YY.
HGL_H00000269856    ....................................................----..-------...----...--.
HGL_H00000317379    ....................................................----..-------...----...--.
HGL_H00000261740    ....................................................----..-------...----...-Y.
HGL_H00000386897    ....................................................----..-------...----...--.
HGL_H00000340913-2  ....................................................----..-------...----...--.
HGL_H00000378328    ....................................................----..-------...----...--.
HGL_H00000386532    ....................................................----..-------...----...--.
HGL_H00000261739    ....................................................----..----GQN...VEAL...DP.
HGL_H00000215941-1  ....................................................----..-------...----...--.
HGL_H00000334879    ....................................................----..-------...----...--.
HGL_H00000380413    ....................................................----..-------...----...--.
HGL_H00000368966    ....................................................----..-ESKTLN...VNCV...DY.
HGL_H00000328160    ....................................................----..-------...----...--.
HGL_H00000262839    ....................................................--EA..EIYYNVN...INCM...DP.
HGL_H00000343362    ....................................................----..-------...----...--.
HGL_H00000369003    ....................................................--EA..EIYFKIN...INCI...DP.
HGL_H00000232744    ....................................................----..-------...----...--.
HGL_H00000419313    ....................................................---E..NSSGDLN...INCV...DV.
HGL_H00000161863    ....................................................----..-------...----...--.
HGL_H00000402616-1  ....................................................----..--SRQHD...LEQE...DP.
HGL_M00000035452    ....................................................----..-------...----...--.
HGL_H00000416826    ....................................................----..-------...----...--.
HGL_H00000373600    ....................................................----..-------...----...--.
HGL_H00000321813    ....................................................----..-------...----...--.
HGL_M00000056646    ....................................................----..-------...----...--.
HGL_H00000385887    ....................................................----..-------...----...--.
HGL_H00000387907    ....................................................----..-------...----...--.
HGL_H00000416826    ....................................................----..-------...----...--.
HGL_N10020562       ....................................................----..-------...----...--.
HGL_H00000350686    ....................................................----..-------...----...--.
HGL_H00000321627    ....................................................----..-------...----...--.
HGL_H00000386337    ....................................................----..-------...----...--.
HGL_H00000378871    ....................................................----..-------...----...--.
HGL_N000000797401   ....................................................----..-------...----...--.
HGL_H00000307298-1  ....................................................----..-------...----...--.
HGL_H00000340913-1  ....................................................----..-------...----...--.
HGL_H00000320509    ....................................................----..-------...----...--.
HGL_H00000262547    ....................................................----..-------...----...--.


                                               80                    90                 100         
                                                |                     |                   |         
d2fo1e1               DEN..T.................PLMLAVLA...........RR.RRLVA.YLMKA....G..AD...P.........
HGL_H00000312988    LGQ..T.................ALHLAAIL...........GE.ASTVE.KLYAA....G..AG...L.........
HGL_H00000407057    NGL..T.................PLHVAVHH...........NN.LDIVK.LLLPR....G..GS...P.........
HGL_H00000280772    KGF..T.................PLHVAAKY...........GK.LEVAN.LLLQK....S..AS...P.........
HGL_H00000349588    NGY..T.................PLHIAAKK...........NQ.MHIAS.TLLSY....G..AE...T.........
HGL_H00000281131    AGW..T.................PLHMAAFE...........GH.RLICE.ALIEQ....G..AR...T.........
HGL_H00000280772    ---..-.................--------...........--.---AT.LLLNR....A..AA...V.........
HGL_H00000407057    DGF..T.................PLAVALQQ...........GH.ENVVA.HLINY....G..TK...Gkvrlpalhi
HGL_H00000306678    NLR..T.................PLHLAVER...........GK.VRAIQ.YLLKS....G..AA...P.........
HGL_H00000282272    NWQ..T.................PLHVAAAN...........KA.IKCAE.VIIPL....L..SS...V.........
HGL_H00000267116    KER..Q.................PLHWAAFL...........GH.LEVLK.LLVAR....G..AD...L.........
HGL_H00000256707    GGW..T.................ALMWACYK...........GR.TNVVE.LLLSH....G..AN...P.........
HGL_H00000411147-2  NGA..T.................SFIIAGIE...........GN.VELLR.LFLSK....G..AD...V.........
HGL_H00000351416    LGI..S.................PLMLAAMN...........GH.TAAVK.LLLDM....G..SD...I.........
HGL_H00000330161    EGR..T.................PMHVACQH...........GQ.ENIVR.ILLRR....G..VD...V.........
HGL_H00000253810    LGI..S.................PLMLAAMN...........GH.VPAVK.LLLDM....G..SD...I.........
HGL_H00000351416    NGH..T.................PLMEAGSA...........GH.VEVAR.LLLEN....G..AG...I.........
HGL_H00000374171    WGE..T.................ALTAAAGR...........GK.LEVCR.LLLEQ....G..AA...V.........
HGL_H00000373287    FGR..T.................CLHAAAAG...........GN.LECLN.LLLNT....G..AD...F.........
HGL_H00000262457    YGG..T.................ALHAAALS...........GH.VTTVK.LLLEN....D..AQ...V.........
HGL_H00000263635    WGE..T.................ALTAAAGR...........GK.LEICE.LLLER....G..AA...V.........
HGL_H00000386135    SGE..T.................ALHVAARY...........GH.ADVVQ.LLCSF....G..SN...P.........
HGL_H00000373287    WGR..T.................ALHRGAVT...........GH.EECID.ALLQH....G..AK...C.........
HGL_H00000267116    QGY..T.................AVHYAAAY...........GN.RQNLE.LLLEM....S..FN...Cledvestip
HGL_H00000349588    NGI..T.................PLHVASKR...........GN.TNMVK.LLLDR....G..GQ...I.........
HGL_H00000417980-1  DQR..T.................PLMEAAEN...........NH.LDAVK.YLIKA....G..AQ...V.........
HGL_H00000216797    LQQ..T.................PLHLAVIT...........KQ.PEITQ.ALLEA....G..CD...P.........
HGL_H00000369579    KKM..S.................CLHYAALS...........GS.EAVCQ.ALIRA....G..GC...T.........
HGL_H00000373287    KWL..T.................PLHRAVAS...........CS.EEAVQ.VLLKH....S..AD...V.........
HGL_H00000345767    GDQ..T.................ALHRATVV...........GN.TEIIA.ALIQE....G..CA...L.........
HGL_H00000311579    LGQ..T.................ALHRAALA...........GH.LQTCR.LLLSY....G..SD...Psiislqgft
HGL_H00000360689    EFL..T.................PLHVASEK...........AH.NDVVE.VVVKH....E..AK...V.........
HGL_H00000350297    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000267116    RGR..T.................ALHRGAVT...........GC.EDCLA.ALLDH....D..AF...V.........
HGL_H00000360689    GGL..I.................PLHNACSF...........GH.AEVVN.LLLQH....G..AD...P.........
HGL_H00000311579    GGL..I.................PLHNACSF...........GH.AEVVS.LLLCQ....G..AD...P.........
HGL_H00000345065    RGR..K.................PFLLAAGR...........GH.VEMIE.KLAFL....N..LH...T.........
HGL_H00000282272    MGC..T.................ALHRGIMT...........GH.EECVQ.MLLEQ....E..VS...V.........
HGL_H00000281419    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000348081    TRS..T.................ALHVAVQR...........GF.LEVVR.VLCER....G..CD...V.........
HGL_H00000388725-2  EGK..T.................AFHLAAAK...........GH.VECLR.VMFTH....G..VD...V.........
HGL_H00000389168    DGL..T.................ALHQACID...........DN.VDMVK.FLVEN....G..AN...I.........
HGL_H00000402044    QEE..T.................ALYLATCR...........EH.LDCLL.SLLQA....G..AE...P.........
HGL_H00000281131    NGR..T.................LLANAAYS...........GN.LDVVN.LLVSR....G..AD...L.........
HGL_H00000353518    KGC..Y.................PLHLAAWK...........GD.AQIVR.LLIHQ....G..PShtkV.........
HGL_H00000217958-1  DSR..T.................ALHWACLP...........GH.TEIVE.FLLQL....G..VP...V.........
HGL_H00000388725-1  EGK..T.................AFHLAAAK...........GY.VEYLR.VMFTH....G..VD...V.........
HGL_H00000275015    LYQ..T.................ALHLAVHL...........DQ.PGAVR.ALVLK....G..AS...L.........
HGL_H00000299824-1  DGL..T.................ALHQCCID...........NF.EEIVK.LLLSH....G..AN...V.........
HGL_H00000325355    NGM..R.................PLHYAAWQ...........GR.LEPVR.LLLRA....S..AA...V.........
HGL_H00000369434    SDW..T.................PLMMACTR...........KN.LEVIQ.DLVEH....G..AN...Pllknkdgwn
HGL_H00000338769    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000403397    ENV..T.................LLHWAAIN...........NR.IDLVK.YYISK....G..AI...V.........
HGL_H00000226574    LYQ..T.................PLHLAVIT...........KQ.EDVVE.DLLQA....G..AD...L.........
HGL_H00000349588    KGN..T.................ALHIASLA...........GQ.AEVVK.ILVKE....G..AN...I.........
HGL_H00000382545-2  DGG..T.................ALLAASQY...........GH.RQVVE.TLLKH....G..AN...I.........
HGL_H00000328327-1  GGF..T.................ALHYAAMH...........GR.ARIAR.LMLES....E..YRsdiI.........
HGL_H00000356240    DGL..T.................ALHQACID...........EN.LDMVK.FLVEN....R..AN...V.........
HGL_H00000301030    AGW..T.................ALHEACNR...........GY.YDVAK.QLLAA....G..AE...V.........
HGL_H00000391126-2  DGL..T.................ALHQCCID...........DF.QEMAQ.QLLEA....G..AD...V.........
HGL_H00000351416    TQE..T.................ALTLACCG...........GF.LEVAD.FLIKA....G..AD...I.........
HGL_H00000417980-2  QQR..T.................PLMEAVVN...........NH.LEVAR.YMVQR....G..GC...V.........
HGL_H00000333142    QGL..T.................PLHLACQL...........GK.EEMVR.VLLLC....N..AR...C.........
HGL_H00000411147-1  LGL..T.................PLHRAARA...........GR.AEIAG.HLLDS....G..AQ...V.........
HGL_H00000160373    DGH..S.................ALYSAAKN...........GH.TDCVR.LLLNA....E..AQ...V.........
HGL_H00000350331-2  DSI..T.................PLHAASLQ...........GQ.AQCVQ.LLLAA....G..AQ...V.........
HGL_H00000345436    KGK..TgpeplgqgqkikvrgmrPLHYAAWQ...........GR.KEPMK.LVLKA....G..SA...V.........
HGL_H00000343362    EGR..T.................PVHVAISN...........QH.SVIIQ.LLISHp...D..IH...L.........
HGL_H00000378210    EGF..C.................ALHFAASQ...........GH.WKIAQ.ILLEA....G..AD...P.........
HGL_H00000304292-1  KGY..F.................PIHLAAWK...........GD.VEIVK.ILIHQ....G..PShsrV.........
HGL_H00000314556    EGR..S.................AFHVVASK...........GN.LECLN.AILIH....G..ID...I.........
HGL_H00000263388    TGE..T.................ALHLAARY...........AR.ADAAK.RLLDA....G..AD...T.........
HGL_H00000260047    RGC..T.................PVHLAATH...........GH.SFTLQ.VMLRS....G..VD...P.........
HGL_H00000342295    NGR..L.................PLHAATAE...........PD.VRLLT.VLLQQ....SnlSE...I.........
HGL_H00000261537    RRQ..T.................PLHIAVNK...........GH.LQVVK.TLLDF....G..CH...P.........
HGL_H00000277541-1  TGE..T.................ALHLAARY...........SR.SDAAK.RLLEA....S..AD...A.........
HGL_H00000307298-2  TNS..T.................PLRAACFD...........GR.LDIVK.YLVEN....N..AN...I.........
HGL_H00000386502    ---..-.................-LVQAIFN...........GD.SDEVQ.ALIFK....K..ED...V.........
HGL_H00000347802    ---..-.................-FHLAASK...........GL.TECLS.VLLAN....G..AD...I.........
HGL_H00000296525    DHV..T.................PLHEACLG...........GH.VACAK.TLLEA....G..AN...V.........
HGL_H00000274457-1  EGA..P.................PLWAASAA...........GH.LNVVQ.SLLNH....G..AS...V.........
HGL_H00000262457    SQR..T.................ALHLAAQK...........GN.YRFMK.LLLTR....R..AN...W.........
HGL_H00000256646    TGE..M.................ALHLAARY...........SR.ADAAK.RLLDA....G..AD...A.........
HGL_H00000400113    ENV..S.................LLHWAAIN...........NR.LDLVK.FYISK....G..AV...I.........
HGL_H00000277541-2  TGE..T.................PLHLAARF...........SR.PTAAR.RLLET....G..AN...P.........
HGL_H00000274457-2  EGA..P.................PLWSASAA...........GP.LNVVQ.SLLNH....G..AS...V.........
HGL_H00000262970    EGK..S.................AFHLAAMR...........GA.ASCLE.VMLAQ....G..AN...V.........
HGL_H00000401369    DGK..R.................PLHLCRGP...........GT.LQCAD.LLLRF....G..AQ...V.........
HGL_H00000358983    LHQ..T.................PLHLAVIT...........GQ.TRVVS.FLLQV....G..AD...P.........
HGL_H00000304586    ---..-.................-LHTAASI...........GQ.YEVVK.ECVQRr...E..LD...L.........
HGL_H00000304292-2  EFC..H.................PLCQCPKC...........AP.AQKKL.AKIPAs...G..LG...V.........
HGL_H00000360826    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000360762-1  ---..-.................----AALE...........NK.LPVVV.KFLSD....K..DN...P.........
HGL_H00000275699    FGV..T.................PLGVAAEH...........GH.CDVLE.HLIHK....G..GD...V.........
HGL_H00000325663    NGQ..S.................AFQVAVAA...........NQ.HLIVQ.DLVNL....G..AQ...V.........
HGL_H00000339115    EGA..L.................PLHQAAVS...........GD.LTCLK.LLAAAh...P..RG...V.........
HGL_H00000364158    LGA..S.................VLTVASRG...........GH.LGVVK.LLLEA....G..AF...Vdyhspsseq
HGL_H00000417914    NRV..S.................SLHEACLG...........GH.VACAK.VLLEN....G..AQ...V.........
HGL_H00000306163    ---..-.................---KAAVE...........GK.MKVIE.KFLAD....G..GS...A.........
HGL_H00000337056    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000369855    DQV..S.................PLHEACLG...........GH.PSCAN.MLLRH....G..AQ...V.........
HGL_H00000282272    DGN..T.................PLHVAARY...........GH.ELLIN.TLITS....G..AD...T.........
HGL_H00000370259-3  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000375690    SGE..T.................PLTLAAQTe..........GS.VEVIR.TLCLG....G..AH...I.........
HGL_H00000164227    -GD..T.................PLHIAVVQ...........GN.LPAVH.QLVTLfqhgG..RE...L.........
HGL_H00000263433    DGI..S.................ALHQACID...........EN.LEVVR.FLVEQ....G..AT...V.........
HGL_H00000391126-1  DFW..T.................PMHIACAC...........DN.PDIVL.LLVLA....G..AN...V.........
HGL_H00000357681    ---..-.................--------...........--.--LVK.ILVSS....G..TD...V.........
HGL_H00000360762-2  ---..-.................----AALE...........NK.LPVVV.KFLSD....K..DN...P.........
HGL_H00000357914-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000284629-1  ---..-.................----ALTT...........GD.ISLVE.ELLDS....G..ID...I.........
HGL_H00000320893    ---..-.................--------...........--.HDNVE.DLIRG....G..AD...V.........
HGL_H00000217958-2  DSR..T.................ALHWACLP...........GH.TEIVE.FLLQL....S..VP...V.........
HGL_H00000284629-2  ---..-.................----ALTT...........GD.TSLVE.ELLDS....G..ID...I.........
HGL_H00000269856    TNS..T.................PLRAACFD...........GH.LEVVR.YLVGEh...Q..AD...L.........
HGL_H00000345193-1  SGE..C.................PLSLAAQL...........DNaSDLLK.VLRNG....G..AH...L.........
HGL_H00000304292-2  ---..-.................--------...........--.-----.-----....-..-T...P.........
HGL_H00000276925-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000343362    AQE..T.................PLHLVALYtskkhsaetmsEM.AQIAE.ALLQA....G..AN...P.........
HGL_H00000262209    ANV..S.................PLHHAAAE...........GQ.LELMK.MIISGs...S..CEv..L.........
HGL_H00000217958-3  VFF..T.................PLHITVYY...........GH.EQVTH.LLLKF....G..AD...V.........
HGL_H00000343362    WGE..T.................SLHTACQH...........GL.ANLTA.ELLQQ....G..AN...Pnlqteeavs
HGL_H00000276925-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000320291    LGW..T.................PLHLACYF...........GH.RQVVQ.DLLKA....G..AE...V.........
HGL_H00000262209    DGC..T.................PLHYACKQ...........GV.PVSVN.NLLGF....N..VS...I.........
HGL_H00000321679    ---..-.................---KAAAE...........NQ.DSLID.KYLTD....G..GD...P.........
HGL_H00000371734-2  ---..-.................--------...........--.-----.-----....-..--...I.........
HGL_H00000360689    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000382545-1  HGT..T.................LLMVASYA...........GH.INCVR.ELVLQ....G..AD...I.........
HGL_H00000311579    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000392839    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000252985    KGK..T.................PLLVAAAA...........NQ.PLIVE.DLLNL....G..AE...P.........
HGL_H00000392839    EGK..G.................ILFYCILPtk.........RH.YRCAL.IALEH....G..AD...V.........
HGL_H00000217958-5  DSR..T.................ALHWACLP...........GH.TEIVE.FLLQL....S..VP...V.........
HGL_H00000303518-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000357914-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000296785-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000405112-2  --R..T.................ALHFACTS...........GH.PEVVT.LLVDR....K..CE...I.........
HGL_H00000349612    KHR..T.................ALHFACAY...........GH.PKVVT.LLVKR....K..CD...I.........
HGL_H00000260947    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000403487    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000415252    ---..-.................--------...........--.-----.-----....-..--...V.........
HGL_H00000398321    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000305071    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000379435    WGVpgT.................PLRLAASY...........GH.LSCLQ.VLLAH....G..AD...V.........
HGL_H00000262126    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000264607    KGQ..T.................ALYMAVVN...........GH.LESAQ.ILLEA....G..AD...P.........
HGL_H00000303518-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000331873    KHR..T.................ALHFACAY...........SH.PKVVT.LLVER....K..CD...I.........
HGL_H00000274361    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000282272    ---..-.................--------...........--.--CLE.FLLQH....D..AN...P.........
HGL_H00000414663-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000352358    IWE..S.................PLLLAAKE...........ND.VQALS.KLLKYe...A..CD...V.........
HGL_H00000296785-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000215941-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000352814    ---..-.................--------...........--.-----.-----....-..--...V.........
HGL_H00000386239    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000320076    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000328327-3  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000360998    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000351881    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000265310    -SE..S.................PLLQAAKE...........ND.LCTLKrLLLGQ....S..CD...F.........
HGL_H00000294053    ---..A.................ALMEAART...........NN.VQEVT.RLLSE....G..AD...I.........
HGL_H00000274361    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000340836-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000217958-4  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000353796    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000349140-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000299234    ---..-.................---AAAHA...........GD.LEALQ.ALVEL....G..SG...L.........
HGL_H00000328327-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000303570    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000267339    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000369579    ---..-.................-LHEAARR...........NQ.VGRMK.ELIAR....K..VN...V.........
HGL_H00000368848    ---..-.................--------...........--.-----.----Lm...G..EDc..L.........
HGL_H00000401089    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000350331-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000265140    ---..-.................--------...........--.-----.-----....-..-N...I.........
HGL_H00000414663-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000375751    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000355827-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000314103    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000280758-2  ---..-.................--------...........GR.TDLVK.QAVSLl...G..PDg..I.........
HGL_H00000331065    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000378013    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000261312    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000202556    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000298992    QGM..T.................PLMYACAA...........GD.EAMVQ.MLIDA....G..AN...Ldiqvpnnsl
HGL_H00000307541    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000349140-2  ---..-.................---WALKK...........GD.LDEVK.DYVAK....G..-D...V.........
HGL_H00000371734-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000370259-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000324287    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000346733    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000403902    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000253810    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000384801    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_R00000013095    -DM..T.................RLHQAVAA...........GD.YSAVK.RILKK....Gl.CD...P.........
HGL_H00000277458    TYY..T.................ALHIAVLR...........NQ.PDMVE.LLVRH....G..AD...I.........
HGL_H00000335147    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000158762    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000303518-3  ---..-.................-LHTAASI...........GQ.YEVVK.ECVQWr...E..LD...L.........
HGL_H00000299824-2  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000356685    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000240361    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000265742    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000320340    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000308772    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000349041    EGQ..T.................ALHQSVID...........GN.LELVK.LLVKF....G..AD...I.........
HGL_H00000378338    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000367705    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000396078    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000419199    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000385887    ---..-.................--------...........--.---IK.LLLHR....G..AD...P.........
HGL_H00000396747    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_M00000098100    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000365830    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000407057    KGN..T.................ALHIAALA...........GQ.NEVVR.ELVNY....G..AN...V.........
HGL_H00000350331-3  ---..-.................-LHEYVKQ...........GN.YVKVK.KILKK....G..IY...V.........
HGL_H00000368859    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000347464    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000274457-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000230792    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000310447    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000353732    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000305721    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000359982    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000382659    KGQ..T.................ALHIAIER...........RN.MALVT.LLVEN....G..AD...Vqaaangdff
HGL_H00000269856    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000317379    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000261740    RGQ..T.................ALHIAIER...........RC.KHYVE.LLVAQ....G..AD...Vhaqargrff
HGL_H00000386897    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000340913-2  ---..-.................----AAEY...........GN.IPVVR.KMLEEcl..S..LN...V.........
HGL_H00000378328    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000386532    ---..S.................PLRVAAAH...........GH.AACVR.DLLRR....G..AN...P.........
HGL_H00000261739    RGR..T.................LLHLAVSL...........GH.LESAR.VLLRH....K..AD...V.........
HGL_H00000215941-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000334879    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000380413    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000368966    MGQ..N.................ALQLAVGN...........EH.LEVTE.LLLKK....E..NL...A.........
HGL_H00000328160    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000262839    LGR..S.................ALLIAIEN...........EN.LEIME.LLLNH....S..V-...-.........
HGL_H00000343362    ---..-.................--------...........--.-----.-----....-..-D...F.........
HGL_H00000369003    LGR..T.................ALLIAIEN...........EN.LELIE.LLLSF....N..VY...V.........
HGL_H00000232744    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000419313    LGR..N.................AITITIEN...........EN.LDILQ.LLLDY....G..--...-.........
HGL_H00000161863    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000402616-1  RGR..T.................PLELAVSL...........GN.LESVR.VLLRH....N..AN...V.........
HGL_M00000035452    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000416826    ---..-.................--------...........--.--LLG.LLIDN....G..AL...P.........
HGL_H00000373600    ---..-.................---TAYKQ...........GD.LSRAR.DLLRQ....A..CE...D.........
HGL_H00000321813    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_M00000056646    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000385887    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000387907    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000416826    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_N10020562       ---..-.................--------...........--.-----.-----....-..--...Pefmklmypd
HGL_H00000350686    ---..-.................-MHVAAKA...........NQ.ASICQ.LTLET....L..EN...Pefmqlmypd
HGL_H00000321627    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000386337    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000378871    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_N000000797401   ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000307298-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000340913-1  ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000320509    ---..-.................--------...........--.-----.-----....-..--...-.........
HGL_H00000262547    ---..-.................--------...........--.-----.-----....-..--...-.........


                                                                        110                      120
                                                                          |                        |
d2fo1e1               ..........................TIY..NKS...........ER....SALHQAA......ANR.......D..F
HGL_H00000312988    ..........................LVG..ERG...........GH....TALHLAC......RVR.......A..S
HGL_H00000407057    ..........................HSP..AWN...........GY....TPLHIAA......KQN.......Q..M
HGL_H00000280772    ..........................DAA..GKS...........GL....TPLHVAA......HYD.......N..Q
HGL_H00000349588    ..........................NIV..TRQ...........GV....TPLHLAS......QEG.......H..M
HGL_H00000281131    ..........................NEI..DND...........GR....IPFILAS......QEG.......H..Y
HGL_H00000280772    ..........................DFT..ARN...........DI....TPLHVAS......KRG.......N..A
HGL_H00000407057    ......aarnddtrtaavllqndpnpDVL..SKT...........GF....TPLHIAA......HYE.......N..L
HGL_H00000306678    ..........................DAL..DQS...........GY....SPLHIAA......ACS.......K..Y
HGL_H00000282272    ..........................NVS..DRG...........GR....TALHHAA......LNG.......H..V
HGL_H00000267116    ..........................GCK..DRK...........GY....GLLHTAA......ASG.......Q..I
HGL_H00000256707    ..........................SVT..GLY...........SV....YPIIWAA......GRG.......H..A
HGL_H00000411147-2  ..........................NEY..DSN...........GF....TAFMEAA......EQG.......N..A
HGL_H00000351416    ..........................NAQi.ETN...........RN....TALTLAC......FQG.......R..T
HGL_H00000330161    ..........................GLQ..GKD...........AW....VPLHYAA......WQG.......H..L
HGL_H00000253810    ..........................NAQi.ETN...........RN....TALTLAC......FQG.......R..A
HGL_H00000351416    ..........................NTHs.NEF...........KE....SALTLAC......YKG.......H..L
HGL_H00000374171    ..........................AQP..NRR...........GA....VPLFSTV......RQG.......H..W
HGL_H00000373287    ..........................NKK..DKF...........GR....SPLHYAA......ANC.......N..Y
HGL_H00000262457    ..........................DAT..DVM...........KH....TPLFRAC......EMG.......H..K
HGL_H00000263635    ..........................SRM..NKR...........GV....PPLFCAA......RQG.......H..W
HGL_H00000386135    ..........................NFQ..DKE...........EE....TPLHCAA......WHG.......Y..Y
HGL_H00000373287    ..........................LLR..DSR...........GR....TPIHLSA......ACG.......H..I
HGL_H00000267116    vsplhlaaynghcealktlaetlvnlDVR..DHK...........GR....TALFLAT......ERG.......S..T
HGL_H00000349588    ..........................DAK..TRD...........GL....TPLHCAA......RSG.......H..D
HGL_H00000417980-1  ..........................DPK..DAE...........GS....TCLHLAA......KKG.......H..Y
HGL_H00000216797    ..........................ELR..DFR...........GN....TPLHLAC......EQG.......C..L
HGL_H00000369579    ..........................NVA..DYQ...........GT....SPLHLAV......RHN.......F..P
HGL_H00000373287    ..........................NAR..DKN...........WQ....TPLHIAA......ANK.......A..V
HGL_H00000345767    ..........................DRQ..DKD...........GN....TALHEAS......WHG.......F..S
HGL_H00000311579    .........aaqmgneavqqilsestPIR..TSD...........VD....YRLLEAS......KAG.......D..L
HGL_H00000360689    ..........................NAL..DNL...........GQ....TSLHRAA......HCG.......H..L
HGL_H00000350297    ..........................---..---...........--....-------......---.......-..-
HGL_H00000267116    ..........................LCR..DFK...........GR....TPIHLAS......ACG.......H..T
HGL_H00000360689    ..........................NAR..DNW...........NY....TPLHEAA......IKG.......K..I
HGL_H00000311579    ..........................NAR..DNW...........NY....TPLHEAA......IKG.......K..I
HGL_H00000345065    ..........................LEK..DKE...........GN....TALHLAA......MHG.......H..S
HGL_H00000282272    ..........................LCR..DFR...........GR....TPLHYAA......ARG.......H..A
HGL_H00000281419    ..........................---..---...........--....-------......---.......-..-
HGL_H00000348081    ..........................NLP..DAH...........AD....TPLHSAI......SAGag.....A..S
HGL_H00000388725-2  ..........................TVQ..DTT...........GH....SALHLAA......KNG.......H..H
HGL_H00000389168    ..........................NQP..DNE...........GW....IPLHAAA......SCG.......Y..L
HGL_H00000402044    ..........................DIS..NKS...........RE....TPLYKAC......ERK.......N..T
HGL_H00000281131    ..........................EIE..DAH...........GH....TPLTLAA......RQG.......H..T
HGL_H00000353518    ..........................NEQ..NND...........NE....TALHCAA......QYG.......H..R
HGL_H00000217958-1  ..........................NDK..DDA...........GW....SPLHIAA......SAG.......R..D
HGL_H00000388725-1  ..........................TVQ..DTT...........GH....SALHLAA......KNG.......H..H
HGL_H00000275015    ..........................ALQ..DRH...........GD....TALHVAC......QRQ.......H..L
HGL_H00000299824-1  ..........................NAK..DNE...........LW....TPLHAAA......TCG.......H..I
HGL_H00000325355    ..........................NAA..SLD...........GQ....IPLHLAA......QYG.......H..Y
HGL_H00000369434    .sfhiasregnplilqylltvcpdawKTE..SKI...........RR....TPLHTAA......MHG.......C..L
HGL_H00000338769    ..........................---..---...........--....-------......---.......-..-
HGL_H00000403397    ..........................DQL..GGDl..........NS....TPLHWAT......RQG.......H..L
HGL_H00000226574    ..........................SLL..DRL...........GN....SALHLAT......KEG.......Q..D
HGL_H00000349588    ..........................NAQ..SQN...........GF....TPLYMAA......QEN.......H..I
HGL_H00000382545-2  ..........................HDH..LYD...........GA....TALFLAA......QGG.......Y..L
HGL_H00000328327-1  ..........................NAK..SND...........GW....TPLHVAA......HYG.......R..D
HGL_H00000356240    ..........................NQQ..DNE...........GW....TPLHAAA......SCG.......Y..L
HGL_H00000301030    ..........................NTK..GLD...........DD....TPLHDAA......NNG.......H..Y
HGL_H00000391126-2  ..........................NAQ..DSE...........CW....TPLHAAA......TCG.......H..L
HGL_H00000351416    ..........................ELG..---...........CS....TPLMEAA......QEG.......H..L
HGL_H00000417980-2  ..........................YSK..EED...........GS....TCLHHAA......KIG.......N..L
HGL_H00000333142    ..........................NVV..-GP...........GG....YPIHTAM......KFS.......Q..K
HGL_H00000411147-1  ..........................NAA..GWL...........HK....TPLHLAT......EHN.......Q..R
HGL_H00000160373    ..........................NAA..DKN...........GF....TPLCAAA......AQG.......H..F
HGL_H00000350331-2  ..........................DAR..NID...........GS....TPLCDAC......ASG.......S..I
HGL_H00000345436    ..........................NVP..SDE...........GH....IPLHLAA......QHG.......H..Y
HGL_H00000343362    ..........................NVR..DRQ...........GL....TPFACAM......TYK.......N..N
HGL_H00000378210    ..........................NAT..TLE...........ET....TPLFLGD......--E.......N..V
HGL_H00000304292-1  ..........................NEQ..NNE...........NE....TALHCAA......QYG.......H..S
HGL_H00000314556    ..........................TTS..DSV...........GR....NALHLAA......KYG.......H..A
HGL_H00000263388    ..........................NAQ..DHS...........GR....TPLHTAV......TAD.......A..Q
HGL_H00000260047    ..........................SVT..DKR...........EW....KSVHYAA......FHG.......R..L
HGL_H00000342295    ..........................NHQ..DNE...........GM....TPLHWAA......FHN.......Q..P
HGL_H00000261537    ..........................SLQ..DSE...........GD....TPLHDAI......SKK.......R..D
HGL_H00000277541-1  ..........................NIQ..DNM...........GR....TPLHAAV......SAD.......A..Q
HGL_H00000307298-2  ..........................SIA..NKY...........DN....TCLMIAA......YKG.......H..T
HGL_H00000386502    ..........................NFQ..DNE...........KR....TPLHAAA......YLE.......D..A
HGL_H00000347802    ..........................NSK..NED...........GS....TALHLAT......ISC.......Q..P
HGL_H00000296525    ..........................NAI..TID...........GV....TPLFNAC......SQG.......S..A
HGL_H00000274457-1  ..........................NNT..TLT...........NS....TPLRAAC......FDG.......H..L
HGL_H00000262457    ..........................MQK..DLE...........EM....TPLHLTT......RHK.......S..P
HGL_H00000256646    ..........................NAQ..DNM...........GR....CPLHAAV......AAD.......A..Q
HGL_H00000400113    ..........................DQL..GGDl..........NS....TPLHWAI......RQG.......H..L
HGL_H00000277541-2  ..........................NQP..DRA...........GR....TPLHTAV......AAD.......A..R
HGL_H00000274457-2  ..........................NNT..TLT...........NS....TPLRAAC......FDG.......H..L
HGL_H00000262970    ..........................MST..DGA...........GY....IALHLAA......KYG.......H..P
HGL_H00000401369    ..........................DGR..SEEe..........EE....TPLHTAA......RLG.......H..V
HGL_H00000358983    ..........................ALL..DRH...........GD....SAMHLAL......RAGvg.....A..P
HGL_H00000304586    ..........................NKK..NGG...........GW....TPLMYAS......YIG.......H..D
HGL_H00000304292-2  ..........................NVT..NQD...........GS....SPLHIAA......LHG.......R..A
HGL_H00000360826    ..........................---..---...........--....--LASAA......ARG.......D..L
HGL_H00000360762-1  ..........................DVC..DEY...........KR....TALHRAC......LEG.......H..L
HGL_H00000275699    ..........................FAL..ADD...........GA....SVLFEAA......GGG.......N..P
HGL_H00000325663    ..........................NTT..DCW...........GR....TPLHVCA......EKG.......H..S
HGL_H00000339115    ..........................NRQ..TRS...........GA....SPLYLAC......QEG.......H..L
HGL_H00000364158    .....................lglggGRD..ELL...........DI....TALMAAV......QHG.......H..E
HGL_H00000417914    ..........................NAV..TVH...........GA....TPLFNAC......CSG.......S..A
HGL_H00000306163    ..........................DTC..DEF...........HR....TALHRAS......LEG.......H..M
HGL_H00000337056    ..........................---..---...........--....----GAA......ARG.......D..V
HGL_H00000369855    ..........................NAV..TTD...........WH....TPLFSAC......ISG.......S..V
HGL_H00000282272    ..........................AKC..GIH...........SM....FPLHLAA......LNA.......H..S
HGL_H00000370259-3  ..........................---..---...........--....--LLEAA......RAG.......Q..D
HGL_H00000375690    ..........................DFR..ARD...........GM....TALHKAA......CAR.......H..C
HGL_H00000164227    ..........................DVY..NNL...........RQ....TPLHLAV......ITT.......L..P
HGL_H00000263433    ..........................NQA..DNE...........GW....TPLHVAA......SCG.......Y..L
HGL_H00000391126-1  ..........................FLQ..DVN...........GN....IPLDYAV......EGT.......E..S
HGL_H00000357681    ..........................NLK..NGS...........GK....DSLMLAC......YEG.......H..L
HGL_H00000360762-2  ..........................DVC..DEY...........KR....TALHRAC......LEG.......H..L
HGL_H00000357914-1  ..........................---..---...........--....--LLEAA......RKG.......Q..D
HGL_H00000284629-1  ..........................ESI..FCY...........GW....TPLMYAA......SVA.......N..I
HGL_H00000320893    ..........................NCT..-HG...........TL....KPLHCAC......MVS.......D..A
HGL_H00000217958-2  ..........................NDK..DDA...........GW....SPLHIAA......SAG.......R..D
HGL_H00000284629-2  ..........................ESI..FCY...........GW....TPLTYAA......SVA.......N..I
HGL_H00000269856    ..........................EVA..NRH...........GH....TCLMISC......YKG.......H..R
HGL_H00000345193-1  ..........................DFR..TRD...........GL....TAVHCAT......RQR.......N..A
HGL_H00000304292-2  ..........................FSR..DDR...........GH....TPLHVAA......LCG.......Q..A
HGL_H00000276925-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000343362    ..........................NMQ..DSK...........GR....TPLHLSI......MAR.......N..E
HGL_H00000262209    ..........................NVM..DSY...........GN....TPLHWAA......ENN.......Q..V
HGL_H00000217958-3  ..........................NVS..GEV...........GD....RPLHLAS......AKG.......F..F
HGL_H00000343362    ................lskaavsltgSMD..SVY...........LQ....TPLHMAI......AYN.......H..P
HGL_H00000276925-2  ..........................---..---...........--....-------......---.......-..-
HGL_H00000320291    ..........................NVL..NDM...........GD....TPLHRAA......FTG.......R..K
HGL_H00000262209    ..........................HSK..SKD...........KK....SPLHFAA......SYG.......R..I
HGL_H00000321679    ..........................SAH..DKL...........HR....TALHWAC......LKG.......H..S
HGL_H00000371734-2  ..........................NMA..DGN...........GN....TALHYSV......SHS.......N..F
HGL_H00000360689    ..........................---..---...........GD....AALLDAA......KKG.......C..L
HGL_H00000382545-1  ..........................NLQ..KES...........GK....TALFFAA......HQD.......H..N
HGL_H00000311579    ..........................---..---...........GD....AALLDAA......KKG.......C..L
HGL_H00000392839    ..........................---..---...........--....-------......---.......-..-
HGL_H00000252985    ..........................NAT..DHQ...........GR....SVLHVAA......TYG.......L..P
HGL_H00000392839    ..........................NNS..TYD...........GK....PVFLRAC......EEA.......HdiR
HGL_H00000217958-5  ..........................NDK..DDA...........GW....SPLHIAA......SAG.......R..D
HGL_H00000303518-2  ..........................---..---...........--....KLLLWAA......EKN.......R..L
HGL_H00000357914-2  ..........................---..---...........--....--LLEAA......GKG.......Q..D
HGL_H00000296785-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000405112-2  ..........................NAC..DSE...........NS....TPLIKAV......QCH.......Q..E
HGL_H00000349612    ..........................NAC..DSE...........NS....TALIKAV......QWH.......Q..E
HGL_H00000260947    ..........................---..---...........--....-------......---.......-..-
HGL_H00000403487    ..........................---..---...........--....-------......REG.......N..A
HGL_H00000415252    ..........................NIA..DSN...........GN....TALHYSV......SHA.......N..F
HGL_H00000398321    ..........................---..---...........--....--IWSAA......LDG.......D..L
HGL_H00000305071    ..........................---..---...........--....-------......---.......L..S
HGL_H00000379435    ..........................DSL..DVK...........AQ....TPLFTAV......SHG.......H..L
HGL_H00000262126    ..........................---..---...........--....-------......---.......-..-
HGL_H00000264607    ..........................NGS..RHH...........RS....TPVYHAS......RVG.......R..A
HGL_H00000303518-1  ..........................---..---...........--....--LLWAA......EKN.......Q..L
HGL_H00000331873    ..........................NAC..DSE...........NS....TALIKAV......QWH.......Q..E
HGL_H00000274361    ..........................---..---...........--....-------......---.......-..-
HGL_H00000282272    ..........................SIR..DKE...........GY....NSIHYAA......AYG.......H..R
HGL_H00000414663-2  ..........................---..---...........--....--LRDAV......KNG.......D..Y
HGL_H00000352358    ..........................HQR..GAM...........GE....TALHIAA......LYD.......N..L
HGL_H00000296785-2  ..........................---..---...........--....-------......---.......-..-
HGL_H00000215941-2  ..........................---..---...........--....-------......NAN.......D..-
HGL_H00000352814    ..........................NLA..DDN...........GN....TALHYSV......SHG.......N..L
HGL_H00000386239    ..........................---..---...........--....-------......---.......-..-
HGL_H00000320076    ..........................---..---...........--....---HRAA......RDG.......Y..L
HGL_H00000328327-3  ..........................---..---...........--....-------......---.......-..-
HGL_H00000360998    ..........................---..---...........--....---CQAA......YQN.......D..F
HGL_H00000351881    ..........................---..---...........--....-PLLQAC......IDG.......D..F
HGL_H00000265310    ..........................RQR..GAL...........GE....TALHVAT......LYD.......N..L
HGL_H00000294053    ..........................NAR..HKL...........GW....TALMVAA......INR.......N..D
HGL_H00000274361    ..........................---..---...........--....-------......---.......-..-
HGL_H00000340836-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000217958-4  ..........................---..-VI...........SQ....PFLRSAT......MWE.......A..E
HGL_H00000353796    ..........................---..---...........GF....TAIHFVA......QRG.......K..F
HGL_H00000349140-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000299234    ..........................CLQ..DPN...........GQ....TLLHAAA......RRG.......H..V
HGL_H00000328327-2  ..........................---..---...........--....-------......---.......-..-
HGL_H00000303570    ..........................---..---...........--....-------......---.......-..-
HGL_H00000267339    ..........................---..---...........--....-------......---.......-..-
HGL_H00000369579    ..........................RVR..NHV...........GR....VALHWAA......GAG.......H..E
HGL_H00000368848    ..........................NER..NAE...........KL....TPAGLAI......KNG.......Q..L
HGL_H00000401089    ..........................---..---...........--....-------......---.......-..-
HGL_H00000350331-1  ..........................---..---...........--....TPMHKAA......YQG.......E..S
HGL_H00000265140    ..........................HKT..NLK...........GE....TALHRAC......ISN.......K..V
HGL_H00000414663-1  ..........................---..---...........--....--LRDAV......KNG.......D..Y
HGL_H00000375751    ..........................---..---...........--....-------......---.......-..-
HGL_H00000355827-2  ..........................---..---...........--....-------......---.......-..-
HGL_H00000314103    ..........................---..---...........--....-------......---.......-..-
HGL_H00000280758-2  ..........................NTM..SEQ...........GM....TPLMYAC......VRG.......D..E
HGL_H00000331065    ..........................---..---...........--....-------......---.......-..-
HGL_H00000378013    ..........................---..---...........--....-------......---.......-..-
HGL_H00000261312    ..........................---..---...........--....-------......---.......-..-
HGL_H00000202556    ..........................---..---...........--....-------......---.......-..-
HGL_H00000298992    ......................rhpsVHP..DSR...........HW....TSLTFAV......LHG.......H..I
HGL_H00000307541    ..........................---..---...........GE....TLLQRAA......RLG.......Y..K
HGL_H00000349140-2  ..........................NRT..LEA...........GR....KPLHYAA......DCG.......Q..L
HGL_H00000371734-1  ..........................NMA..NAK...........GN....TALHYSM......AHS.......N..F
HGL_H00000370259-2  ..........................---..---...........--....-------......---.......-..-
HGL_H00000324287    ..........................---..---...........--....-------......---.......-..-
HGL_H00000346733    ..........................---..---...........--....-------......---.......-..-
HGL_H00000403902    ..........................---..---...........--....-------......---.......-..-
HGL_H00000253810    ..........................---..---...........--....-------......---.......-..-
HGL_H00000384801    ..........................---..---...........--....-------......---.......-..-
HGL_R00000013095    ..........................NHKdaDWH...........DR....TPLHWAA......IRGgqvaprqS..P
HGL_H00000277458    ..........................NRR..DRGrqlslslplssGK....TALLHALassdgvQVH.......N..T
HGL_H00000335147    ..........................---..---...........--....-------......---.......-..-
HGL_H00000158762    ..........................---..---...........--....-------......---.......-..-
HGL_H00000303518-3  ..........................NKK..NGG...........GW....TPLMYAS......YIG.......H..D
HGL_H00000299824-2  ..........................---..---...........--....-------......---.......-..-
HGL_H00000356685    ..........................---..---...........--....-------......---.......-..-
HGL_H00000240361    ..........................---..---...........--....-------......---.......-..-
HGL_H00000265742    ..........................---..---...........--....-------......---.......-..-
HGL_H00000320340    ..........................---..---...........--....-------......---.......-..-
HGL_H00000308772    ..........................---..---...........--....-------......---.......-..-
HGL_H00000349041    ..........................RLA..NRD...........GW....SALHIAA......FGG.......H..Q
HGL_H00000378338    ..........................---..---...........--....-------......---.......-..-
HGL_H00000367705    ..........................---..---...........--....-------......---.......-..-
HGL_H00000396078    ..........................---..---...........--....-------......---.......-..-
HGL_H00000419199    ..........................---..--S...........GI....NPVHCAA......AGA.......H..T
HGL_H00000385887    ..........................NLC..-CV...........PM....RALFFAV......KAG.......D..V
HGL_H00000396747    ..........................---..---...........--....-------......---.......-..-
HGL_M00000098100    ..........................---..---...........--....-------......---.......-..-
HGL_H00000365830    ..........................---..---...........--....-------......---.......-..-
HGL_H00000407057    ..........................N--..---...........--....-------......---.......-..-
HGL_H00000350331-3  ..........................DAV..NSL...........GQ....TVLFVAT......LLG.......L..T
HGL_H00000368859    ..........................---..---...........--....-------......---.......-..-
HGL_H00000347464    ..........................---..---...........--....-------......---.......-..-
HGL_H00000274457-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000230792    ..........................---..---...........--....-------......---.......-..-
HGL_H00000310447    ..........................---..---...........--....-------......---.......-..-
HGL_H00000353732    ..........................---..---...........--....-------......---.......-..-
HGL_H00000305721    ..........................---..---...........--....-------......---.......-..-
HGL_H00000359982    ..........................---..---...........--....-------......---.......-..-
HGL_H00000382659    .....................kktkgRPG..FYF...........GE....LPLSLAA......CTN.......Q..L
HGL_H00000269856    ..........................---..---...........--....-------......---.......-..-
HGL_H00000317379    ..........................---..---...........--....-------......---.......-..-
HGL_H00000261740    .....................qpkdeGGY..FYF...........GE....LPLSLAA......CTN.......Q..P
HGL_H00000386897    ..........................---..---...........--....-------......---.......-..-
HGL_H00000340913-2  ..........................NCV..DYM...........GQ....NALQLAV......ANE.......H..L
HGL_H00000378328    ..........................---..---...........--....-------......---.......-..-
HGL_H00000386532    ..........................NAS..-PG...........AR....GALHEAC......LGG.......H..T
HGL_H00000261739    ..........................TKE..NSQ...........GWtgkyTFLHEAV......STG.......D..P
HGL_H00000215941-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000334879    ..........................---..---...........--....-------......---.......-..-
HGL_H00000380413    ..........................---..---...........--....-------......---.......-..-
HGL_H00000368966    ..........................RIG..D--...........--....-ALLLAI......SKG.......Y..V
HGL_H00000328160    ..........................---..---...........--....-------......---.......-..-
HGL_H00000262839    ..........................---..--Y...........MG....DALLYAI......RKE.......V..V
HGL_H00000343362    ..........................AAV..DEN...........GN....NALHLAV......MHG.......R..L
HGL_H00000369003    ..........................GD-..---...........--....-ALLHAI......RKE.......V..V
HGL_H00000232744    ..........................---..---...........--....-------......---.......-..-
HGL_H00000419313    ..........................---..-CQ...........SA....DALLVAI......DSE.......V..V
HGL_H00000161863    ..........................---..---...........--....-------......---.......-..-
HGL_H00000402616-1  ..........................GKE..SRQ...........GW....AVLQEAV......STG.......D..P
HGL_M00000035452    ..........................---..---...........--....-------......---.......-..-
HGL_H00000416826    ..........................EGL..QGS...........QQ....KPILMCL......QNE.......E..F
HGL_H00000373600    ..........................STS..QLE...........KG....QLLSISA......AHG.......D..L
HGL_H00000321813    ..........................---..---...........GM....SLLHLAA......AQG.......Y..A
HGL_M00000056646    ..........................---..---...........--....-------......---.......-..-
HGL_H00000385887    ..........................---..---...........--....-------......---.......-..-
HGL_H00000387907    ..........................---..---...........--....-------......---.......-..-
HGL_H00000416826    ..........................---..---...........--....-------......---.......-..-
HGL_N10020562       ........ddmgmlqeriqylvdlylNTP..DKG...........YD....TPLHFAC......KFG.......N..V
HGL_H00000350686    ........ddmgmlqeriqylvdlylNTP..DKV...........GYd...TPLHFAC......KFG.......N..V
HGL_H00000321627    ..........................---..---...........--....EAMFEAV......EQQ.......D..M
HGL_H00000386337    ..........................---..---...........--....-------......---.......-..-
HGL_H00000378871    ..........................---..---...........--....-------......---.......-..-
HGL_N000000797401   ..........................---..---...........--....-------......---.......-..-
HGL_H00000307298-1  ..........................---..---...........--....-------......---.......-..-
HGL_H00000340913-1  ..........................---..---...........--....--LNLAI......RLG.......H..E
HGL_H00000320509    ..........................---..---...........--....-------......---.......-..-
HGL_H00000262547    ..........................---..---...........--....-------......---.......-..-


                               130                                                                  
                                 |                                                                  
d2fo1e1               G..MMVYMLNSTK.................................................................
HGL_H00000312988    A..CARVLLQPRPqeapcsyltqsrdrtcdtshnpaalhpepelekeeeeseed........................
HGL_H00000407057    E..VARSLLQY--.................................................................
HGL_H00000280772    K..VALLLLDQ--.................................................................
HGL_H00000349588    D..MVTLLLDK--.................................................................
HGL_H00000281131    D..CVQILLEN--.................................................................
HGL_H00000280772    N..MVKLLLDR--.................................................................
HGL_H00000407057    S..VAQLLLNR--.................................................................
HGL_H00000306678    L..ICKMLLRY--.................................................................
HGL_H00000282272    E..MVNLLLAK--.................................................................
HGL_H00000267116    E..VVKYLLRM--.................................................................
HGL_H00000256707    D..IVYLLLQN--.................................................................
HGL_H00000411147-2  E..ALKFLYES--.................................................................
HGL_H00000351416    E..VVSLLLDR--.................................................................
HGL_H00000330161    A..IVKLLARQP-.................................................................
HGL_H00000253810    E..VVSLLLDR--.................................................................
HGL_H00000351416    E..MVRFLLEA--.................................................................
HGL_H00000374171    Q..IVDLLLTH--.................................................................
HGL_H00000373287    Q..CLFALVGS--.................................................................
HGL_H00000262457    D..VIQTLIKG--.................................................................
HGL_H00000263635    Q..IVRLLLEH--.................................................................
HGL_H00000386135    S..VARALCEA--.................................................................
HGL_H00000373287    G..VLGALLQSASs................................................................
HGL_H00000267116    E..CVEVLTAH--.................................................................
HGL_H00000349588    Q..VVELLLER--.................................................................
HGL_H00000417980-1  D..VVQYLLSNG-.................................................................
HGL_H00000216797    A..SVGVLTQTC-.................................................................
HGL_H00000369579    A..LVELLIDA--.................................................................
HGL_H00000373287    K..CAEALVPL--.................................................................
HGL_H00000345767    Q..SAKLLVKA--.................................................................
HGL_H00000311579    E..TVKQLCSP--.................................................................
HGL_H00000360689    Q..TCRLLLSY--.................................................................
HGL_H00000350297    -..----------.................................................................
HGL_H00000267116    A..VLRTLLQA--.................................................................
HGL_H00000360689    D..VCIVLLQHGAestirntdgrtaldladpsakavltgeykkdellesarsgneekmmalltp..............
HGL_H00000311579    D..VCIVLLQH--.................................................................
HGL_H00000345065    P..AVQVLLTQ--.................................................................
HGL_H00000282272    T..WLSELLQMAL.................................................................
HGL_H00000281419    -..----------.................................................................
HGL_H00000348081    G..IVKVLTEVP-.................................................................
HGL_H00000388725-2  E..CIRKLLQS--.................................................................
HGL_H00000389168    D..IAEFLIGQ--.................................................................
HGL_H00000402044    E..AVRLLVQH--.................................................................
HGL_H00000281131    K..VVNCLIGC--.................................................................
HGL_H00000353518    E..VVKVLLEE--.................................................................
HGL_H00000217958-1  E..IVKALLGK--.................................................................
HGL_H00000388725-1  E..CIRKLLQS--.................................................................
HGL_H00000275015    A..CAHCLLEGQPepgrrpa..........................................................
HGL_H00000299824-1  N..LVKILVQY--.................................................................
HGL_H00000325355    E..VSEMLLQH--.................................................................
HGL_H00000369434    E..AVKVLLTRC-.................................................................
HGL_H00000338769    -..----------.................................................................
HGL_H00000403397    S..MVVQLMKY--.................................................................
HGL_H00000226574    G..ILSILLKHRK.................................................................
HGL_H00000349588    D..VVKYLLEN--.................................................................
HGL_H00000382545-2  D..VIRLLLSS--.................................................................
HGL_H00000328327-1  S..FVRLLLEF--.................................................................
HGL_H00000356240    N..IAEYFINH--.................................................................
HGL_H00000301030    K..VG-------Isppptpaqspnfrailwlqkqgperkrikkepvarksgllfgmglsgiragyplserqqvallmq
HGL_H00000391126-2  H..LVELLISR--.................................................................
HGL_H00000351416    E..LVKYLLAA--.................................................................
HGL_H00000417980-2  E..MVSLLLSTG-.................................................................
HGL_H00000333142    G..CAEMIISMD-.................................................................
HGL_H00000411147-1  A..TVELLLSR--.................................................................
HGL_H00000160373    E..CVELLIAY--.................................................................
HGL_H00000350331-2  E..CVKLLLSY--.................................................................
HGL_H00000345436    D..VSEMLLQH--.................................................................
HGL_H00000343362    K..AAEAILKRE-.................................................................
HGL_H00000378210    E..IIKLLLKK--.................................................................
HGL_H00000304292-1  E..VVAVLLEE--.................................................................
HGL_H00000314556    L..CLQKLLQY--.................................................................
HGL_H00000263388    G..VFQILIRNR-.................................................................
HGL_H00000260047    G..CLQLLIKW--.................................................................
HGL_H00000342295    Q..HTQMLLKK--.................................................................
HGL_H00000261537    D..ILAVLLEA--.................................................................
HGL_H00000277541-1  G..VFQILIRNR-.................................................................
HGL_H00000307298-2  D..VVRYLLEQ--.................................................................
HGL_H00000386502    E..IIELLILS--.................................................................
HGL_H00000347802    Q..CVKILLQH--.................................................................
HGL_H00000296525    S..CTELLLEY--.................................................................
HGL_H00000274457-1  E..IVKYLVEH--.................................................................
HGL_H00000262457    K..CLALLLKFMA.................................................................
HGL_H00000256646    G..VFQILIRNR-.................................................................
HGL_H00000400113    P..MVILLLQH--.................................................................
HGL_H00000277541-2  E..VCQLLLSSR-.................................................................
HGL_H00000274457-2  E..IMKYLVEH--.................................................................
HGL_H00000262970    Q..CLKQLLQA--.................................................................
HGL_H00000401369    E..LADLLLRR--.................................................................
HGL_H00000358983    G..LLRALLQS--.................................................................
HGL_H00000304586    T..IVHLLLEA--.................................................................
HGL_H00000304292-2  D..LVPLLLKH--.................................................................
HGL_H00000360826    E..QLTSLLQN--.................................................................
HGL_H00000360762-1  A..IVEKLIEA--.................................................................
HGL_H00000275699    D..CIALLLEY--.................................................................
HGL_H00000325663    Q..VLQAIQKGVVrsn..............................................................
HGL_H00000339115    H..LAQFLVKDC-.................................................................
HGL_H00000364158    A..VVRLLLEW--.................................................................
HGL_H00000417914    A..CVNVLLEF--.................................................................
HGL_H00000306163    E..ILEKLLGN--.................................................................
HGL_H00000337056    Q..EVRRLLYRE-.................................................................
HGL_H00000369855    D..CVNLLLQH--.................................................................
HGL_H00000282272    D..CCRKLLSS--.................................................................
HGL_H00000370259-3  D..EVRILMAN--.................................................................
HGL_H00000375690    L..ALTALLDL--.................................................................
HGL_H00000164227    S..AVWLLVSA--.................................................................
HGL_H00000263433    D..IARYLLSH--.................................................................
HGL_H00000391126-1  SsiLLAYLDEN--.................................................................
HGL_H00000357681    D..VVKYLRRH--.................................................................
HGL_H00000360762-2  A..TVEKLIEA--.................................................................
HGL_H00000357914-1  D..EVRTLMAN--.................................................................
HGL_H00000284629-1  E..LVRVLLDR--.................................................................
HGL_H00000320893    D..CVELLLEK--.................................................................
HGL_H00000217958-2  E..IVKALLGK--.................................................................
HGL_H00000284629-2  E..LVRVLLDR--.................................................................
HGL_H00000269856    E..IARYLLEQ--.................................................................
HGL_H00000345193-1  G..ALTTLLDL--.................................................................
HGL_H00000304292-2  S..LIDLLVSK--.................................................................
HGL_H00000276925-1  -..----------.................................................................
HGL_H00000343362    Y..VFNQLLQCK-.................................................................
HGL_H00000262209    E..SVKFLLTQ--.................................................................
HGL_H00000217958-3  N..IAKLLMEDGN.................................................................
HGL_H00000343362    D..VVSVILEQ--.................................................................
HGL_H00000276925-2  -..----------.................................................................
HGL_H00000320291    E..LVMLLLEY--.................................................................
HGL_H00000262209    N..TCQRLLQDIS.................................................................
HGL_H00000321679    Q..LVSKLLAA--.................................................................
HGL_H00000371734-2  E..IVKLLLDAD-.................................................................
HGL_H00000360689    A..RVKKLSSPD-.................................................................
HGL_H00000382545-1  D..VVRFLFGF--.................................................................
HGL_H00000311579    A..RVQKLCTPE-.................................................................
HGL_H00000392839    -..-LKKAFES--.................................................................
HGL_H00000252985    S..VLSAVFKS--.................................................................
HGL_H00000392839    E..MCLTFLER--.................................................................
HGL_H00000217958-5  E..IVKALLGK--.................................................................
HGL_H00000303518-2  A..TVRRLLSEK-.................................................................
HGL_H00000357914-2  D..EARTLTAN--.................................................................
HGL_H00000296785-1  -..----------.................................................................
HGL_H00000405112-2  E..CVTILLEH--.................................................................
HGL_H00000349612    E..CVTVLLEH--.................................................................
HGL_H00000260947    -..------PH--.................................................................
HGL_H00000403487    V..AVRLWLDNT-.................................................................
HGL_H00000415252    P..VVRQLLDSG-.................................................................
HGL_H00000398321    A..RVKSFIQK--.................................................................
HGL_H00000305071    Q..LKEHLRKG--.................................................................
HGL_H00000379435    D..CVRVLLEA--.................................................................
HGL_H00000262126    -..----------.................................................................
HGL_H00000264607    D..ILQALIRY--.................................................................
HGL_H00000303518-1  T..TVQRLLSEK-.................................................................
HGL_H00000331873    E..SVTILLEH--.................................................................
HGL_H00000274361    -..----------.................................................................
HGL_H00000282272    Q..CLELLLERTN.................................................................
HGL_H00000414663-2  I..SVKVALNSNE.................................................................
HGL_H00000352358    E..VAMVLMEAAP.................................................................
HGL_H00000296785-2  -..----LANRIQ.................................................................
HGL_H00000215941-2  -..----------.................................................................
HGL_H00000352814    G..ISSLLLDTG-.................................................................
HGL_H00000386239    -..----------.................................................................
HGL_H00000320076    E..LLKEATRK--.................................................................
HGL_H00000328327-3  -..----------.................................................................
HGL_H00000360998    G..QVWRWVRED-.................................................................
HGL_H00000351881    N..YSKRLLES--.................................................................
HGL_H00000265310    E..AAMLLMEA--.................................................................
HGL_H00000294053    S..VVQILLAA--.................................................................
HGL_H00000274361    -..----------.................................................................
HGL_H00000340836-1  -..----------.................................................................
HGL_H00000217958-4  E..LKESILAS--.................................................................
HGL_H00000353796    T..CMKVLIEEY-.................................................................
HGL_H00000349140-1  -..----------.................................................................
HGL_H00000299234    G..AVTMLLRR--.................................................................
HGL_H00000328327-2  -..----------.................................................................
HGL_H00000303570    -..----------.................................................................
HGL_H00000267339    -..----------.................................................................
HGL_H00000369579    Q..AVRLLLEH--.................................................................
HGL_H00000368848    E..CVRWMVSE--.................................................................
HGL_H00000401089    -..----------.................................................................
HGL_H00000350331-1  L..QLQQLIES--.................................................................
HGL_H00000265140    D..KLILLLSLP-.................................................................
HGL_H00000414663-1  I..SVKVALNS--.................................................................
HGL_H00000375751    -..----------.................................................................
HGL_H00000355827-2  -..----------.................................................................
HGL_H00000314103    -..----------.................................................................
HGL_H00000280758-2  A..MVQMLLDA--.................................................................
HGL_H00000331065    -..----------.................................................................
HGL_H00000378013    -..----------.................................................................
HGL_H00000261312    -..----------.................................................................
HGL_H00000202556    -..----------.................................................................
HGL_H00000298992    S..VVQLLLDA--.................................................................
HGL_H00000307541    D..VVLYCLQKD-.................................................................
HGL_H00000349140-2  E..I---LLLK--.................................................................
HGL_H00000371734-1  G..IIKLLLDAD-.................................................................
HGL_H00000370259-2  -..----------.................................................................
HGL_H00000324287    -..----------.................................................................
HGL_H00000346733    -..----------.................................................................
HGL_H00000403902    -..----------.................................................................
HGL_H00000253810    -..----------.................................................................
HGL_H00000384801    -..----------.................................................................
HGL_R00000013095    G..VTIHVVPIC-.................................................................
HGL_H00000277458    D..NIRLLLEG--.................................................................
HGL_H00000335147    -..----------.................................................................
HGL_H00000158762    -..----------.................................................................
HGL_H00000303518-3  T..IVHLLLEA--.................................................................
HGL_H00000299824-2  -..----------.................................................................
HGL_H00000356685    -..----------.................................................................
HGL_H00000240361    -..----------.................................................................
HGL_H00000265742    -..----------.................................................................
HGL_H00000320340    -..----------.................................................................
HGL_H00000308772    -..----LKEAT-.................................................................
HGL_H00000349041    D..IVLYLIT---.................................................................
HGL_H00000378338    -..----------.................................................................
HGL_H00000367705    -..----------.................................................................
HGL_H00000396078    -..----------.................................................................
HGL_H00000419199    Q..CLELLIQA--.................................................................
HGL_H00000385887    D..GVRVLLES--.................................................................
HGL_H00000396747    -..----------.................................................................
HGL_M00000098100    -..----------.................................................................
HGL_H00000365830    -..----------.................................................................
HGL_H00000407057    -..----------.................................................................
HGL_H00000350331-3  K..FVDILVDY--.................................................................
HGL_H00000368859    -..----ILKR--.................................................................
HGL_H00000347464    -..----------.................................................................
HGL_H00000274457-1  -..----------.................................................................
HGL_H00000230792    -..----------.................................................................
HGL_H00000310447    -..----------.................................................................
HGL_H00000353732    -..-----LRR--.................................................................
HGL_H00000305721    -..----------.................................................................
HGL_H00000359982    -..----------.................................................................
HGL_H00000382659    A..IVKFLLQNSW.................................................................
HGL_H00000269856    -..----------.................................................................
HGL_H00000317379    -..----------.................................................................
HGL_H00000261740    H..IVNYLTENPH.................................................................
HGL_H00000386897    -..----------.................................................................
HGL_H00000340913-2  E..ITELLLKKEN.................................................................
HGL_H00000378328    -..----------.................................................................
HGL_H00000386532    A..CAHLLLQH--.................................................................
HGL_H00000261739    E..MVYTVLQH--.................................................................
HGL_H00000215941-1  -..----------.................................................................
HGL_H00000334879    -..----------.................................................................
HGL_H00000380413    -..----------.................................................................
HGL_H00000368966    R..IVEAILNHPG.................................................................
HGL_H00000328160    -..----------.................................................................
HGL_H00000262839    G..AVELLLSYRK.................................................................
HGL_H00000343362    N..NIRVLLTEC-.................................................................
HGL_H00000369003    G..AVELLLNHKK.................................................................
HGL_H00000232744    -..----------.................................................................
HGL_H00000419313    G..AVDILLNH--.................................................................
HGL_H00000161863    -..----------.................................................................
HGL_H00000402616-1  E..MVQLV-----.................................................................
HGL_M00000035452    -..----------.................................................................
HGL_H00000416826    E..LAFLLLTK--.................................................................
HGL_H00000373600    E..TVRYLLTEKR.................................................................
HGL_H00000321813    R..LIETLSQWR-.................................................................
HGL_M00000056646    -..----------.................................................................
HGL_H00000385887    -..----------.................................................................
HGL_H00000387907    -..----------.................................................................
HGL_H00000416826    -..----------.................................................................
HGL_N10020562       E..VVNVLSSHP-.................................................................
HGL_H00000350686    E..VVNVLSSHP-.................................................................
HGL_H00000321627    D..AVLLLLEQYTp................................................................
HGL_H00000386337    -..----------.................................................................
HGL_H00000378871    -..----------.................................................................
HGL_N000000797401   -..----------.................................................................
HGL_H00000307298-1  -..----------.................................................................
HGL_H00000340913-1  A..ITDMLLANV-.................................................................
HGL_H00000320509    -..----------.................................................................
HGL_H00000262547    -..----------.................................................................


                                                                                           140      
                                                                                             |      
d2fo1e1               ..................................LKGD.....IEE........................LD...RNG
HGL_H00000312988    ..................................WKLQ.....LEA........................EN...YEG
HGL_H00000407057    ..................................-GGS.....ANA........................ES...VQG
HGL_H00000280772    ..................................-GAS.....PHA........................AA...KNG
HGL_H00000349588    ..................................-GAN.....IHM........................ST...KSG
HGL_H00000281131    ..................................-KSN.....IDQ........................RG...YDG
HGL_H00000280772    ..................................-GAK.....IDA........................KT...RDG
HGL_H00000407057    ..................................-GAS.....VNF........................TP...KNG
HGL_H00000306678    ..................................-GAS.....LEL........................PT...QQG
HGL_H00000282272    ..................................-GAN.....INA........................FD...KKD
HGL_H00000267116    ..................................-GAE.....IDE........................PN...AFG
HGL_H00000256707    ..................................-GAK.....VNC........................SD...KYG
HGL_H00000411147-2  ..................................-GAN.....VNLhretkadqkv..............LG...KGG
HGL_H00000351416    ..................................-KAN.....VEH........................RA...KTG
HGL_H00000330161    ..................................-GAS.....VNA........................QT...LDG
HGL_H00000253810    ..................................-KAN.....VEH........................RA...KTG
HGL_H00000351416    ..................................-GAD.....QEH........................KT...DEM
HGL_H00000374171    ..................................-GAD.....VNM........................AD...KQG
HGL_H00000373287    ..................................-GAS.....VND........................LD...ERG
HGL_H00000262457    ..................................-GAR.....VDL........................VD...QDG
HGL_H00000263635    ..................................-GCD.....VNL........................SD...KQG
HGL_H00000386135    ..................................-GCN.....VNI........................KN...REG
HGL_H00000373287    ..................................VDAN.....PAI........................AD...NHG
HGL_H00000267116    ..................................-GAS.....ALI........................KEr..KRK
HGL_H00000349588    ..................................-GAP.....LLA........................RT...KNG
HGL_H00000417980-1  ..................................-QMD.....VNC........................QD...DGG
HGL_H00000216797    ..................................----.....---........................--...---
HGL_H00000369579    ..................................-HSD.....LNA........................ID...NKK
HGL_H00000373287    ..................................-LSN.....VNV........................SD...RAG
HGL_H00000345767    ..................................-GAN.....VLA........................RN...KAG
HGL_H00000311579    ..................................--QN.....VNC........................RDle.GRH
HGL_H00000360689    ..................................-GCD.....PNI........................IS...LQG
HGL_H00000350297    ..................................----.....---........................--...---
HGL_H00000267116    ..................................-ALS.....TDPldag....................VD...YSG
HGL_H00000360689    ..................................LNVN.....CHA........................SD...GRK
HGL_H00000311579    ..................................-GAD.....PNI........................RN...TDG
HGL_H00000345065    ..................................-WQE.....VDV........................TN...ENG
HGL_H00000282272    ..................................AEED.....CCL........................RD...SQG
HGL_H00000281419    ..................................----.....---........................--...---
HGL_H00000348081    ..................................-GIN.....ITA........................TN...SQG
HGL_H00000388725-2  ..................................-KCP.....AEG........................ID...SSG
HGL_H00000389168    ..................................-GAH.....VGA........................VN...SEG
HGL_H00000402044    ..................................-HAD.....TNH........................RC...NRG
HGL_H00000281131    ..................................-GAN.....INH........................TD...QDG
HGL_H00000353518    ..................................-LTD.....PTM........................RN...NKF
HGL_H00000217958-1  ..................................-GAQ.....VNA........................VN...QNG
HGL_H00000388725-1  ..................................-KCP.....AED........................ID...SSG
HGL_H00000275015    ..................................HPQD.....LQL........................QN...WQG
HGL_H00000299824-1  ..................................-GAD.....LLA........................VN...SDG
HGL_H00000325355    ..................................-QSN.....PCL........................VN...KAK
HGL_H00000369434    ..................................-QYE.....PDC........................KD...SCG
HGL_H00000338769    ..................................----.....---........................--...---
HGL_H00000403397    ..................................-GAD.....PSL........................ID...GEG
HGL_H00000226574    ..................................APPL.....LDH........................PN...REG
HGL_H00000349588    ..................................-GAN.....QST........................AT...EDG
HGL_H00000382545-2  ..................................-GAK.....VNQ........................PR...QDG
HGL_H00000328327-1  ..................................-KAE.....VDP........................LS...DKG
HGL_H00000356240    ..................................-GAN.....VGM........................VN...SEG
HGL_H00000301030    mtaeesanspvdttpkhpsqstvcqkgtpnsaskTKDK.....VNK........................RN...ERG
HGL_H00000391126-2  ..................................-GAD.....LLA........................VN...TDG
HGL_H00000351416    ..................................-GAN.....VHA........................TT...ATG
HGL_H00000417980-2  ..................................-QVD.....VNAqwavapphhvlparthrt......AA...GGH
HGL_H00000333142    ..................................-SNQ.....IHS........................KDp..RYG
HGL_H00000411147-1  ..................................-GAS.....PTL........................RT...QWG
HGL_H00000160373    ..................................-DAN.....INH........................AA...AGG
HGL_H00000350331-2  ..................................-GAK.....VNP........................P-...LYT
HGL_H00000345436    ..................................-QSN.....PCM........................VD...NSG
HGL_H00000343362    ..................................-SGA.....AEQ........................VD...NKG
HGL_H00000378210    ..................................-GAD.....KEC........................QD...DFG
HGL_H00000304292-1  ..................................-LTD.....PTI........................RN...SKL
HGL_H00000314556    ..................................-NCP.....TEH........................VD...LHG
HGL_H00000263388    ..................................-STD.....LDA........................RM...ADG
HGL_H00000260047    ..................................-GCG.....IED........................VD...YNG
HGL_H00000342295    ..................................-GAD.....PTL........................VD...KDF
HGL_H00000261537    ..................................-GAD.....VTI........................TN...NNG
HGL_H00000277541-1  ..................................-ATD.....LDA........................RM...HDG
HGL_H00000307298-2  ..................................-RAD.....PNA........................KA...HCG
HGL_H00000386502    ..................................-GAR.....VNA........................KD...SKW
HGL_H00000347802    ..................................-GAN.....EDA........................VD...AEN
HGL_H00000296525    ..................................-GAK.....AQL........................E-...SCL
HGL_H00000274457-1  ..................................-KAD.....LEV........................SN...RHG
HGL_H00000262457    ..................................-PGE.....VDT........................QD...KNK
HGL_H00000256646    ..................................-VTD.....LDA........................RM...NDG
HGL_H00000400113    ..................................-GAD.....PTL........................ID...GEG
HGL_H00000277541-2  ..................................-QTA.....VDA........................RT...EDG
HGL_H00000274457-2  ..................................-KAD.....LEV........................SN...RHG
HGL_H00000262970    ..................................-SCV.....VDM........................ED...SSG
HGL_H00000401369    ..................................-GAC.....PDA........................RN...AEG
HGL_H00000358983    ..................................-GAPalpqlLHM........................PD...FEG
HGL_H00000304586    ..................................-GVS.....VNV........................PT...PEG
HGL_H00000304292-2  ..................................-GAN.....PSA........................RN...TNQ
HGL_H00000360826    ..................................-NVN.....VNA........................QN...GFG
HGL_H00000360762-1  ..................................-GAQ.....IEF........................RD...MLE
HGL_H00000275699    ..................................-GGS.....GNV........................PN...RAG
HGL_H00000325663    ..................................QFVD.....LEA........................TN...YDG
HGL_H00000339115    ..................................-GAD.....MHL........................RA...LDG
HGL_H00000364158    ..................................-GAD.....PNH........................VAw..TVG
HGL_H00000417914    ..................................-GAK.....AQL........................E-...VHL
HGL_H00000306163    ..................................-GAT.....VDF........................QD...RLD
HGL_H00000337056    ..................................-LVH.....PDA........................LN...RFG
HGL_H00000369855    ..................................-GAS.....PHS........................E-...SDL
HGL_H00000282272    ..................................-GFE.....IDT........................PD...KFG
HGL_H00000370259-3  ..................................-GA-.....PFT........................TD...WLG
HGL_H00000375690    ..................................-GGS.....PNY........................KD...RRG
HGL_H00000164227    ..................................-GAS.....PMA........................LD...RHG
HGL_H00000263433    ..................................-GAN.....IAA........................VN...SDG
HGL_H00000391126-1  ..................................-GVD.....L--........................--...---
HGL_H00000357681    ..................................-GAS.....WDA........................RD...LGG
HGL_H00000360762-2  ..................................-GAQ.....IKF........................HD...MLE
HGL_H00000357914-1  ..................................-GA-.....PFT........................TD...WLG
HGL_H00000284629-1  ..................................-GAN.....AS-........................FN...KDK
HGL_H00000320893    ..................................-GAE.....VNA........................LD...GYN
HGL_H00000217958-2  ..................................-GAQ.....VNA........................VN...QNG
HGL_H00000284629-2  ..................................-GAN.....AS-........................FN...KDK
HGL_H00000269856    ..................................-GAQ.....VNR........................RS...AKG
HGL_H00000345193-1  ..................................-GAS.....PDY........................KD...SRG
HGL_H00000304292-2  ..................................-GAV.....VNA........................MD...YHG
HGL_H00000276925-1  ..................................----.....---........................--...---
HGL_H00000343362    ..................................-QLD.....LEL........................KD...HEG
HGL_H00000262209    ..................................-GAN.....PNL........................RN...SSM
HGL_H00000217958-3  ..................................-KAD.....VNA........................QD...NED
HGL_H00000343362    ..................................-KAN.....ALHatnnlqiipdfsl...........KD...SRD
HGL_H00000276925-2  ..................................----.....---........................--...---
HGL_H00000320291    ..................................-NAD.....TTV........................VN...GSG
HGL_H00000262209    ..................................DTRL.....LNE........................GD...LHG
HGL_H00000321679    ..................................-GAA.....VDA........................SD...LLD
HGL_H00000371734-2  ..................................-VCN.....VDH........................QN...KAG
HGL_H00000360689    ..................................---N.....VNC........................RDtq.GRH
HGL_H00000382545-1  ..................................-GAS.....TEC........................RT...KDG
HGL_H00000311579    ..................................---N.....INC........................RDtq.GRN
HGL_H00000392839    ..................................-GIP.....VDM........................KD...KYY
HGL_H00000252985    ..................................-GVQ.....VNLea......................RD...FEG
HGL_H00000392839    ..................................-GAD.....PNA........................INs..STG
HGL_H00000217958-5  ..................................-GAQ.....VNA........................VN...QNG
HGL_H00000303518-2  ..................................-ATH.....VNT........................RD...EDE
HGL_H00000357914-2  ..................................-GAP.....FTT........................-A...WLG
HGL_H00000296785-1  ..................................-ENV.....INH........................MD...EEG
HGL_H00000405112-2  ..................................-GAD.....PNI........................AD...VSS
HGL_H00000349612    ..................................-GAD.....PNV........................AD...ASG
HGL_H00000260947    ..................................-GFM.....ARK........................RN...HRG
HGL_H00000403487    ..................................-END.....LNQ........................GD...DHG
HGL_H00000415252    ..................................-LCQ.....VDK........................QN...RAG
HGL_H00000398321    ..................................-AMD.....PSQ........................PD...SAG
HGL_H00000305071    ..................................-DNL.....VNK........................PD...DHG
HGL_H00000379435    ..................................-GAC.....PGG........................SI...YNN
HGL_H00000262126    ..................................----.....VNK........................RN...ERG
HGL_H00000264607    ..................................-GAD.....VDVnhhltpnirppfsrr.........LT...SLV
HGL_H00000303518-1  ..................................-VTH.....VNT........................RD...EEE
HGL_H00000331873    ..................................-GAN.....PNV........................AD...ASG
HGL_H00000274361    ..................................----.....-SK........................RN...ARG
HGL_H00000282272    ..................................TG--.....CEG........................SDs..GAT
HGL_H00000414663-2  ..................................-EYN.....LDQ........................ED...SSG
HGL_H00000352358    ..................................ELVF.....EPM........................TSel.YEG
HGL_H00000296785-2  ..................................QENV.....VNH........................TD...EEG
HGL_H00000215941-2  ..................................----.....---........................--...---
HGL_H00000352814    ..................................-VCE.....VSC........................QN...RAG
HGL_H00000386239    ..................................----.....-NR........................RN...DMG
HGL_H00000320076    ..................................---E.....LNA........................PD...EDG
HGL_H00000328327-3  ..................................----.....---........................--...---
HGL_H00000360998    ..................................-SCY.....VNI........................QDg..FNG
HGL_H00000351881    ..................................-GFD.....PNI........................RD...SRG
HGL_H00000265310    ..................................-APD.....LVMeptlc...................EP...YVG
HGL_H00000294053    ..................................-GAD.....PNL........................GD...DF-
HGL_H00000274361    ..................................----.....INR........................RN...VFG
HGL_H00000340836-1  ..................................----.....---........................--...---
HGL_H00000217958-4  ..................................-KSL.....ATR........................TN...QDS
HGL_H00000353796    ..................................-KVP.....VDL........................PT...YSS
HGL_H00000349140-1  ..................................----.....---........................--...---
HGL_H00000299234    ..................................-GVD.....VSA........................RD...QDG
HGL_H00000328327-2  ..................................----.....---........................--...---
HGL_H00000303570    ..................................----.....---........................--...---
HGL_H00000267339    ..................................----.....---........................--...---
HGL_H00000369579    ..................................-GAS.....VDD........................AD...AFG
HGL_H00000368848    ..................................----.....---........................--...---
HGL_H00000401089    ..................................----.....---........................--...---
HGL_H00000350331-1  ..................................-GAC.....VNQ........................VT...MDS
HGL_H00000265140    ..................................-GID.....INV........................KD...NAG
HGL_H00000414663-1  ..................................----.....NEE........................YN...SSG
HGL_H00000375751    ..................................----.....---........................--...---
HGL_H00000355827-2  ..................................----.....---........................--...---
HGL_H00000314103    ..................................----.....---........................--...---
HGL_H00000280758-2  ..................................-GAD.....LNVevvstphkypsvh...........PE...TRH
HGL_H00000331065    ..................................----.....---........................--...---
HGL_H00000378013    ..................................----.....---........................--...---
HGL_H00000261312    ..................................----.....---........................--...---
HGL_H00000202556    ..................................----.....---........................--...---
HGL_H00000298992    ..................................-GAH.....VEGsavssg..................ED...TYA
HGL_H00000307541    ..................................-SED.....VNH........................RD...NAG
HGL_H00000349140-2  ..................................-GAD.....INA........................PD...KHH
HGL_H00000371734-1  ..................................-VCN.....VDH........................QN...KAG
HGL_H00000370259-2  ..................................----.....---........................--...---
HGL_H00000324287    ..................................----.....---........................--...---
HGL_H00000346733    ..................................----.....---........................--...---
HGL_H00000403902    ..................................----.....---........................--...---
HGL_H00000253810    ..................................----.....---........................--...--G
HGL_H00000384801    ..................................----.....---........................--...---
HGL_R00000013095    ..................................-QLW.....VGA........................GN...TPG
HGL_H00000277458    ..................................-GAD.....VKA........................TT...KDG
HGL_H00000335147    ..................................----.....---........................--...---
HGL_H00000158762    ..................................----.....---........................--...---
HGL_H00000303518-3  ..................................-GVS.....VNV........................PT...PEG
HGL_H00000299824-2  ..................................----.....---........................--...---
HGL_H00000356685    ..................................----.....---........................--...---
HGL_H00000240361    ..................................----.....---........................--...---
HGL_H00000265742    ..................................----.....---........................--...YQH
HGL_H00000320340    ..................................----.....---........................--...---
HGL_H00000308772    ..................................-TRD.....LIL........................SD...EDG
HGL_H00000349041    ..................................----.....---........................--...---
HGL_H00000378338    ..................................----.....---........................--...---
HGL_H00000367705    ..................................----.....---........................--...---
HGL_H00000396078    ..................................----.....---........................--...---
HGL_H00000419199    ..................................-GFD.....VNFmldqrihkh...............YD...DQR
HGL_H00000385887    ..................................-GAR.....TDI........................RYppqLGA
HGL_H00000396747    ..................................----.....---........................--...---
HGL_M00000098100    ..................................----.....---........................--...---
HGL_H00000365830    ..................................----.....---........................--...---
HGL_H00000407057    ..................................----.....---........................--...---
HGL_H00000350331-3  ..................................-GSD.....PNH........................HC...FDG
HGL_H00000368859    ..................................-GCN.....VND........................RDg..LTD
HGL_H00000347464    ..................................----.....---........................--...---
HGL_H00000274457-1  ..................................----.....---........................--...---
HGL_H00000230792    ..................................----.....---........................--...---
HGL_H00000310447    ..................................----.....---........................--...---
HGL_H00000353732    ..................................-GCH.....VND........................RDg..LTD
HGL_H00000305721    ..................................----.....---........................--...---
HGL_H00000359982    ..................................----.....---........................--...---
HGL_H00000382659    ..................................QPAD.....ISA........................RD...SVG
HGL_H00000269856    ..................................----.....---........................--...---
HGL_H00000317379    ..................................----.....---........................--...---
HGL_H00000261740    ..................................KKAD.....MRR........................QD...SRG
HGL_H00000386897    ..................................----.....---........................--...---
HGL_H00000340913-2  ..................................L---.....---........................--...SRV
HGL_H00000378328    ..................................----.....---........................--...---
HGL_H00000386532    ..................................-RAD.....PDL........................PS...AEG
HGL_H00000261739    ..................................----.....---........................--...---
HGL_H00000215941-1  ..................................----.....---........................--...---
HGL_H00000334879    ..................................----.....---........................--...---
HGL_H00000380413    ..................................----.....---........................--...---
HGL_H00000368966    ..................................--FA.....ATKrltlspceqelqdddfyaydedgtRF...SPD
HGL_H00000328160    ..................................----.....---........................--...---
HGL_H00000262839    ..................................PSGE.....KQV........................PT...LMM
HGL_H00000343362    ..................................-TVD.....AEA........................FN...LRG
HGL_H00000369003    ..................................---P.....---........................--...---
HGL_H00000232744    ..................................----.....---........................--...---
HGL_H00000419313    ..................................-R--.....---........................--...---
HGL_H00000161863    ..................................----.....---........................--...---
HGL_H00000402616-1  ..................................----.....---........................--...---
HGL_M00000035452    ..................................----.....---........................--...---
HGL_H00000416826    ..................................-GAD.....PRD........................ISl..MEG
HGL_H00000373600    ..................................VELS.....T--........................-E...PTD
HGL_H00000321813    ..................................----.....---........................--...---
HGL_M00000056646    ..................................----.....---........................--...---
HGL_H00000385887    ..................................----.....---........................--...---
HGL_H00000387907    ..................................----.....---........................--...--K
HGL_H00000416826    ..................................----.....---........................--...---
HGL_N10020562       ..................................-LIE.....KKT........................RN...KYN
HGL_H00000350686    ..................................-LIE.....KKT........................RN...KYN
HGL_H00000321627    ..................................EELD.....LNT........................PN...SEG
HGL_H00000386337    ..................................----.....---........................--...---
HGL_H00000378871    ..................................----.....---........................--...---
HGL_N000000797401   ..................................----.....---........................--...---
HGL_H00000307298-1  ..................................----.....---........................--...---
HGL_H00000340913-1  ..................................-KFD.....F--........................--...RQV
HGL_H00000320509    ..................................----.....---........................--...---
HGL_H00000262547    ..................................----.....---........................--...---


                                                                                      150           
                                                                                        |           
d2fo1e1               MTA............................................................LMIVA..........
HGL_H00000312988    HTP............................................................LHVAV..........
HGL_H00000407057    VTP............................................................LHLAS..........
HGL_H00000280772    YTP............................................................LHIAA..........
HGL_H00000349588    LTS............................................................LHLAA..........
HGL_H00000281131    RNA............................................................LRVAA..........
HGL_H00000280772    LTP............................................................LHCGA..........
HGL_H00000407057    ITP............................................................LHIAS..........
HGL_H00000306678    WTP............................................................LHLAT..........
HGL_H00000282272    RRA............................................................LHWAV..........
HGL_H00000267116    NTA............................................................LHIAC..........
HGL_H00000256707    TTP............................................................LVWAA..........
HGL_H00000411147-2  GTA............................................................LMDAA..........
HGL_H00000351416    LTP............................................................LMEAA..........
HGL_H00000330161    RTP............................................................LHLAA..........
HGL_H00000253810    LTP............................................................LMEAA..........
HGL_H00000351416    HTA............................................................LMEAC..........
HGL_H00000374171    RTP............................................................LMMAA..........
HGL_H00000373287    CTP............................................................LHYAA..........
HGL_H00000262457    HSL............................................................LHWAA..........
HGL_H00000263635    RVP............................................................LMVAA..........
HGL_H00000386135    ETP............................................................LLTAS..........
HGL_H00000373287    YTA............................................................LHWAC..........
HGL_H00000267116    WTP............................................................LHAAA..........
HGL_H00000349588    LSP............................................................LHMAA..........
HGL_H00000417980-1  WTP............................................................MIWAT..........
HGL_H00000216797    ---............................................................-----..........
HGL_H00000369579    MSC............................................................LHYAA..........
HGL_H00000373287    RTA............................................................LHHAA..........
HGL_H00000345767    NTA............................................................LHLAC..........
HGL_H00000311579    STP............................................................LHFAA..........
HGL_H00000360689    FTAlqmgnenvqqvlqegiplgnseadrqlleaakagdvetvkklctvqsvncrdiegrqstpLHFAA..........
HGL_H00000350297    ---............................................................-----..........
HGL_H00000267116    YSP............................................................MHWAS..........
HGL_H00000360689    STP............................................................LHLAA..........
HGL_H00000311579    KSAldladpsakavltgeykkdelleaarsgneeklmalltplnvnchasdgrkstp......LHLAA..........
HGL_H00000345065    ETP............................................................FFLAV..........
HGL_H00000282272    YTP............................................................LHWAC..........
HGL_H00000281419    ---............................................................-----..........
HGL_H00000348081    FTL............................................................LHHAS..........
HGL_H00000388725-2  KTA............................................................LHYAA..........
HGL_H00000389168    DTP............................................................LDIAE..........
HGL_H00000402044    WTA............................................................LHESV..........
HGL_H00000281131    WTA............................................................LRSAA..........
HGL_H00000353518    ETP............................................................LDLAA..........
HGL_H00000217958-1  CTP............................................................LHYAA..........
HGL_H00000388725-1  KTA............................................................LHYAM..........
HGL_H00000275015    LAC............................................................LHIAT..........
HGL_H00000299824-1  NMPydlcedeptldvietcmayqgitqekine...............................MRAAP..........
HGL_H00000325355    KTP............................................................LDLAC..........
HGL_H00000369434    VTP............................................................FMDAI..........
HGL_H00000338769    ---............................................................-----..........
HGL_H00000403397    CSC............................................................IHLAA..........
HGL_H00000226574    LNA............................................................IHIAV..........
HGL_H00000349588    FTP............................................................LAVAL..........
HGL_H00000382545-2  TAP............................................................LWIAS..........
HGL_H00000328327-1  TTP............................................................LQLAI..........
HGL_H00000356240    EVP............................................................SDLAE..........
HGL_H00000301030    ETR............................................................LHRAA..........
HGL_H00000391126-2  NMPydlcedeqtldcletamasqgitqgs..................................IEEAR..........
HGL_H00000351416    DTA............................................................LTYAC..........
HGL_H00000417980-2  PSS............................................................IIWAA..........
HGL_H00000333142    ASP............................................................LHWAK..........
HGL_H00000411147-1  EVA............................................................-QTAA..........
HGL_H00000160373    QTP............................................................LYLAC..........
HGL_H00000350331-2  ASP............................................................LHEAC..........
HGL_H00000345436    KTP............................................................LDLAC..........
HGL_H00000343362    RNF............................................................LHVAV..........
HGL_H00000378210    ITP............................................................LFLAA..........
HGL_H00000304292-1  ETP............................................................LDLAA..........
HGL_H00000314556    RTA............................................................LHDAA..........
HGL_H00000263388    STA............................................................LILAA..........
HGL_H00000260047    NLP............................................................VHLAA..........
HGL_H00000342295    KTA............................................................LHWAV..........
HGL_H00000261537    FNA............................................................LHHAA..........
HGL_H00000277541-1  TTP............................................................LILAA..........
HGL_H00000307298-2  ATA............................................................LHFAA..........
HGL_H00000386502    LTP............................................................LHTAV..........
HGL_H00000347802    RSP............................................................LHWAA..........
HGL_H00000296525    PSP............................................................THEAA..........
HGL_H00000274457-1  HTC............................................................LMISC..........
HGL_H00000262457    QTA............................................................LHWSA..........
HGL_H00000256646    TTP............................................................LILAA..........
HGL_H00000400113    FSS............................................................IHLAV..........
HGL_H00000277541-2  TTP............................................................LMLAA..........
HGL_H00000274457-2  HTC............................................................FMISC..........
HGL_H00000262970    WTA............................................................LHHAA..........
HGL_H00000401369    WTP............................................................LLAACdtrcqssada
HGL_H00000358983    LYP............................................................VHLAV..........
HGL_H00000304586    QTP............................................................LMLAS..........
HGL_H00000304292-2  AVP............................................................LHLAC..........
HGL_H00000360826    RTA............................................................LQVM-..........
HGL_H00000360762-1  STA............................................................IHWAC..........
HGL_H00000275699    HLP............................................................IHRAA..........
HGL_H00000325663    LTP............................................................LHCAVvahnavvhel
HGL_H00000339115    SSA............................................................LHAAA..........
HGL_H00000364158    WSP............................................................LMLAA..........
HGL_H00000417914    ASP............................................................IHEAV..........
HGL_H00000306163    CTA............................................................MHWAC..........
HGL_H00000337056    KTA............................................................LQVM-..........
HGL_H00000369855    ASP............................................................IHEAA..........
HGL_H00000282272    RTC............................................................LHAAA..........
HGL_H00000370259-3  TSP............................................................LHLAA..........
HGL_H00000375690    LTP............................................................LFHTAm.........
HGL_H00000164227    QTA............................................................AHLAC..........
HGL_H00000263433    DLA............................................................LDLAE..........
HGL_H00000391126-1  -TS............................................................LHQLK..........
HGL_H00000357681    CTA............................................................LHWAA..........
HGL_H00000360762-2  CTA............................................................IHWAC..........
HGL_H00000357914-1  TSP............................................................LHLAA..........
HGL_H00000284629-1  QTI............................................................LITACsargs.....
HGL_H00000320893    RTA............................................................LHYAA..........
HGL_H00000217958-2  CTP............................................................LHYAA..........
HGL_H00000284629-2  QTI............................................................LITACsahgs.....
HGL_H00000269856    NTA............................................................LHDCA..........
HGL_H00000345193-1  LTP............................................................LYHSA..........
HGL_H00000304292-2  STP............................................................LHLAC..........
HGL_H00000276925-1  ---............................................................-----..........
HGL_H00000343362    STA............................................................LWLAV..........
HGL_H00000262209    MAP............................................................LHLAV..........
HGL_H00000217958-3  HDP............................................................LHFCS..........
HGL_H00000343362    QTV............................................................LGLAL..........
HGL_H00000276925-2  ---............................................................-----..........
HGL_H00000320291    QTA............................................................KEATH..........
HGL_H00000262209    MTP............................................................LHLAA..........
HGL_H00000321679    KTP............................................................VFWAC..........
HGL_H00000371734-2  YTP............................................................IMLAAlaave.....
HGL_H00000360689    STP............................................................LHLAA..........
HGL_H00000382545-1  ATG............................................................LFLAA..........
HGL_H00000311579    STP............................................................LHLAA..........
HGL_H00000392839    KTP............................................................LMMAC..........
HGL_H00000252985    LTP............................................................LHTAIlalnaamhpp
HGL_H00000392839    RTA............................................................LMEAS..........
HGL_H00000217958-5  CTP............................................................LHYAA..........
HGL_H00000303518-2  YTP............................................................LHRAA..........
HGL_H00000357914-2  ASP............................................................LHLAA..........
HGL_H00000296785-1  FTP............................................................LMWAA..........
HGL_H00000405112-2  NTA............................................................LHYAV..........
HGL_H00000349612    NTA............................................................LHYAV..........
HGL_H00000260947    ETL............................................................LHIAS..........
HGL_H00000403487    FSP............................................................LHWAC..........
HGL_H00000415252    YSP............................................................IMLTAlatlk.....
HGL_H00000398321    YTA............................................................LHYAS..........
HGL_H00000305071    FTP............................................................LIWAS..........
HGL_H00000379435    CSP............................................................VLTAA..........
HGL_H00000262126    ETP............................................................LHMAA..........
HGL_H00000264607    VCP............................................................LYISA..........
HGL_H00000303518-1  YTP............................................................LHQAA..........
HGL_H00000331873    NTA............................................................LHYAV..........
HGL_H00000274361    ESQ............................................................LHSAA..........
HGL_H00000282272    KSP............................................................LHLAA..........
HGL_H00000414663-2  MTL............................................................VMLAA..........
HGL_H00000352358    QTA............................................................LHIAV..........
HGL_H00000296785-2  FTP............................................................LMWAA..........
HGL_H00000215941-2  ---............................................................-----..........
HGL_H00000352814    YSA............................................................LMLAA..........
HGL_H00000386239    ETL............................................................LHRAC..........
HGL_H00000320076    MTP............................................................TLWAA..........
HGL_H00000328327-3  ---............................................................LHLAA..........
HGL_H00000360998    DTP............................................................LICAC..........
HGL_H00000351881    RTG............................................................LHLAA..........
HGL_H00000265310    QTA............................................................LHIAV..........
HGL_H00000294053    -SS............................................................VYKTA..........
HGL_H00000274361    ETL............................................................LYRAA..........
HGL_H00000340836-1  DNP............................................................LHEAA..........
HGL_H00000217958-4  QTA............................................................LHRAC..........
HGL_H00000353796    QTP............................................................LHLVM..........
HGL_H00000349140-1  ---............................................................FMWAL..........
HGL_H00000299234    LTP............................................................LLLAV..........
HGL_H00000328327-2  ---............................................................---AA..........
HGL_H00000303570    ---............................................................-----..........
HGL_H00000267339    ---............................................................-----..........
HGL_H00000369579    MNA............................................................ILLSA..........
HGL_H00000368848    ---............................................................-----..........
HGL_H00000401089    ---............................................................LLKAV..........
HGL_H00000350331-1  ITP............................................................LHAAS..........
HGL_H00000265140    WTP............................................................LHEAC..........
HGL_H00000414663-1  MTL............................................................VMLAA..........
HGL_H00000375751    ---............................................................-----..........
HGL_H00000355827-2  ---............................................................-----..........
HGL_H00000314103    --A............................................................LLRAV..........
HGL_H00000280758-2  WTA............................................................LTFAV..........
HGL_H00000331065    ---............................................................-----..........
HGL_H00000378013    DFP............................................................LHRSA..........
HGL_H00000261312    ---............................................................-----..........
HGL_H00000202556    ---............................................................LLDAS..........
HGL_H00000298992    ETP............................................................LQLAS..........
HGL_H00000307541    YTA............................................................LHEAC..........
HGL_H00000349140-2  ITL............................................................LLSAV..........
HGL_H00000371734-1  YTP............................................................IMLAAlkave.....
HGL_H00000370259-2  ---............................................................-----..........
HGL_H00000324287    ---............................................................LYRAS..........
HGL_H00000346733    ---............................................................-HRAA..........
HGL_H00000403902    ---............................................................-LDAA..........
HGL_H00000253810    RTP............................................................LMKAA..........
HGL_H00000384801    ---............................................................LLAAA..........
HGL_R00000013095    ARQ............................................................GWSAP..........
HGL_H00000277458    DTV............................................................FTCIIfllgetvggd
HGL_H00000335147    ---............................................................-----..........
HGL_H00000158762    ---............................................................-----..........
HGL_H00000303518-3  QTP............................................................LMLAS..........
HGL_H00000299824-2  ---............................................................-----..........
HGL_H00000356685    ---............................................................-----..........
HGL_H00000240361    ---............................................................LHEYV..........
HGL_H00000265742    NTP............................................................LHYAA..........
HGL_H00000320340    --A............................................................LMEAA..........
HGL_H00000308772    MTP............................................................TLLAA..........
HGL_H00000349041    ---............................................................-----..........
HGL_H00000378338    ---............................................................-----..........
HGL_H00000367705    ---............................................................-----..........
HGL_H00000396078    ---............................................................-----..........
HGL_H00000419199    KSA............................................................LYFAV..........
HGL_H00000385887    LTP............................................................LHIAA..........
HGL_H00000396747    ---............................................................-----..........
HGL_M00000098100    ---............................................................-----..........
HGL_H00000365830    ---............................................................-----..........
HGL_H00000407057    ---............................................................-----..........
HGL_H00000350331-3  STP............................................................VHAAA..........
HGL_H00000368859    MTL............................................................LHYTC..........
HGL_H00000347464    ---............................................................-----..........
HGL_H00000274457-1  ---............................................................-----..........
HGL_H00000230792    ---............................................................-----..........
HGL_H00000310447    ---............................................................-----..........
HGL_H00000353732    MTL............................................................LHYAC..........
HGL_H00000305721    ---............................................................-----..........
HGL_H00000359982    ---............................................................-----..........
HGL_H00000382659    NTV............................................................LHALV..........
HGL_H00000269856    ---............................................................-----..........
HGL_H00000317379    ---............................................................-----..........
HGL_H00000261740    NTV............................................................LHALVaiadnt....
HGL_H00000386897    ---............................................................---AT..........
HGL_H00000340913-2  GDA............................................................LLLAI..........
HGL_H00000378328    ---............................................................-----..........
HGL_H00000386532    LAP............................................................LHLCW..........
HGL_H00000261739    ---............................................................-----..........
HGL_H00000215941-1  ---............................................................-----..........
HGL_H00000334879    ---............................................................-----..........
HGL_H00000380413    ---............................................................-LRAV..........
HGL_H00000368966    ITP............................................................IILAA..........
HGL_H00000328160    ---............................................................-WAAV..........
HGL_H00000262839    ETP............................................................F----..........
HGL_H00000343362    QSP............................................................LHILG..........
HGL_H00000369003    ---............................................................-----..........
HGL_H00000232744    ---............................................................-----..........
HGL_H00000419313    ---............................................................----A..........
HGL_H00000161863    ---............................................................-----..........
HGL_H00000402616-1  ---............................................................-----..........
HGL_M00000035452    ---............................................................-----..........
HGL_H00000416826    DTP............................................................LHAALhifl......
HGL_H00000373600    DNA............................................................AVVAA..........
HGL_H00000321813    ---............................................................-----..........
HGL_M00000056646    ---............................................................-----..........
HGL_H00000385887    ---............................................................-----..........
HGL_H00000387907    RVA............................................................LYIAA..........
HGL_H00000416826    ---............................................................-----..........
HGL_N10020562       KTP............................................................EEVIC..........
HGL_H00000350686    KTP............................................................EEVIC..........
HGL_H00000321627    LTP............................................................LDIAI..........
HGL_H00000386337    ---............................................................-----..........
HGL_H00000378871    ---............................................................-----..........
HGL_N000000797401   ---............................................................-----..........
HGL_H00000307298-1  ---............................................................-----..........
HGL_H00000340913-1  HEA............................................................LLVAV..........
HGL_H00000320509    ---............................................................-----..........
HGL_H00000262547    ---............................................................-----..........


                                                  160             170                               
                                                    |               |                               
d2fo1e1               ..............HNEG.RDQ.......VASAK.LLVEK.....GAKVDYDG.........................
HGL_H00000312988    ..............IHKD.---.......AEMVR.VLRDA.....GADLNK--.........................
HGL_H00000407057    ..............QEGH.---.......AEMVA.LLLSK.....QANGN---.........................
HGL_H00000280772    ..............KKNQ.---.......MDIAT.TLLEY.....GADANAVTrqgiasvhlaaqeghvdmvslllsr
HGL_H00000349588    ..............QEDK.---.......VSVAD.ILTKH.....GADQD---.........................
HGL_H00000281131    ..............LEGH.---.......RDIVE.LLFTH.....GADVNYKDadgrptlyilalenqltmaeyflen
HGL_H00000280772    ..............RSGH.---.......EQVVE.MLLDR.....AAPIL---.........................
HGL_H00000407057    ..............RRGN.---.......VIMVR.LLLDR.....GAQIE---.........................
HGL_H00000306678    ..............YKGH.---.......LEIIH.LLAES.....HADMG---.........................
HGL_H00000282272    ..............YIGH.---.......LDVVV.LLINH.....GAEVT---.........................
HGL_H00000267116    ..............YLGQ.---.......DAVAI.ELVNA.....GANVN---.........................
HGL_H00000256707    ..............RKGH.---.......LECVK.HLLAM.....GADVDQEGansmtalivavkggytqsvkeilkr
HGL_H00000411147-2  ..............KKGH.---.......IDVLR.ILLEKm....RAEVN---.........................
HGL_H00000351416    ..............SGGY.---.......AEVGR.VLLDK.....GADVNAP-.........................
HGL_H00000330161    ..............QRGH.---.......YRVAR.VLIDL.....CSDVN---.........................
HGL_H00000253810    ..............SGGY.---.......AEVGR.VLLDK.....GADVNAP-.........................
HGL_H00000351416    ..............MDGH.---.......VEVAR.LLLDS.....GAQVN---.........................
HGL_H00000374171    ..............SEGH.---.......LGTVD.FLLAQ.....GASIA---.........................
HGL_H00000373287    ..............TSDT.D--.......GKCLE.YLLRN.....DANPG---.........................
HGL_H00000262457    ..............LGGN.---.......AEVCQ.ILIEN.....KINPN---.........................
HGL_H00000263635    ..............CEGH.---.......LSTVE.FLLSK.....GAALS---.........................
HGL_H00000386135    ..............ARGY.HDIvvgvmgyHDIVE.CLAEH.....GADLN---.........................
HGL_H00000373287    ..............YNGH.---.......ETCVE.LLLEQ.....EVFQKMEGnafsplhcavindnegaaemlidtl
HGL_H00000267116    ..............ASGH.---.......TDSLH.LLIDS.....GERAD---.........................
HGL_H00000349588    ..............QGDH.---.......VECVK.HLLQH.....KAPVD---.........................
HGL_H00000417980-1  ..............EYKH.---.......VELVK.LLLSK.....GSDIN---.........................
HGL_H00000216797    ..............----.---.......-----.-----.....-TA--QRL.........................
HGL_H00000369579    ..............LSGS.---.......EAVCQ.ALIRA.....GGCTN---.........................
HGL_H00000373287    ..............FSGH.---.......GEMVK.LLLSR.....GANIN---.........................
HGL_H00000345767    ..............QNNH.---.......SQSTR.ILLLG.....GSRAD---.........................
HGL_H00000311579    ..............GYNR.---.......VSVVE.YLLHH.....GADVH---.........................
HGL_H00000360689    ..............GYNR.---.......VSVVE.YLLQH.....GADVH---.........................
HGL_H00000350297    ..............----.---.......VELME.PLLES.....GQ------.........................
HGL_H00000267116    ..............YTGH.---.......EDCLE.LLLEH.....SPFSYLEGnpftplhcavinnqdsttemllgal
HGL_H00000360689    ..............GYNR.---.......IKIVQ.LLLQH.....GADVH---.........................
HGL_H00000311579    ..............GYNR.---.......VRIVQ.LLLQH.....GADVH---.........................
HGL_H00000345065    ..............AGGH.---.......EECSK.VLLAA.....GSDINILNkawipcllslcllqlnvsalqtatq
HGL_H00000282272    ..............YHGN.---.......ENCIE.ILLEQ.....KCFRAFVGnpftplhcaiindhencasmllgai
HGL_H00000281419    ..............----.---.......-----.-----.....--------.........................
HGL_H00000348081    ..............LKGH.A--.......LAVRK.ILARA.....RQLVD---.........................
HGL_H00000388725-2  ..............ARGC.---.......LQAVQ.VLYEH.....KSPVN---.........................
HGL_H00000389168    ..............----.---.......EEAME.ELLQN.....EVNRQGVDieaarkeeerimlrdarqwlns...
HGL_H00000402044    ..............SRND.---.......VEGME.ILVSG.....GAKVE---.........................
HGL_H00000281131    ..............WGGH.---.......TEVVS.ALLYA.....GVKVD---.........................
HGL_H00000353518    ..............LYGR.---.......LEVVK.MLLNA.....HPNLL---.........................
HGL_H00000217958-1  ..............SKNR.---.......HEIAV.MLLEG.....GANPD---.........................
HGL_H00000388725-1  ..............AGGC.---.......LQAVQ.VLYEH.....KSPVN---.........................
HGL_H00000275015    ..............LQRN.---.......QPLME.LLLQN.....GADIDV--.........................
HGL_H00000299824-1  ..............EQQM.---.......ITDIH.CMIAA.....GQDLD---.........................
HGL_H00000325355    ..............EFGR.---.......LKVAQ.LLLNS.....HLCVALLE.........................
HGL_H00000369434    ..............QCGH.---.......IDVAR.LLLTKh....KACSS---.........................
HGL_H00000338769    ..............----.---.......-----.-----.....--------.........................
HGL_H00000403397    ..............QFGH.---.......TSIVA.YLIAK.....GQDVD---.........................
HGL_H00000226574    ..............TSNS.---.......LPCLL.LLVAA.....GANVN---.........................
HGL_H00000349588    ..............QQGH.---.......NQAVA.ILLEN.....D-------.........................
HGL_H00000382545-2  ..............QMGH.---.......SEVVR.VMLLR.....GADRD---.........................
HGL_H00000328327-1  ..............IRER.---.......SSCVK.ILLDH.....NANID---.........................
HGL_H00000356240    ..............E---.---.......PAMKD.LLLEQvkkq.GVDLEQSRkeeeqqmlqdarqwlnsg.......
HGL_H00000301030    ..............IRGD.---.......ARRIK.ELISE.....GADVN---.........................
HGL_H00000391126-2  ..............AVPE.LRM.......VDDLQ.SLLRA.....GADLN---.........................
HGL_H00000351416    ..............ENGH.---.......TDVAD.VLLQA.....GADLE---.........................
HGL_H00000417980-2  ..............EHKH.---.......IDVIR.MLLTR.....GADVT---.........................
HGL_H00000333142    ..............N---.---.......AEMAR.MLLKR.....GCDVD---.........................
HGL_H00000411147-1  ..............AGGH.---.......LPAVQ.LLVAW.....GAAVD---.........................
HGL_H00000160373    ..............KNGN.---.......RECIK.LLLEV.....GTDRS---.........................
HGL_H00000350331-2  ..............MSGS.---.......SECVR.LLIDV.....GANLE---.........................
HGL_H00000345436    ..............EFGR.---.......VGVVQ.LLLSS.....NMCAALLE.........................
HGL_H00000343362    ..............QNSD.---.......IESVL.FLISV.....HANVNSR-.........................
HGL_H00000378210    ..............QYGK.---.......LESLS.ILISS.....GAKVN---.........................
HGL_H00000304292-1  ..............LYGR.---.......LRVVK.MIISA.....HPNLM---.........................
HGL_H00000314556    ..............MADC.---.......PSSIQ.LLCDH.....GASVN---.........................
HGL_H00000263388    ..............RLAV.---.......EGMVE.ELIAS.....HADVN---.........................
HGL_H00000260047    ..............MEGH.---.......LHCFK.FLLSR.....MSNGIQALkafndngenvldlaqrffkqnilqf
HGL_H00000342295    ..............QSGN.---.......RILCS.IILSH.....HQGPS---.........................
HGL_H00000261537    ..............LRGN.---.......PSAMR.VLLSK.....LPRPW---.........................
HGL_H00000277541-1  ..............RLAV.---.......EGMLE.DLINS.....HADVN---.........................
HGL_H00000307298-2  ..............EAGH.---.......IDIVK.ELIKW.....RAAI----.........................
HGL_H00000386502    ..............ASCS.---.......EEAVQ.VLLKH.....SADVN---.........................
HGL_H00000347802    ..............SSGC.---.......ASSVL.LLCDH.....EAFLD---.........................
HGL_H00000296525    ..............SKGH.---.......HECLD.ILISW.....CIDVD---.........................
HGL_H00000274457-1  ..............YKGH.---.......KEIAQ.YLLEK.....GADVN---.........................
HGL_H00000262457    ..............YYNN.---.......PEHVK.LLIKH.....DSNIG---.........................
HGL_H00000256646    ..............RLAV.---.......EGMVA.ELINC.....QADVN---.........................
HGL_H00000400113    ..............LFQR.---.......MPIIA.YLISK.....GQSVN---.........................
HGL_H00000277541-2  ..............RLEV.---.......EDLVE.ELIAA.....RADVG---.........................
HGL_H00000274457-2  ..............YKGH.---.......EETAQ.YLLEK.....GADVNRKSvkelfsfmlqdrskdllgttitfdd
HGL_H00000262970    ..............AGGC.---.......LSCSE.LLCSF.....KAHLN---.........................
HGL_H00000401369    ...........eatSARC.---.......FQLCH.LLLSA.....GADAD---.........................
HGL_H00000358983    ..............RARS.---.......PECLD.LLVDS.....GAEVEA--.........................
HGL_H00000304586    ..............SCGN.---.......ESIAY.FLLQQ.....GAELE---.........................
HGL_H00000304292-2  ..............QKGH.---.......FQVVK.YLLDS.....NTKPN---.........................
HGL_H00000360826    ..............KLGN.---.......PEIAR.RLLLR.....GANPN---.........................
HGL_H00000360762-1  ..............RGGS.---.......LDVLK.LLLNK.....GAKIS---.........................
HGL_H00000275699    ..............YEGH.---.......YLALK.YLIPV.....TSK-N---.........................
HGL_H00000325663    qknqqphspevqelL---.--Lknksl..VDTIK.CLIQM.....GASVE---.........................
HGL_H00000339115    ..............ARGH.---.......CPLVV.WLVTFt....DISLM---.........................
HGL_H00000364158    ..............LAGR.---.......LSVAQ.QLVEK.....GANPDHLSvlektafevaldrrhrdladcldpl
HGL_H00000417914    ..............KRGH.---.......RECME.ILLVN.....NVNID---.........................
HGL_H00000306163    ..............RGGH.---.......LEVVK.LLQSR.....GADTN---.........................
HGL_H00000337056    ..............MFGS.---.......LTIAQ.ELLKQ.....GASPN---.........................
HGL_H00000369855    ..............KRGH.---.......VECIE.SLVAH.....GANIN---.........................
HGL_H00000282272    ..............AGGN.---.......VECIK.LLQSS.....GADFH---.........................
HGL_H00000370259-3  ..............QYGH.---.......YSTTE.VLLRA.....GVSRD---.........................
HGL_H00000375690    ..............VGGD.---.......PRCCE.LLLYN.....RAQLG---.........................
HGL_H00000164227    ..............EHRN.---.......PTCLR.ALLDSaapg.SVDLE---.........................
HGL_H00000263433    ..............SDAI.---.......EGLLQ.AEIARr....GVDVQAAKraeeelllhdtrcwlng........
HGL_H00000391126-1  ..............LQRP.MSM.......LADVE.RFLSS.....GGNVN---.........................
HGL_H00000357681    ..............DGGH.---.......CPVID.WMIKD.....GCEVD---.........................
HGL_H00000360762-2  ..............CGGS.---.......LDVLK.LLLNK.....GAKIS---.........................
HGL_H00000357914-1  ..............QHGH.---.......YSTAE.VLLRA.....GVSRD---.........................
HGL_H00000284629-1  ..............E---.EQI.......LKCVD.LLLSR.....NADPN---.........................
HGL_H00000320893    ..............EKD-.---.......EACVE.VLLEY.....GANPN---.........................
HGL_H00000217958-2  ..............SINR.---.......HEIAV.MLLEEg....GANPD---.........................
HGL_H00000284629-2  ..............EGQ-.--I.......LKCVD.LLLSR.....NADPN---.........................
HGL_H00000269856    ..............ESGS.---.......LEILQ.LLLGC.....NARME---.........................
HGL_H00000345193-1  ..............LGGG.D--.......ALCCE.LLLHD.....HAQLG---.........................
HGL_H00000304292-2  ..............QRGY.---.......QSVTL.LLLHY.....KASAE---.........................
HGL_H00000276925-1  ..............----.---.......-----.-----.....-ADPN---.........................
HGL_H00000343362    ..............----.---.......-----.-----.....--------.........................
HGL_H00000262209    ..............QGMY.---.......NEITK.VLIEHs....STNIN---.........................
HGL_H00000217958-3  ..............HFGH.---.......HEIMK.YLLQS.....DSEVQ---.........................
HGL_H00000343362    ..............WTGM.---.......HTIAA.QLLGS.....GASIN---.........................
HGL_H00000276925-2  ..............----.---.......-----.-----.....--------.........................
HGL_H00000320291    ..............DKEI.RNM.......LEAVE.R----.....--------.........................
HGL_H00000262209    ..............KNGH.---.......DKVVQ.LLLKK.....GALF----.........................
HGL_H00000321679    ..............RGGH.---.......LDILK.QLLNQ.....GVQVN---.........................
HGL_H00000371734-2  ..............AEKD.---.......MRVVE.ELFGC.....G-DVNA--.........................
HGL_H00000360689    ..............GYNN.---.......LEVAE.YLLQH.....GADVN---.........................
HGL_H00000382545-1  ..............QGGY.---.......LDVIR.LLLSS.....GAKVN---.........................
HGL_H00000311579    ..............GYNN.---.......LEVAE.YLLEH.....GADVN---.........................
HGL_H00000392839    ..............ANGN.---.......IDVVK.FLLEK.....GANIN---.........................
HGL_H00000252985    ....tlcprmlsaqARDR.---.......LACVQ.MLLHI.....GADHT---.........................
HGL_H00000392839    ..............REGV.---.......TELVR.GILER.....GGAVN---.........................
HGL_H00000217958-5  ..............SINR.---.......HEIAV.MLLEG.....GSNPD---.........................
HGL_H00000303518-2  ..............YSGH.---.......LDIVQ.ELVAQ.....GADVH---.........................
HGL_H00000357914-2  ..............QHGR.---.......YPTAE.ALLRA.....GVSRD---.........................
HGL_H00000296785-1  ..............AHGQ.---.......IAVVE.FLLQN.....GADPQ---.........................
HGL_H00000405112-2  ..............SSEN.---.......TSIAA.KLLSH.....HADTE---.........................
HGL_H00000349612    ..............CSEN.---.......TSIAA.KLLSH.....HADTE---.........................
HGL_H00000260947    ..............IKGD.---.......VSSVE.YLLQN.....GTDPN---.........................
HGL_H00000403487    ..............REGR.---.......SAVVE.MLIMR.....GARIN---.........................
HGL_H00000415252    ..............TQDD.---.......IKTVV.QLFRL.....G-DVNA--.........................
HGL_H00000398321    ..............RNGH.---.......YAVCQ.FLLES.....GAKCD---.........................
HGL_H00000305071    ..............AFGE.---.......IQTVR.FLLDW.....GADPH---.........................
HGL_H00000379435    ..............RDGS.---.......VAILQ.ELLGH.....GADANVKA.........................
HGL_H00000262126    ..............IRGD.---.......VKQVK.ELISL.....GANVN---.........................
HGL_H00000264607    ..............AYHN.---.......LQCFQ.LLLQA.....GANPDFNC.........................
HGL_H00000303518-1  ..............YSGH.---.......LDIVQ.ELVAQ.....GADVH---.........................
HGL_H00000331873    ..............CSEN.---.......TSIAA.KLLSH.....HADTE---.........................
HGL_H00000274361    ..............RRGD.---.......LSLVQ.ILIES.....GADVN---.........................
HGL_H00000282272    ..............YNGH.---.......HQALE.VLLQS.....LVDLD---.........................
HGL_H00000414663-2  ..............AGGQ.---.......DDLLR.LLITK.....GAKVN---.........................
HGL_H00000352358    ..............MNQN.---.......MNLVH.ALLIH.....GASVSARAtgvaf....................
HGL_H00000296785-2  ..............AHGQ.---.......IAVVV.FLLQS.....GADPQ---.........................
HGL_H00000215941-2  ..............----.---.......VETVQ.QLLDD.....GVDPS---.........................
HGL_H00000352814    ..............LTSV.GLEd......MVVVR.RLFRM.....G-DVNA--.........................
HGL_H00000386239    ..............IEGR.---.......LRRVQ.DLVKQ.....GHPLN---.........................
HGL_H00000320076    ..............YHGN.---.......LESLR.LIVSR.....GGDPD---.........................
HGL_H00000328327-3  ..............RNGQ.---.......KKCMS.KLLEH.....GADVN---.........................
HGL_H00000360998    ..............RRGH.---.......VKIVS.FLLKR.....NANVN---.........................
HGL_H00000351881    ..............ARGN.---.......VDICQ.LLHKF.....GADLL---.........................
HGL_H00000265310    ..............MNQN.---.......VNLVR.MLLSH.....GASVCARAtglgf....................
HGL_H00000294053    ..............KEQG.---.......IHSLE.VLVTR.....EDDFN---.........................
HGL_H00000274361    ..............LYDD.---.......ADLVQ.CCIKK.....GANVN---.........................
HGL_H00000340836-1  ..............KRGN.---.......LSWLR.ECLDN.....RVGVN---.........................
HGL_H00000217958-4  ..............H---.---.......TKIVE.FLLQL.....SVPVN---.........................
HGL_H00000353796    ..............HKDNkTTA.......VPCIL.YLLKK.....GASIN---.........................
HGL_H00000349140-1  ..............KNGD.---.......LDEVK.DYVAK.....GEDVN---.........................
HGL_H00000299234    ..............RGRH.---.......WGVIQ.LLRAA.....GACLS---.........................
HGL_H00000328327-2  ..............RNGQ.---.......KKCMS.KLLEY.....GADVN---.........................
HGL_H00000303570    ..............----.---.......-----.LLSSK.....NVRVN---.........................
HGL_H00000267339    ..............--GS.---.......LECLI.QLVRA.....GATLNV--.........................
HGL_H00000369579    ..............WFGH.---.......LQVLQ.ILVNS.....GAKIH---.........................
HGL_H00000368848    ..............----.---.......TEAIA.EL---.....--------.........................
HGL_H00000401089    ..............WLGR.---.......LRLTR.LLLEG.....GAYIN---.........................
HGL_H00000350331-1  ..............LQGQ.---.......AQCVQ.LLLAA.....AAQVD---.........................
HGL_H00000265140    ..............NYGN.---.......TVCVQ.EILQR.....CPEVDL--.........................
HGL_H00000414663-1  ..............AGGQ.---.......DDFLR.LLITK.....GAKVN---.........................
HGL_H00000375751    ..............-EGE.---.......FDLVQ.RIIYE.....VEDPS---.........................
HGL_H00000355827-2  ..............----.---.......-----.-----.....--------.........................
HGL_H00000314103    ..............GQGK.---.......LRLAR.LLLEG.....GAYVN---.........................
HGL_H00000280758-2  ..............LHGH.---.......IPVVQ.LLLDA.....GAKVE---.........................
HGL_H00000331065    ..............----.---.......----G.RFIRTr....KVSLD---.........................
HGL_H00000378013    ..............CEGD.---.......SELLS.RLLNE.....KFSVN---.........................
HGL_H00000261312    ..............----.---.......-----.-----.....-FEVN---.........................
HGL_H00000202556    ..............LEGE.---.......FDLVQ.RIIYE.....VEDPS---.........................
HGL_H00000298992    ..............AAGN.---.......YELVS.LLLSR.....GADPLLSM.........................
HGL_H00000307541    ..............SRGW.---.......TDILN.ILLQH.....GANVNCSAqdgtrqapqhpaqpltennlpqpqp
HGL_H00000349140-2  ..............YEGH.---.......VSCVK.LLLSK.....GAGKT---.........................
HGL_H00000371734-1  ..............AEKD.---.......MWIVE.ELFGC.....GDMNT---.........................
HGL_H00000370259-2  ..............----.---.......-----.-----.....--------.........................
HGL_H00000324287    ..............YEKN.---.......LPKMA.EALAR.....GADVN---.........................
HGL_H00000346733    ..............RTRD.---.......LPALA.AALAH.....GAEVN---.........................
HGL_H00000403902    ..............LTGE.---.......LEVVQ.QAVKE.....MNDPS---.........................
HGL_H00000253810    ..............RAGH.---.......LCTVQ.FLISK.....GANVNR--.........................
HGL_H00000384801    ..............RKGQ.---.......DDEVR.TLMAN.....GAPF----.........................
HGL_R00000013095    ..............TSPC.ARI.......APYTR.CLLSQ.....PRSIV---.........................
HGL_H00000277458    .......keeaqmiNR--.-FC.......FQVTQ.LLLAH.....GADPS---.........................
HGL_H00000335147    ..............----.---.......---LK.HLLQT.....GCSVNA--.........................
HGL_H00000158762    ..............----.---.......-----.--LAH.....GADVN---.........................
HGL_H00000303518-3  ..............SCGN.---.......ESIAY.FLL--.....--------.........................
HGL_H00000299824-2  ..............----.---.......-----.--IAV.....GQDLD---.........................
HGL_H00000356685    ..............---H.---.......KDAMQ.LLL--.....--------.........................
HGL_H00000240361    ..............KQGN.---.......YVKVK.KILKK.....GIYVD---.........................
HGL_H00000265742    ..............RHGM.---.......NRILGtFLFGR.....DGNPN---.........................
HGL_H00000320340    ..............QRND.---.......FCKLQ.ELHRA.....GGDLL---.........................
HGL_H00000308772    ..............YHSN.---.......LQALE.IICSR.....GGDPD---.........................
HGL_H00000349041    ..............----.---.......-----.-----.....--------.........................
HGL_H00000378338    ..............----.---.......LQMVH.TLASN.....GANSIWEHslldpaqvqsgrrkanpqdkvhpik
HGL_H00000367705    ..............----.---.......-----.-----.....-SDVN---.........................
HGL_H00000396078    ..............----.---.......-----.---KN.....GGSLL---.........................
HGL_H00000419199    ..............SNGD.---.......LSSVK.LLLNA.....GVLPN---.........................
HGL_H00000385887    ..............ALPG.EEG.......VRITE.LLLHA.....ITDVDAKAadqddvykpgkldllpsslklnnep
HGL_H00000396747    ..............----.---.......-----.-----.....--------.........................
HGL_M00000098100    ..............----.---.......-----.-----.....--------.........................
HGL_H00000365830    ..............----.---.......-----.-----.....--------.........................
HGL_H00000407057    ..............----.---.......-----.-----.....--------.........................
HGL_H00000350331-3  ..............FSGS.---.......QWILS.KLLDS.....GGDLW---.........................
HGL_H00000368859    ..............KSGA.HGIgdveta.VKFAA.QLIDL.....GADVS---.........................
HGL_H00000347464    ..............----.---.......-----.-----.....--------.........................
HGL_H00000274457-1  ..............----.---.......QTIYR.LL---.....--------.........................
HGL_H00000230792    ..............----.---.......-----.-----.....--------.........................
HGL_H00000310447    ..............----.---.......-----.-----.....--------.........................
HGL_H00000353732    ..............KAGA.HGVgdpaaa.VRLSQ.QLLAL.....GADVT---.........................
HGL_H00000305721    ..............----.---.......-----.FLSSH.....CYNAAT--.........................
HGL_H00000359982    ..............----.---.......-----.-----.....--------.........................
HGL_H00000382659    ..............EVAD.NTAdntkfv.TSMYN.DILIL.....GAKLY-PT.........................
HGL_H00000269856    ..............----.---.......-----.-----.....--------.........................
HGL_H00000317379    ..............----.---.......-----.-----.....--------.........................
HGL_H00000261740    ..............RENT.KFV.......TKMYD.LLLLK.....CARLF-PD.........................
HGL_H00000386897    ..............ADED.---.......LRTVI.LLLAH.....GSRDE---.........................
HGL_H00000340913-2  ..............SKGY.---.......VRIVE.AILSH.....PAFAEGKRlatspsqselqqddfya........
HGL_H00000378328    ..............----.---.......-----.-----.....--DIE---.........................
HGL_H00000386532    ..............TTAS.---.......-----.----L.....GAG-----.........................
HGL_H00000261739    ..............----.---.......-----.-----.....--------.........................
HGL_H00000215941-1  ..............----.---.......-----.-----.....--------.........................
HGL_H00000334879    ..............----.---.......-----.-----.....--------.........................
HGL_H00000380413    ..............VEDD.---.......LRLLV.MLLAH.....GSKEE---.........................
HGL_H00000368966    ..............HCQK.---.......YEVVH.MLLMK.....GARIE---.........................
HGL_H00000328160    ..............QAQD.---.......VAAVL.LLLAHarhg.PLDTS---.........................
HGL_H00000262839    ..............----.---.......-----.-----.....--------.........................
HGL_H00000343362    ..............QYGK.ENA.......AAIFD.LFLECmp...EYPLD---.........................
HGL_H00000369003    ..............-SGE.---.......KQVPP.ILLDK.....QFSEF---.........................
HGL_H00000232744    ..............----.---.......-----.-----.....--------.........................
HGL_H00000419313    ..............KRSS.---.......RPTIV.KLMER.....IQNPE---.........................
HGL_H00000161863    ..............----.---.......-----.--LTE.....NVSVDY--.........................
HGL_H00000402616-1  ..............----.---.......-----.-----.....--------.........................
HGL_M00000035452    ..............----.---.......-----.-----.....--------.........................
HGL_H00000416826    ..............DINA.DIG.......FNFLS.YLLDLf....LSNPTEFY.........................
HGL_H00000373600    ..............HFGH.---.......TEVVQ.ELLESls...GKSQC---.........................
HGL_H00000321813    ..............---S.---.......VETGS.LDLEQ.....EVDPL---.........................
HGL_M00000056646    ..............----.---.......-----.-----.....--------.........................
HGL_H00000385887    ..............----.---.......-----.-----.....--------.........................
HGL_H00000387907    ..............FYGY.---.......IELTE.WALQQ.....GVRPHEAVgvhpyra..................
HGL_H00000416826    ..............----.---.......--LVQ.WLISI.....GASIE---.........................
HGL_N10020562       ..............E---.---.......-----.-----.....--------.........................
HGL_H00000350686    ..............ERNK.---.......-----.-----.....--------.........................
HGL_H00000321627    ..............MTNN.---.......VPIAK.ILLRT.....GA------.........................
HGL_H00000386337    ..............----.---.......-----.-----.....--------.........................
HGL_H00000378871    ..............----.---.......-----.-----.....--------.........................
HGL_N000000797401   ..............----.---.......-----.-----.....--------.........................
HGL_H00000307298-1  ..............----.---.......-----.-----.....--------.........................
HGL_H00000340913-1  ..............DTNQ.---.......PAVVR.RLLARldrekGRKVDTRSfslaffd..................
HGL_H00000320509    ..............----.---.......-----.-----.....--------.........................
HGL_H00000262547    ..............----.---.......-SVLE.QLLDK.....DTDPD---.........................


                                                                                    180         190 
                                                                                      |           | 
d2fo1e1               .............................................................AARKDSEK..YKGRTA.
HGL_H00000312988    .............................................................-----PEP..TCGRSP.
HGL_H00000407057    .............................................................-----LGN..KSGLTP.
HGL_H00000280772    .............................................................NANVNLSN..KSGLTP.
HGL_H00000349588    .............................................................-----AHT..KLGYTP.
HGL_H00000281131    .............................................................GANVEASD..AEGRTA.
HGL_H00000280772    .............................................................-----SKT..KNGLSP.
HGL_H00000407057    .............................................................-----TRT..KDELTP.
HGL_H00000306678    .............................................................-----ALG..SMNWTP.
HGL_H00000282272    .............................................................-----CKD..KKGYTP.
HGL_H00000267116    .............................................................-----QPN..DKGFTP.
HGL_H00000256707    .............................................................NPNVNLTD..KDGNTA.
HGL_H00000411147-2  .............................................................-----ACD..NMGRSA.
HGL_H00000351416    .............................................................-----PVP..SSRDTA.
HGL_H00000330161    .............................................................-----VRS..LQALTP.
HGL_H00000253810    .............................................................-----PVP..SSRDTA.
HGL_H00000351416    .............................................................-----MPA..DSFESP.
HGL_H00000374171    .............................................................-----LMD..KEGLTA.
HGL_H00000373287    .............................................................-----IRD..KQGYNA.
HGL_H00000262457    .............................................................-----VQD..YAGRTP.
HGL_H00000263635    .............................................................-----SLD..KEGLSA.
HGL_H00000386135    .............................................................-----ASD..KDEHIA.
HGL_H00000373287    ............................................................gASIVNATD..SKGRTP.
HGL_H00000267116    .............................................................--ITDVMD..AYGQTP.
HGL_H00000349588    .............................................................-----DVT..LDYLTA.
HGL_H00000417980-1  .............................................................-----IRD..NEENIC.
HGL_H00000216797    .............................................................HSILQATN..YNGHTC.
HGL_H00000369579    .............................................................-----VAD..YQGTSP.
HGL_H00000373287    .............................................................-----AFD..KKDRRA.
HGL_H00000345767    .............................................................-----LKN..NVGDTC.
HGL_H00000311579    .............................................................-----AKD..KGGLVP.
HGL_H00000360689    .............................................................-----AKD..KGGLVP.
HGL_H00000350297    .............................................................--------..ELGETA.
HGL_H00000267116    ............................................................gAKIVNSRD..TKGRTP.
HGL_H00000360689    .............................................................-----AKD..KGDLVP.
HGL_H00000311579    .............................................................-----AKD..KGGLVP.
HGL_H00000345065    ................................................ngqaslvnfllseNIKLPQRM..EPKESP.
HGL_H00000282272    ............................................................dSSIVSCGD..DRGRTP.
HGL_H00000281419    .............................................................--------..-PDETA.
HGL_H00000348081    .............................................................-----AKK..EDGFTA.
HGL_H00000388725-2  .............................................................-----LKD..LDGNIP.
HGL_H00000389168    .............................................................GHINDVRHa.KSGGTA.
HGL_H00000402044    .............................................................-----AKN..AYGITP.
HGL_H00000281131    .............................................................-----CAD..ADSRTA.
HGL_H00000353518    .............................................................-----SCN..TKKHTP.
HGL_H00000217958-1  .............................................................-----AKD..HYEATA.
HGL_H00000388725-1  .............................................................-----FKD..LDGNIP.
HGL_H00000275015    .............................................................-----QEG..TSGKTA.
HGL_H00000299824-1  .............................................................-----WID..AQGATL.
HGL_H00000325355    .............................................................GEAKDPGD..PNYTTP.
HGL_H00000369434    .............................................................-----AED..SLGAQA.
HGL_H00000338769    .............................................................--------..--GELA.
HGL_H00000403397    .............................................................-----MMD..QNGMTP.
HGL_H00000226574    .............................................................-----AQEq.KSGRTA.
HGL_H00000349588    .............................................................-----TKG..KVRLPA.
HGL_H00000382545-2  .............................................................-----ATR..NDGTTA.
HGL_H00000328327-1  .............................................................--------..IQNGFL.
HGL_H00000356240    .............................................................KIEDVRQA..RSGATA.
HGL_H00000301030    .............................................................-----VKD..FAGWTA.
HGL_H00000391126-2  .............................................................-----DPL..DHGATL.
HGL_H00000351416    .............................................................-----HES..EGGRTP.
HGL_H00000417980-2  .............................................................-----LTD..NEENIC.
HGL_H00000333142    .............................................................-----STS..TSGNTA.
HGL_H00000411147-1  .............................................................-----AQD..SLGLTP.
HGL_H00000160373    .............................................................-----AKT..RDGWTP.
HGL_H00000350331-2  .............................................................-----AHD..CHFGTP.
HGL_H00000345436    .............................................................PRPGDTTD..PNGTSP.
HGL_H00000343362    .............................................................-----VQD..ASKLTP.
HGL_H00000378210    .............................................................-----CQA..LDKATP.
HGL_H00000304292-1  .............................................................-----SCN..TRKHTP.
HGL_H00000314556    .............................................................-----AKD..IDGRTP.
HGL_H00000263388    .............................................................-----AVD..ELGKSA.
HGL_H00000260047    ...................................................iqgaawegnnP-----EDq.EILAFP.
HGL_H00000342295    .............................................................--VINYDD..DSGKTC.
HGL_H00000261537    .............................................................--IVDEKK..DDGYTA.
HGL_H00000277541-1  .............................................................-----AVD..DLGKSA.
HGL_H00000307298-2  .............................................................-----VVN..GHGMTP.
HGL_H00000386502    .............................................................-----ARD..KNWQTP.
HGL_H00000347802    .............................................................-----VLD..NDGRTP.
HGL_H00000296525    .............................................................-----QDI..PYLGTP.
HGL_H00000274457-1  .............................................................-----RKS..VKGNTA.
HGL_H00000262457    .............................................................-----IPD..VEGKIP.
HGL_H00000256646    .............................................................-----AVD..DHGKSA.
HGL_H00000400113    .............................................................-----MTD..VNGQTP.
HGL_H00000277541-2  .............................................................-----ARD..KWGKTA.
HGL_H00000274457-2  lmgvlcksvleieqaikqtqcpadplqlnkalsiilhlicllekvpctleqdhfkkqtiyrFLKLHQRG..KNNFSP.
HGL_H00000262970    .............................................................-----PRD..RSGATP.
HGL_H00000401369    .............................................................-----AAD..QDRQRP.
HGL_H00000358983    .............................................................-----AER..QGGRTA.
HGL_H00000304586    .............................................................-----MKD..IQGWTA.
HGL_H00000304292-2  .............................................................-----KKD..VSGNTP.
HGL_H00000360826    .............................................................-----LKD..RTGFAV.
HGL_H00000360762-1  .............................................................-----ARD..KLLSTA.
HGL_H00000275699    .............................................................-----AIW..KSGLTP.
HGL_H00000325663    .............................................................-----AKDr.KSGRTA.
HGL_H00000339115    .............................................................-----ARD..NEGATA.
HGL_H00000364158    ..........................ttvrprtdeekrrpdifhalkmgnfqlvkeiadedPNHVNLIN..GDGATP.
HGL_H00000417914    .............................................................-----QEV..PQLGTP.
HGL_H00000306163    .............................................................-----VRD..KLLSTP.
HGL_H00000337056    .............................................................-----IQD..ASGTSP.
HGL_H00000369855    .............................................................-----HNI..SHLGTP.
HGL_H00000282272    .............................................................-----KKD..KCGRTP.
HGL_H00000370259-3  .............................................................-----ART..KVDRTP.
HGL_H00000375690    .............................................................-----IAD..ENGWQE.
HGL_H00000164227    .............................................................-----ARN..YDGFTA.
HGL_H00000263433    .............................................................GAMPEARHp.RTGASA.
HGL_H00000391126-1  .............................................................-----EKN..EEGVTL.
HGL_H00000357681    .............................................................-----VIDt.GSGWTP.
HGL_H00000360762-2  .............................................................-----ARD..KLISTA.
HGL_H00000357914-1  .............................................................-----ART..KVDRTP.
HGL_H00000284629-1  .............................................................-----VAC..RRLMTP.
HGL_H00000320893    .............................................................-----ALD..GNRDTP.
HGL_H00000217958-2  .............................................................-----AKD..HYEATA.
HGL_H00000284629-2  .............................................................-----VAC..RRLMTP.
HGL_H00000269856    .............................................................------RD..GYGMTP.
HGL_H00000345193-1  .............................................................-----TTD..ENGWQE.
HGL_H00000304292-2  .............................................................-----VQD..NNGNTP.
HGL_H00000276925-1  .............................................................-----AVN..RFGRRP.
HGL_H00000343362    .............................................................--------..------.
HGL_H00000262209    .............................................................-----LEG..ENGNTA.
HGL_H00000217958-3  .............................................................---PHVVN..IYEDTP.
HGL_H00000343362    .............................................................-----DTM..SDGQTL.
HGL_H00000276925-2  .............................................................--------..------.
HGL_H00000320291    .............................................................-----TQQ..RKLEEL.
HGL_H00000262209    .............................................................-----LSD..HNGWTA.
HGL_H00000321679    .............................................................-----ARD..KIWSIP.
HGL_H00000371734-2  .............................................................-----KAS..QAGQTA.
HGL_H00000360689    .............................................................-----AQD..KGGLIP.
HGL_H00000382545-1  .............................................................-----QPR..QGGTAP.
HGL_H00000311579    .............................................................-----AQD..KGGLIP.
HGL_H00000392839    .............................................................-----ATD..NFLWTP.
HGL_H00000252985    .............................................................-----SQEi.KSNKTV.
HGL_H00000392839    .............................................................-----TLD..SDRHHA.
HGL_H00000217958-5  .............................................................-----AKD..HYEATA.
HGL_H00000303518-2  .............................................................-----AVT..VDGWTP.
HGL_H00000357914-2  .............................................................-----ART..EVDRTP.
HGL_H00000296785-1  .............................................................-----LLG..KGRESA.
HGL_H00000405112-2  .............................................................-----AKN..KDDLTP.
HGL_H00000349612    .............................................................-----AKN..------.
HGL_H00000260947    .............................................................-----VKD..NAGWTP.
HGL_H00000403487    .............................................................-----VMN..RGDDTP.
HGL_H00000415252    .............................................................-----KAS..QAGQTA.
HGL_H00000398321    .............................................................-----AQT..HGGATA.
HGL_H00000305071    .............................................................-----ILA..KERESA.
HGL_H00000379435    .............................................................KLPVWASNi.ALCSGP.
HGL_H00000262126    .............................................................-----VKD..FAGWTP.
HGL_H00000264607    .............................................................NGPVNTQE..FYRG--.
HGL_H00000303518-1  .............................................................-----AAT..VDGWTP.
HGL_H00000331873    .............................................................-----AKN..------.
HGL_H00000274361    .............................................................-----LKD..NAGWTP.
HGL_H00000282272    .............................................................-----IRD..EKGRTA.
HGL_H00000414663-2  .............................................................-----GQQ..KNGTTA.
HGL_H00000352358    .............................................................QRSSNSLI..YYGEHP.
HGL_H00000296785-2  .............................................................-----LLG..KGQESA.
HGL_H00000215941-2  .............................................................-----AAD..DKGRTA.
HGL_H00000352814    .............................................................-----KAS..QTGQTA.
HGL_H00000386239    .............................................................-----PRD..YCGWTP.
HGL_H00000320076    .............................................................-----KCD..IWGNTP.
HGL_H00000328327-3  .............................................................-----VCN..NEGLTE.
HGL_H00000360998    .............................................................-----LKN..QVSKT-.
HGL_H00000351881    .............................................................-----ATD..YQGNTA.
HGL_H00000265310    .............................................................EHSPH--NlvYYGEHP.
HGL_H00000294053    .............................................................NRLNNRAS..FKGCTA.
HGL_H00000274361    .............................................................-----QPS..YAGWTA.
HGL_H00000340836-1  .............................................................-----GLD..KAGSTA.
HGL_H00000217958-4  .............................................................-----DKD..TARWPP.
HGL_H00000353796    .............................................................-------N..RQRLQP.
HGL_H00000349140-1  .............................................................-----RTL..EGGRKP.
HGL_H00000299234    .............................................................-----PQDl.EDAGTE.
HGL_H00000328327-2  .............................................................-----ICN..NEGLTA.
HGL_H00000303570    .............................................................-----CLD..ENGMTP.
HGL_H00000267339    .............................................................-----STT..RYAQTP.
HGL_H00000369579    .............................................................-----CEN..KDGLAL.
HGL_H00000368848    .............................................................-----SCS..KDFPSL.
HGL_H00000401089    .............................................................-----ESN..DKGETA.
HGL_H00000350331-1  .............................................................-----ACN..IDGSTP.
HGL_H00000265140    .............................................................-----LTQ..VDGVTP.
HGL_H00000414663-1  .............................................................-----GWQ..NNGTTV.
HGL_H00000375751    .............................................................-----LPN..DEGITA.
HGL_H00000355827-2  .............................................................--------..------.
HGL_H00000314103    .............................................................-----EGD..AQGETA.
HGL_H00000280758-2  .............................................................GSVEHGEE..NYSETP.
HGL_H00000331065    .............................................................-----TIH..PSGLAA.
HGL_H00000378013    .............................................................-----QLD..SDHWAP.
HGL_H00000261312    .............................................................-----FMD..DVGQTL.
HGL_H00000202556    .............................................................-----KPN..DEGITP.
HGL_H00000298992    .............................................................LEASGMASslHEDMNC.
HGL_H00000307541    ..........................lqhtklraagrpvlytvertyflgridmsyvpsrrT-------..------.
HGL_H00000349140-2  .............................................................-----VKV..PHGLTA.
HGL_H00000371734-1  .............................................................-----KAS..QVGQMA.
HGL_H00000370259-2  .............................................................------QN..QRGPDA.
HGL_H00000324287    .............................................................-----WANseENKATP.
HGL_H00000346733    .............................................................-----WADaeDEGKTP.
HGL_H00000403902    .............................................................-----QPN..EEGITA.
HGL_H00000253810    .............................................................-----ATA..NNDHTV.
HGL_H00000384801    .............................................................-----ITV..WFATSP.
HGL_R00000013095    .............................................................-----LYN..KGSRAA.
HGL_H00000277458    .............................................................----ECPA..HESLTH.
HGL_H00000335147    .............................................................-----PPD..SCEQSP.
HGL_H00000158762    .............................................................-----WVNggQENATP.
HGL_H00000303518-3  .............................................................--------..------.
HGL_H00000299824-2  .............................................................-----WID..AQGATL.
HGL_H00000356685    .............................................................-----EED..IVGRNL.
HGL_H00000240361    .............................................................-----AVN..SLGQTA.
HGL_H00000265742    .............................................................-----KRN..VHNETS.
HGL_H00000320340    .............................................................-----HRD..SRGRTL.
HGL_H00000308772    .............................................................-----RCD..IWGNTL.
HGL_H00000349041    .............................................................--------..------.
HGL_H00000378338    ................................................sefirakyqmlafVHKLPCRD..DDGVTAk
HGL_H00000367705    .............................................................-----HRD..NAGXX-.
HGL_H00000396078    .............................................................-----IQG..PDHCSL.
HGL_H00000419199    .............................................................--------..QDPVNC.
HGL_H00000385887    ......................................................gppstyyTASTCVAE..EGGRTA.
HGL_H00000396747    .............................................................--------..-----V.
HGL_M00000098100    .............................................................---VECED..SHGNTP.
HGL_H00000365830    .............................................................--------..-TGFTC.
HGL_H00000407057    .............................................................--------..------.
HGL_H00000350331-3  .............................................................--------..------.
HGL_H00000368859    .............................................................-----LRSr.WTNMNA.
HGL_H00000347464    .............................................................--------..------.
HGL_H00000274457-1  .............................................................--KLHPRG..KNNFSP.
HGL_H00000230792    .............................................................--------..------.
HGL_H00000310447    .............................................................--------..------.
HGL_H00000353732    .............................................................-----LRSr.WTNMNA.
HGL_H00000305721    .............................................................-----IKD..AFGRKA.
HGL_H00000359982    .............................................................--------..-----P.
HGL_H00000382659    .............................................................LKLEEITN..KKGFTP.
HGL_H00000269856    .............................................................-LKCAPRG..RNGFTP.
HGL_H00000317379    .............................................................--------..------.
HGL_H00000261740    .............................................................SNLEAVLN..NDGLSP.
HGL_H00000386897    .............................................................-VNETCGE..SDGRTA.
HGL_H00000340913-2  .............................................................YDEDGTRF..SHDVTP.
HGL_H00000378328    .............................................................-----QLD..PRGRTP.
HGL_H00000386532    .............................................................-----ALD..YGGASP.
HGL_H00000261739    .............................................................--------..------.
HGL_H00000215941-1  .............................................................--------..------.
HGL_H00000334879    .............................................................--------..--GYTA.
HGL_H00000380413    .............................................................-VNETYGD..GDGRTA.
HGL_H00000368966    .............................................................--------..------.
HGL_H00000328160    .............................................................-----GED..PQLRSP.
HGL_H00000262839    .............................................................-----SEF..TPDITP.
HGL_H00000343362    .............................................................-----KPD..TEGNTV.
HGL_H00000369003    .............................................................--------..TPDITP.
HGL_H00000232744    .............................................................--------..------.
HGL_H00000419313    .............................................................-----YST..TMDVAP.
HGL_H00000161863    .............................................................-----RHS..ETSATA.
HGL_H00000402616-1  .............................................................--------..------.
HGL_M00000035452    .............................................................--------..-GQPPP.
HGL_H00000416826    .............................................................YLDPNVQD..SNGNTL.
HGL_H00000373600    .............................................................-----TRS..LPPPWA.
HGL_H00000321813    .............................................................-----NVD..HFSCTP.
HGL_M00000056646    .............................................................--------..------.
HGL_H00000385887    .............................................................--------..------.
HGL_H00000387907    .............................................................WCYEALHA..DVSKCP.
HGL_H00000416826    .............................................................-----TIG..PYPLHA.
HGL_N10020562       .............................................................--------..------.
HGL_H00000350686    .............................................................--------..------.
HGL_H00000321627    .............................................................--------..------.
HGL_H00000386337    .............................................................--------..------.
HGL_H00000378871    .............................................................--------..------.
HGL_N000000797401   .............................................................--------..------.
HGL_H00000307298-1  .............................................................------RT..HEGFTL.
HGL_H00000340913-1  .............................................................SSIDGSRF..APGVTP.
HGL_H00000320509    .............................................................--------..------.
HGL_H00000262547    .............................................................-----CSD..STGRSA.


                                                              200                                   
                                                                |                                   
d2fo1e1               .....LHYAAQV.......................S.....NMPIVKYLV...G........................
HGL_H00000312988    .....VHLAVEA.......................Q.....AADVLELLL...-........................
HGL_H00000407057    .....LHLVAQE.......................G.....HVPVADVLI...-........................
HGL_H00000280772    .....LHLAAQE.......................D.....RVNVAEVLV...-........................
HGL_H00000349588    .....LIVACHY.......................G.....NVKMVNFLL...-........................
HGL_H00000281131    .....LHVSCWQ.......................G.....HMEMVQVLI...-........................
HGL_H00000280772    .....LHMATQG.......................D.....HLNCVQLLL...-........................
HGL_H00000407057    .....LHCAARN.......................G.....HVRISEILL...-........................
HGL_H00000306678    .....LHLAAHH.......................G.....EETVLLALL...-........................
HGL_H00000282272    .....LHAAASN.......................G.....QINVVKHLL...-........................
HGL_H00000267116    .....LHVAAVS.......................T.....NGALCLELL...V........................
HGL_H00000256707    .....LMIASKE.......................G.....HTEIVQDLL...-........................
HGL_H00000411147-2  .....LIHGIQS.......................Spdek.VEDITRLLL...-........................
HGL_H00000351416    .....LTIAADK.......................G.....HYKFCELLI...-........................
HGL_H00000330161    .....LHVAAET.......................G.....HTSTARLLL...-........................
HGL_H00000253810    .....LTIAADK.......................G.....HYKFCELLI...-........................
HGL_H00000351416    .....LTLAACG.......................G.....HVELAALLI...-........................
HGL_H00000374171    .....LSWACLK.......................G.....HLSVVRSLV...-........................
HGL_H00000373287    .....VHYSAAY.......................G.....HRLCLQLLM...E........................
HGL_H00000262457    .....LQCAAYG.......................G.....YISCMAVLM...-........................
HGL_H00000263635    .....LSWACLK.......................G.....HRAVVQYLV...-........................
HGL_H00000386135    .....LHLAVRR.......................C.....QMEVIKTLI...-........................
HGL_H00000373287    .....LHAAAFT.......................D.....HVECLQLLL...-........................
HGL_H00000267116    .....LMLAIMN.......................G.....HVDCVHLLL...-........................
HGL_H00000349588    .....LHVAAHC.......................G.....HYRVTKLLL...-........................
HGL_H00000417980-1  .....LHWAAFS.......................G.....CVDIAEILL...-........................
HGL_H00000216797    .....LHLASIH.......................N.....YLGIVELLV...-........................
HGL_H00000369579    .....LHLAVRH.......................N.....FPALVELLI...-........................
HGL_H00000373287    .....IHWAAYM.......................G.....HIDVVKLLV...-........................
HGL_H00000345767    .....LHVAARY.......................N.....HLSIIRLLL...-........................
HGL_H00000311579    .....LHNACSY.......................G.....HYEVAELLV...-........................
HGL_H00000360689    .....LHNACSY.......................G.....HYEVAELLV...-........................
HGL_H00000350297    .....LHLAVRT.......................Adqt..SLHLVDFLV...-........................
HGL_H00000267116    .....LHAAAFA.......................D.....NVSGLRMLL...-........................
HGL_H00000360689    .....LHNACSY.......................G.....HYEVTELLV...-........................
HGL_H00000311579    .....LHNACSY.......................G.....HYEVTELLL...-........................
HGL_H00000345065    .....LHLAVSN.......................N.....HIAVVNSLL...-........................
HGL_H00000282272    .....LHAAAFG.......................D.....HVDCLQLLL...-........................
HGL_H00000281419    .....LHLAVRSvdr....................T.....SLHIVDFLV...-........................
HGL_H00000348081    .....LHLAALN.......................N.....HQEVAQILI...Q........................
HGL_H00000388725-2  .....LLLAVQN.......................G.....HTEVCCFLL...-........................
HGL_H00000389168    .....LHVAAAK.......................G.....YTEVLKLLI...-........................
HGL_H00000402044    .....LFVAAQS.......................G.....QLEALRFLA...-........................
HGL_H00000281131    .....LRAAAWG.......................G.....HEDIVLNLL...-........................
HGL_H00000353518    .....LHLAARN.......................G.....HKAVVQVLL...-........................
HGL_H00000217958-1  .....MHRAAAK.......................G.....NLKMIHILL...-........................
HGL_H00000388725-1  .....LLLAVQN.......................G.....HTEVCCFLL...-........................
HGL_H00000275015    .....LHLAVET.......................Q.....ERGLVQFLL...-........................
HGL_H00000299824-1  .....LHIAGAN.......................G.....YLRAAELLL...-........................
HGL_H00000325355    .....LHLAAKN.......................G.....HREVIRQLL...-........................
HGL_H00000369434    .....LHRAAVT.......................G.....QNEAIQFLV...S........................
HGL_H00000338769    .....LHLAIRV.......................Anqa..SLPLVDFII...-........................
HGL_H00000403397    .....LMWAAYR.......................Th....SVDPTRLLL...-........................
HGL_H00000226574    .....LHLAVEQ.......................D.....NVSLAGCLL...L........................
HGL_H00000349588    .....LHIAARK.......................D.....DTKSAALLL...-........................
HGL_H00000382545-2  .....LLKAANK.......................G.....YNDVIEELL...-........................
HGL_H00000328327-1  .....LRYAVIK.......................S.....NHSYCRMFL...-........................
HGL_H00000356240    .....LHVAAAK.......................G.....YSEVLRLLI...-........................
HGL_H00000301030    .....LHEACNR.......................G.....YYDVAKQLL...-........................
HGL_H00000391126-2  .....LHIAAAN.......................G.....FSEAAALLL...-........................
HGL_H00000351416    .....LMKAARA.......................G.....HVCTVQFLI...-........................
HGL_H00000417980-2  .....LHWASFT.......................G.....SAAIAEVLL...-........................
HGL_H00000333142    .....LHVAVMR.......................N.....RCDCVMVLL...-........................
HGL_H00000411147-1  .....LHRAARA.......................G.....RAEIAGHLL...-........................
HGL_H00000160373    .....VHAAVDT.......................G.....NEESLKLLM...Fhrtpahgnsqseeepepafcaldg
HGL_H00000350331-2  .....LHVACAR.......................E.....HLDCVKVLL...-........................
HGL_H00000345436    .....LHLAAKN.......................G.....HIDIIRLLL...-........................
HGL_H00000343362    .....LHLAVQA.......................G.....SEIIVRNLL...-........................
HGL_H00000378210    .....LFIAAQE.......................G.....HTKCVKLLL...-........................
HGL_H00000304292-1  .....LHLAARN.......................G.....HKAVVQT--...-........................
HGL_H00000314556    .....LVLATQM.......................C.....RPTICQLLI...-........................
HGL_H00000263388    .....LHWAAAV.......................N.....NVEATLALL...-........................
HGL_H00000260047    .....GHVAAFK.......................G.....DLEMLKKLL...E........................
HGL_H00000342295    .....VHIAAAG.......................G.....FSDIINELA...K........................
HGL_H00000261537    .....LHLAALN.......................-.....---------...-........................
HGL_H00000277541-1  .....LHWAAAV.......................N.....NVDAALVLL...-........................
HGL_H00000307298-2  .....LKVAAES.......................C.....KADVVELLL...Shadcdrrsriealellgasfandr
HGL_H00000386502    .....LHIAAAN.......................K.....AVKCAEALV...-........................
HGL_H00000347802    .....LMIASLG.......................G.....HAAICSQLL...-........................
HGL_H00000296525    .....LYVACMS.......................Q.....QYHCIWMLL...-........................
HGL_H00000274457-1  .....LHDCAES.......................G.....SLDIMKMLL...-........................
HGL_H00000262457    .....LHWAANH.......................Kdps..AVHTVRCIL...D........................
HGL_H00000256646    .....LHWAAAV.......................N.....NVEATLLLL...-........................
HGL_H00000400113    .....LMLSASK.......................Vi....GPEPTGFLL...-........................
HGL_H00000277541-2  .....LHWAAAV.......................N.....NARAARSLL...-........................
HGL_H00000274457-2  .....LHLAVGKnttcvgryavckf..........P.....SLQVTAILI...-........................
HGL_H00000262970    .....LILAAQM.......................G.....HTDLCRLLL...-........................
HGL_H00000401369    .....LHLACRR.......................G.....HVAVVELLL...-........................
HGL_H00000358983    .....LHLATEM.......................E.....ELGLVTHLV...T........................
HGL_H00000304586    .....LFHCTSA.......................G.....HQQMVKFLL...-........................
HGL_H00000304292-2  .....LIYACSG.......................G.....HHEVATLLL...-........................
HGL_H00000360826    .....IHDAARA.......................G.....FLDTLQTLL...-........................
HGL_H00000360762-1  .....LHVAVRT.......................G.....HYECAEHLI...-........................
HGL_H00000275699    .....VHSAADG.......................Q.....NAQCLELLI...-........................
HGL_H00000325663    .....LHLAAEE.......................A.....NLELIRLFL...-........................
HGL_H00000339115    .....LHFAARG.......................G.....HTPILDRLL...-........................
HGL_H00000364158    .....LMLAAVT.......................G.....QLPLVQLLV...-........................
HGL_H00000417914    .....LYVACTY.......................Q.....RVDCVRKLL...-........................
HGL_H00000306163    .....LHVAVRT.......................G.....HVEIVEHFL...-........................
HGL_H00000337056    .....VHDAART.......................G.....FLDTLKVLV...-........................
HGL_H00000369855    .....LYVACEK.......................Q.....QLACAKKLL...-........................
HGL_H00000282272    .....LHYAAAN.......................C.....HFHCIETLV...-........................
HGL_H00000370259-3  .....LHMAASE.......................G.....HASIVEVLL...-........................
HGL_H00000375690    .....IHQACQR.......................G.....HSQHLEHLL...-........................
HGL_H00000164227    .....LHVAVNT.......................G.....CHQAALLLL...-........................
HGL_H00000263433    .....LHVAAAK.......................G.....YIEVMRLLL...-........................
HGL_H00000391126-1  .....LHMACAS.......................G.....YKEVASLIL...-........................
HGL_H00000357681    .....LMRVSAVs......................G.....SQKVASLLI...-........................
HGL_H00000360762-2  .....LHVDVRT.......................G.....HYECAEHLI...-........................
HGL_H00000357914-1  .....LHMAAAD.......................G.....HVHIVELLV...-........................
HGL_H00000284629-1  .....IMYAARD.......................G.....HPQVVALLV...-........................
HGL_H00000320893    .....LHWAAFK.......................N.....NAECVRALL...-........................
HGL_H00000217958-2  .....MHRAAAK.......................G.....NLKMIHILL...-........................
HGL_H00000284629-2  .....IMYAARD.......................G.....HPQVVALLV...-........................
HGL_H00000269856    .....LLAASVT.......................G.....HTNIVEYLI...-........................
HGL_H00000345193-1  .....IHQACRF.......................G.....HVQHLEHLL...-........................
HGL_H00000304292-2  .....LHLACTY.......................G.....HEDCVKALV...-........................
HGL_H00000276925-1  .....IQV-MMM.......................G.....SAHMAELLL...-........................
HGL_H00000343362    .....-----QYitvtsdqsvnpfedllvingtsfD.....ENSFAARLI...-........................
HGL_H00000262209    .....VMITCAK.......................D.....NSESLEIL-...-........................
HGL_H00000217958-3  .....LHLACYN.......................G.....KFEVAKEII...Q........................
HGL_H00000343362    .....LHMAIQR.......................Q.....DSKSALFLL...-........................
HGL_H00000276925-2  .....----MMM.......................G.....NTQVAALLL...-........................
HGL_H00000320291    .....LLAAARE.......................Gk....IADLTALLN...R........................
HGL_H00000262209    .....LHHASMG.......................G.....YTQTIKVIL...D........................
HGL_H00000321679    .....LHVAVRT.......................G.....HSDCLKYLV...-........................
HGL_H00000371734-2  .....LMLAVSH.......................G.....RIDMVKGLL...-........................
HGL_H00000360689    .....LHNAASY.......................G.....HVDVAALLI...-........................
HGL_H00000382545-1  .....LWIASQM.......................G.....HSKVVRVIL...-........................
HGL_H00000311579    .....LHNAASY.......................G.....HVDIAALLI...-........................
HGL_H00000392839    .....LHFACHA.......................G.....QQDIAELLV...-........................
HGL_H00000252985    .....LHLAVQA.......................A.....NPTLVQLLL...E........................
HGL_H00000392839    .....AHFAAKG.......................G.....FFDILKLLF...-........................
HGL_H00000217958-5  .....MHRAA--.......................-.....---------...-........................
HGL_H00000303518-2  .....LHSACKW.......................S.....NTRVASFLL...-........................
HGL_H00000357914-2  .....LHMAAAD.......................G.....HAHIVELLV...-........................
HGL_H00000296785-1  .....LSLACSK.......................G.....YTDIVKMLL...-........................
HGL_H00000405112-2  .....YLLALKD.......................N.....KQQVAELLI...-........................
HGL_H00000349612    .....-------.......................-.....---------...-........................
HGL_H00000260947    .....LHEACNH.......................G.....HLKVAELLL...-........................
HGL_H00000403487    .....LHLAASH.......................G.....HRDIVQKLL...-........................
HGL_H00000415252    .....LMLAVSH.......................G.....RVDVVKALL...-........................
HGL_H00000398321    .....LHRASYC.......................G.....HTEIARLLL...-........................
HGL_H00000305071    .....LSLASMG.......................G.....YTDIVGLLL...-........................
HGL_H00000379435    .....LYLAAVY.......................G.....HLDCFRLLL...-........................
HGL_H00000262126    .....LHEACNV.......................G.....YYDVAKVLI...-........................
HGL_H00000264607    .....-------.......................-.....---------...-........................
HGL_H00000303518-1  .....LHSVCKW.......................S.....NTTVASFLL...-........................
HGL_H00000331873    .....-------.......................-.....---------...-........................
HGL_H00000274361    .....LHEASNE.......................G.....FSDIIVELL...-........................
HGL_H00000282272    .....LDLAAFR.......................G.....HAECVEALV...-........................
HGL_H00000414663-2  .....LIHAAEK.......................N.....FLTTVAILL...-........................
HGL_H00000352358    .....LSFAACV.......................G.....SEEIVRLLI...-........................
HGL_H00000296785-2  .....LSLACSK.......................G.....HMNIVKMLL...-........................
HGL_H00000215941-2  .....LHFASCN.......................G.....NDQIVQLLL...-........................
HGL_H00000352814    .....LMLAISH.......................G.....REDMVMALL...-........................
HGL_H00000386239    .....LHEACNY.......................G.....HLEIVRFLL...-........................
HGL_H00000320076    .....LHLAAAN.......................G.....HLHCLSFLV...-........................
HGL_H00000328327-3  .....IHWLAVN.......................G.....RTELLRDLV...-........................
HGL_H00000360998    .....------K.......................Q.....NEYLVRMLL...-........................
HGL_H00000351881    .....LHL---C.......................G.....HVDTIQFLV...-........................
HGL_H00000265310    .....LSFAACV.......................G.....SEEIVQLFI...-........................
HGL_H00000294053    .....LHYAVLA.......................D.....DYRTVKELL...-........................
HGL_H00000274361    .....LHEASVG.......................G.....FYRTANELL...-........................
HGL_H00000340836-1  .....LYWACHG.......................G.....HKDIVEVLF...T........................
HGL_H00000217958-4  .....LHIAASA.......................S.....RDEIVKALL...-........................
HGL_H00000353796    .....LHLAAPE.......................G.....LLGCMKTLV...-........................
HGL_H00000349140-1  .....LHYAADC.......................G.....QLEILEFLL...-........................
HGL_H00000299234    .....LCRLASR.......................A.....DTEGLRAWC...-........................
HGL_H00000328327-2  .....IHWLAVN.......................G.....RTELLHDLV...-........................
HGL_H00000303570    .....LMHAAYK.......................G.....KLDMCKLLL...-........................
HGL_H00000267339    .....AHIAAFG.......................G.....HPQCLVWLI...-........................
HGL_H00000369579    .....LHCAALR.......................G.....HMPVLAFMM...-........................
HGL_H00000368848    .....IHYAGCY.......................G.....QEKILLWLLqfmQ........................
HGL_H00000401089    .....LMVACITkhvdqqsi...............S.....KSKMVKYLL...-........................
HGL_H00000350331-1  .....LCDACAS.......................G.....SIECVKFLL...-........................
HGL_H00000265140    .....LHDALSN.......................G.....HVEIGKLLL...-........................
HGL_H00000414663-1  .....LIHAAEK.......................N.....FLTTVAILL...-........................
HGL_H00000375751    .....LHNAVCA.......................G.....HTEIVKFLV...-........................
HGL_H00000355827-2  .....-------.......................-.....---------...-........................
HGL_H00000314103    .....LMAACRAryddpq.................N.....KARMVRYLL...-........................
HGL_H00000280758-2  .....LQLAAAV.......................G.....NFELVSLLL...-........................
HGL_H00000331065    .....LHEAVLS.......................G.....NLECVKLLV...-........................
HGL_H00000378013    .....IHYACWY.......................G.....KVEATRILL...E........................
HGL_H00000261312    .....LNWASAF.......................G.....TQEMVEFLC...-........................
HGL_H00000202556    .....LHNAVCA.......................G.....HHHIVKFLL...-........................
HGL_H00000298992    .....FSHSAAH.......................G.....HRNILRKLL...-........................
HGL_H00000307541    .....-------.......................-.....---------...-........................
HGL_H00000349140-2  .....L------.......................-.....---------...-........................
HGL_H00000371734-1  .....LILAVSH.......................G.....WTDMLKGLL...-........................
HGL_H00000370259-2  .....VAHAASE.......................G.....HASIVEVLL...-........................
HGL_H00000324287    .....LIQAVLG.......................G.....SLVTCEFLL...-........................
HGL_H00000346733    .....LVQAVLG.......................G.....SLIICEFLL...-........................
HGL_H00000403902    .....LHNAICG.......................A.....NYTIVDFLI...-........................
HGL_H00000253810    .....VSLACAG.......................G.....HLAVVELLL...-........................
HGL_H00000384801    .....LHLVAQH.......................G.....HYFTAEVLL...-........................
HGL_R00000013095    .....LGP--VI.......................G.....HMEVLHLLL...-........................
HGL_H00000277458    .....ICLKSFK.......................L.....HFRLLRFLL...-........................
HGL_H00000335147    .....VHLAAGG.......................G.....FAYFLLWQL...-........................
HGL_H00000158762    .....LIQATAA.......................N.....SLLACEFLL...-........................
HGL_H00000303518-3  .....-------.......................-.....---------...-........................
HGL_H00000299824-2  .....LHIARAN.......................G.....YLRTAELLL...-........................
HGL_H00000356685    .....LYAACMA.......................G.....QSDVIRALA...-........................
HGL_H00000240361    .....LFVAALL.......................G.....LTKFVDILV...-........................
HGL_H00000265742    .....MHLLCMGpqimisegalhprlarpveddf.R.....RADCLQMIL...R........................
HGL_H00000320340    .....LHHAVSA.......................G.....SKEVVRYLL...D........................
HGL_H00000308772    .....LHYAASN.......................D.....HAHYVSFLI...-........................
HGL_H00000349041    .....-------.......................-.....---------...-........................
HGL_H00000378338    dlskqLHSSVRT.......................G.....NLETCLRLL...-........................
HGL_H00000367705    .....-XXACAR.......................G.....WLNIVRHLL...-........................
HGL_H00000396078    .....LHYAAKT.......................G.....NGEIVKYIL...-........................
HGL_H00000419199    .....LQIALRM.......................G.....NYELISLLL...-........................
HGL_H00000385887    .....LHVACER.......................EdshqcARDVVRLLL...-........................
HGL_H00000396747    .....LYITSHR.......................G.....HLDAVWYLL...-........................
HGL_M00000098100    .....LSEAAAG.......................G.....QPLAIQLLA...-........................
HGL_H00000365830    .....LHWAAKH.......................G.....RQELLATLV...Nfagkh...................
HGL_H00000407057    .....-------.......................-.....---------...-........................
HGL_H00000350331-3  .....-------.......................-.....---------...-........................
HGL_H00000368859    .....LHYAAYF.......................D.....VPEVIRVILktsK........................
HGL_H00000347464    .....LHSSVRT.......................G.....NLETCLRLL...-........................
HGL_H00000274457-1  .....LHLAVDKnttcvgrypvckf..........P.....SLQVTAILI...-........................
HGL_H00000230792    .....-HSAAAE.......................G.....DMAKLTGLL...S........................
HGL_H00000310447    .....LLFAAYS.......................G.....DVSALRRFA...-........................
HGL_H00000353732    .....LHYAAYF.......................D.....VPDLVRVLL...-........................
HGL_H00000305721    .....LHLVSSC.......................G.....KKAVLDWLI...-........................
HGL_H00000359982    .....VHECVFK.......................G.....DVRRLSSLI...-........................
HGL_H00000382659    .....LALAASS.......................G.....K--------...-........................
HGL_H00000269856    .....LHMAVDKettnvgryrvgtf..........P.....SLHVVKVLL...Dlll.....................
HGL_H00000317379    .....LLFAAYT.......................G.....DVSALRRFA...-........................
HGL_H00000261740    .....LMMAAKT.......................G.....KIGIFQHII...-........................
HGL_H00000386897    .....LHLACRK.......................G.....NVVLAQLLI...-........................
HGL_H00000340913-2  .....IILAAHC.......................Q.....EYEIVHTLL...-........................
HGL_H00000378328    .....LHLATTL.......................G.....HLECARVLL...-........................
HGL_H00000386532    .....LSRALQT.......................-.....---------...-........................
HGL_H00000261739    .....-------.......................-.....---------...-........................
HGL_H00000215941-1  .....LHFASCN.......................G.....NDQIVQLLL...-........................
HGL_H00000334879    .....LHWIAKH.......................G.....SLRALQDLV...S........................
HGL_H00000380413    .....LHLSSAM.......................A.....NVVFTQLLI...-........................
HGL_H00000368966    .....-------.......................-.....---------...-........................
HGL_H00000328160    .....LHLAAEL.......................A.....HVVITQLLL...-........................
HGL_H00000262839    .....IMLAAHT.......................N.....NYEIIKLLV...-........................
HGL_H00000343362    .....LLLAYMK.......................G.....NANLCRAIV...-........................
HGL_H00000369003    .....IILAAHT.......................N.....NYEIIKLLV...-........................
HGL_H00000232744    .....LFTSCKK.......................G.....DVGRVRYLL...E........................
HGL_H00000419313    .....VILAAHR.......................N.....NYEILTMLL...-........................
HGL_H00000161863    .....LMVAAGR.......................G.....FASQVEQLI...-........................
HGL_H00000402616-1  .....-------.......................-.....---------...-........................
HGL_M00000035452    .....LHRACAR.......................H.....DAPALCLLL...-........................
HGL_H00000416826    .....MHILFQK.......................G.....MLKRMKKLI...-........................
HGL_H00000373600    .....LFLGYNQ.......................Nsw...HLGVVKLLV...L........................
HGL_H00000321813    .....LMWACAL.......................G.....HLEAAVLLF...R........................
HGL_M00000056646    .....-LKAAQE.......................G.....NVAELRRLL...Epreag...................
HGL_H00000385887    .....----AEE.......................G.....DHDRVYGIL...K........................
HGL_H00000387907    .....IHAAAEA.......................G.....QLLILKAFV...N........................
HGL_H00000416826    .....LMQLCIQa......................G.....ENQLFRWLM...-........................
HGL_N10020562       .....-------.......................-.....---------...-........................
HGL_H00000350686    .....-------.......................-.....---------...-........................
HGL_H00000321627    .....-------.......................-.....---------...-........................
HGL_H00000386337    .....-------.......................-.....---------...-........................
HGL_H00000378871    .....-------.......................-.....---------...-........................
HGL_N000000797401   .....-------.......................-.....---------...-........................
HGL_H00000307298-1  .....LHLAVDFntpvddfhtnnvcsf........P.....NALVTKLLL...-........................
HGL_H00000340913-1  .....LTLACQK.......................D.....LYEIARLLM...-........................
HGL_H00000320509    .....-------.......................-.....---------...-........................
HGL_H00000262547    .....---AALN.......................K.....HQEAIPVLT...-........................


                                                                                                    
                                                                                                    
d2fo1e1               ..............................................................................
HGL_H00000312988    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000306678    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000256707    ..............................................................................
HGL_H00000411147-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000330161    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000374171    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000263635    ..............................................................................
HGL_H00000386135    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000417980-1  ..............................................................................
HGL_H00000216797    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000345767    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000350297    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000345065    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000348081    ..............................................................................
HGL_H00000388725-2  ..............................................................................
HGL_H00000389168    ..............................................................................
HGL_H00000402044    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000353518    ..............................................................................
HGL_H00000217958-1  ..............................................................................
HGL_H00000388725-1  ..............................................................................
HGL_H00000275015    ..............................................................................
HGL_H00000299824-1  ..............................................................................
HGL_H00000325355    ..............................................................................
HGL_H00000369434    ..............................................................................
HGL_H00000338769    ..............................................................................
HGL_H00000403397    ..............................................................................
HGL_H00000226574    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000382545-2  ..............................................................................
HGL_H00000328327-1  ..............................................................................
HGL_H00000356240    ..............................................................................
HGL_H00000301030    ..............................................................................
HGL_H00000391126-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000417980-2  ..............................................................................
HGL_H00000333142    ..............................................................................
HGL_H00000411147-1  ..............................................................................
HGL_H00000160373    geespedtskp...................................................................
HGL_H00000350331-2  ..............................................................................
HGL_H00000345436    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000378210    ..............................................................................
HGL_H00000304292-1  ..............................................................................
HGL_H00000314556    ..............................................................................
HGL_H00000263388    ..............................................................................
HGL_H00000260047    ..............................................................................
HGL_H00000342295    ..............................................................................
HGL_H00000261537    ..............................................................................
HGL_H00000277541-1  ..............................................................................
HGL_H00000307298-2  enydimktyhylylamlerfqdgdnilekevlppihaygnrtecrnpqelesirqdrdalhmeglivrerilgadnid
HGL_H00000386502    ..............................................................................
HGL_H00000347802    ..............................................................................
HGL_H00000296525    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000256646    ..............................................................................
HGL_H00000400113    ..............................................................................
HGL_H00000277541-2  ..............................................................................
HGL_H00000274457-2  ..............................................................................
HGL_H00000262970    ..............................................................................
HGL_H00000401369    ..............................................................................
HGL_H00000358983    ..............................................................................
HGL_H00000304586    ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000360826    ..............................................................................
HGL_H00000360762-1  ..............................................................................
HGL_H00000275699    ..............................................................................
HGL_H00000325663    ..............................................................................
HGL_H00000339115    ..............................................................................
HGL_H00000364158    ..............................................................................
HGL_H00000417914    ..............................................................................
HGL_H00000306163    ..............................................................................
HGL_H00000337056    ..............................................................................
HGL_H00000369855    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000370259-3  ..............................................................................
HGL_H00000375690    ..............................................................................
HGL_H00000164227    ..............................................................................
HGL_H00000263433    ..............................................................................
HGL_H00000391126-1  ..............................................................................
HGL_H00000357681    ..............................................................................
HGL_H00000360762-2  ..............................................................................
HGL_H00000357914-1  ..............................................................................
HGL_H00000284629-1  ..............................................................................
HGL_H00000320893    ..............................................................................
HGL_H00000217958-2  ..............................................................................
HGL_H00000284629-2  ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000345193-1  ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000276925-1  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000217958-3  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000276925-2  ..............................................................................
HGL_H00000320291    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000321679    ..............................................................................
HGL_H00000371734-2  ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000382545-1  ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000252985    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000217958-5  ..............................................................................
HGL_H00000303518-2  ..............................................................................
HGL_H00000357914-2  ..............................................................................
HGL_H00000296785-1  ..............................................................................
HGL_H00000405112-2  ..............................................................................
HGL_H00000349612    ..............................................................................
HGL_H00000260947    ..............................................................................
HGL_H00000403487    ..............................................................................
HGL_H00000415252    ..............................................................................
HGL_H00000398321    ..............................................................................
HGL_H00000305071    ..............................................................................
HGL_H00000379435    ..............................................................................
HGL_H00000262126    ..............................................................................
HGL_H00000264607    ..............................................................................
HGL_H00000303518-1  ..............................................................................
HGL_H00000331873    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000414663-2  ..............................................................................
HGL_H00000352358    ..............................................................................
HGL_H00000296785-2  ..............................................................................
HGL_H00000215941-2  ..............................................................................
HGL_H00000352814    ..............................................................................
HGL_H00000386239    ..............................................................................
HGL_H00000320076    ..............................................................................
HGL_H00000328327-3  ..............................................................................
HGL_H00000360998    ..............................................................................
HGL_H00000351881    ..............................................................................
HGL_H00000265310    ..............................................................................
HGL_H00000294053    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000340836-1  ..............................................................................
HGL_H00000217958-4  ..............................................................................
HGL_H00000353796    ..............................................................................
HGL_H00000349140-1  ..............................................................................
HGL_H00000299234    ..............................................................................
HGL_H00000328327-2  ..............................................................................
HGL_H00000303570    ..............................................................................
HGL_H00000267339    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000368848    ..............................................................................
HGL_H00000401089    ..............................................................................
HGL_H00000350331-1  ..............................................................................
HGL_H00000265140    ..............................................................................
HGL_H00000414663-1  ..............................................................................
HGL_H00000375751    ..............................................................................
HGL_H00000355827-2  ..............................................................................
HGL_H00000314103    ..............................................................................
HGL_H00000280758-2  ..............................................................................
HGL_H00000331065    ..............................................................................
HGL_H00000378013    ..............................................................................
HGL_H00000261312    ..............................................................................
HGL_H00000202556    ..............................................................................
HGL_H00000298992    ..............................................................................
HGL_H00000307541    ..............................................................................
HGL_H00000349140-2  ..............................................................................
HGL_H00000371734-1  ..............................................................................
HGL_H00000370259-2  ..............................................................................
HGL_H00000324287    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000403902    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000384801    ..............................................................................
HGL_R00000013095    ..............................................................................
HGL_H00000277458    ..............................................................................
HGL_H00000335147    ..............................................................................
HGL_H00000158762    ..............................................................................
HGL_H00000303518-3  ..............................................................................
HGL_H00000299824-2  ..............................................................................
HGL_H00000356685    ..............................................................................
HGL_H00000240361    ..............................................................................
HGL_H00000265742    ..............................................................................
HGL_H00000320340    ..............................................................................
HGL_H00000308772    ..............................................................................
HGL_H00000349041    ..............................................................................
HGL_H00000378338    ..............................................................................
HGL_H00000367705    ..............................................................................
HGL_H00000396078    ..............................................................................
HGL_H00000419199    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000396747    ..............................................................................
HGL_M00000098100    ..............................................................................
HGL_H00000365830    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000350331-3  ..............................................................................
HGL_H00000368859    ..............................................................................
HGL_H00000347464    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000230792    ..............................................................................
HGL_H00000310447    ..............................................................................
HGL_H00000353732    ..............................................................................
HGL_H00000305721    ..............................................................................
HGL_H00000359982    ..............................................................................
HGL_H00000382659    ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000317379    ..............................................................................
HGL_H00000261740    ..............................................................................
HGL_H00000386897    ..............................................................................
HGL_H00000340913-2  ..............................................................................
HGL_H00000378328    ..............................................................................
HGL_H00000386532    ..............................................................................
HGL_H00000261739    ..............................................................................
HGL_H00000215941-1  ..............................................................................
HGL_H00000334879    ..............................................................................
HGL_H00000380413    ..............................................................................
HGL_H00000368966    ..............................................................................
HGL_H00000328160    ..............................................................................
HGL_H00000262839    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000369003    ..............................................................................
HGL_H00000232744    ..............................................................................
HGL_H00000419313    ..............................................................................
HGL_H00000161863    ..............................................................................
HGL_H00000402616-1  ..............................................................................
HGL_M00000035452    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_H00000373600    ..............................................................................
HGL_H00000321813    ..............................................................................
HGL_M00000056646    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000387907    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_N10020562       ..............................................................................
HGL_H00000350686    ..............................................................................
HGL_H00000321627    ..............................................................................
HGL_H00000386337    ..............................................................................
HGL_H00000378871    ..............................................................................
HGL_N000000797401   ..............................................................................
HGL_H00000307298-1  ..............................................................................
HGL_H00000340913-1  ..............................................................................
HGL_H00000320509    ..............................................................................
HGL_H00000262547    ..............................................................................


                                                                                                    
                                                                                                    
d2fo1e1               ..............................................................................
HGL_H00000312988    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000306678    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000256707    ..............................................................................
HGL_H00000411147-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000330161    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000374171    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000263635    ..............................................................................
HGL_H00000386135    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000417980-1  ..............................................................................
HGL_H00000216797    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000345767    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000350297    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000345065    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000348081    ..............................................................................
HGL_H00000388725-2  ..............................................................................
HGL_H00000389168    ..............................................................................
HGL_H00000402044    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000353518    ..............................................................................
HGL_H00000217958-1  ..............................................................................
HGL_H00000388725-1  ..............................................................................
HGL_H00000275015    ..............................................................................
HGL_H00000299824-1  ..............................................................................
HGL_H00000325355    ..............................................................................
HGL_H00000369434    ..............................................................................
HGL_H00000338769    ..............................................................................
HGL_H00000403397    ..............................................................................
HGL_H00000226574    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000382545-2  ..............................................................................
HGL_H00000328327-1  ..............................................................................
HGL_H00000356240    ..............................................................................
HGL_H00000301030    ..............................................................................
HGL_H00000391126-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000417980-2  ..............................................................................
HGL_H00000333142    ..............................................................................
HGL_H00000411147-1  ..............................................................................
HGL_H00000160373    ..............................................................................
HGL_H00000350331-2  ..............................................................................
HGL_H00000345436    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000378210    ..............................................................................
HGL_H00000304292-1  ..............................................................................
HGL_H00000314556    ..............................................................................
HGL_H00000263388    ..............................................................................
HGL_H00000260047    ..............................................................................
HGL_H00000342295    ..............................................................................
HGL_H00000261537    ..............................................................................
HGL_H00000277541-1  ..............................................................................
HGL_H00000307298-2  vshpiiyrgavyadnmefeqciklwlhalhlrqkgnrnthkdllrfaqvfsqmihlnetvkapdiecvlrcsvleieq
HGL_H00000386502    ..............................................................................
HGL_H00000347802    ..............................................................................
HGL_H00000296525    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000256646    ..............................................................................
HGL_H00000400113    ..............................................................................
HGL_H00000277541-2  ..............................................................................
HGL_H00000274457-2  ..............................................................................
HGL_H00000262970    ..............................................................................
HGL_H00000401369    ..............................................................................
HGL_H00000358983    ..............................................................................
HGL_H00000304586    ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000360826    ..............................................................................
HGL_H00000360762-1  ..............................................................................
HGL_H00000275699    ..............................................................................
HGL_H00000325663    ..............................................................................
HGL_H00000339115    ..............................................................................
HGL_H00000364158    ..............................................................................
HGL_H00000417914    ..............................................................................
HGL_H00000306163    ..............................................................................
HGL_H00000337056    ..............................................................................
HGL_H00000369855    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000370259-3  ..............................................................................
HGL_H00000375690    ..............................................................................
HGL_H00000164227    ..............................................................................
HGL_H00000263433    ..............................................................................
HGL_H00000391126-1  ..............................................................................
HGL_H00000357681    ..............................................................................
HGL_H00000360762-2  ..............................................................................
HGL_H00000357914-1  ..............................................................................
HGL_H00000284629-1  ..............................................................................
HGL_H00000320893    ..............................................................................
HGL_H00000217958-2  ..............................................................................
HGL_H00000284629-2  ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000345193-1  ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000276925-1  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000217958-3  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000276925-2  ..............................................................................
HGL_H00000320291    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000321679    ..............................................................................
HGL_H00000371734-2  ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000382545-1  ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000252985    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000217958-5  ..............................................................................
HGL_H00000303518-2  ..............................................................................
HGL_H00000357914-2  ..............................................................................
HGL_H00000296785-1  ..............................................................................
HGL_H00000405112-2  ..............................................................................
HGL_H00000349612    ..............................................................................
HGL_H00000260947    ..............................................................................
HGL_H00000403487    ..............................................................................
HGL_H00000415252    ..............................................................................
HGL_H00000398321    ..............................................................................
HGL_H00000305071    ..............................................................................
HGL_H00000379435    ..............................................................................
HGL_H00000262126    ..............................................................................
HGL_H00000264607    ..............................................................................
HGL_H00000303518-1  ..............................................................................
HGL_H00000331873    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000414663-2  ..............................................................................
HGL_H00000352358    ..............................................................................
HGL_H00000296785-2  ..............................................................................
HGL_H00000215941-2  ..............................................................................
HGL_H00000352814    ..............................................................................
HGL_H00000386239    ..............................................................................
HGL_H00000320076    ..............................................................................
HGL_H00000328327-3  ..............................................................................
HGL_H00000360998    ..............................................................................
HGL_H00000351881    ..............................................................................
HGL_H00000265310    ..............................................................................
HGL_H00000294053    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000340836-1  ..............................................................................
HGL_H00000217958-4  ..............................................................................
HGL_H00000353796    ..............................................................................
HGL_H00000349140-1  ..............................................................................
HGL_H00000299234    ..............................................................................
HGL_H00000328327-2  ..............................................................................
HGL_H00000303570    ..............................................................................
HGL_H00000267339    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000368848    ..............................................................................
HGL_H00000401089    ..............................................................................
HGL_H00000350331-1  ..............................................................................
HGL_H00000265140    ..............................................................................
HGL_H00000414663-1  ..............................................................................
HGL_H00000375751    ..............................................................................
HGL_H00000355827-2  ..............................................................................
HGL_H00000314103    ..............................................................................
HGL_H00000280758-2  ..............................................................................
HGL_H00000331065    ..............................................................................
HGL_H00000378013    ..............................................................................
HGL_H00000261312    ..............................................................................
HGL_H00000202556    ..............................................................................
HGL_H00000298992    ..............................................................................
HGL_H00000307541    ..............................................................................
HGL_H00000349140-2  ..............................................................................
HGL_H00000371734-1  ..............................................................................
HGL_H00000370259-2  ..............................................................................
HGL_H00000324287    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000403902    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000384801    ..............................................................................
HGL_R00000013095    ..............................................................................
HGL_H00000277458    ..............................................................................
HGL_H00000335147    ..............................................................................
HGL_H00000158762    ..............................................................................
HGL_H00000303518-3  ..............................................................................
HGL_H00000299824-2  ..............................................................................
HGL_H00000356685    ..............................................................................
HGL_H00000240361    ..............................................................................
HGL_H00000265742    ..............................................................................
HGL_H00000320340    ..............................................................................
HGL_H00000308772    ..............................................................................
HGL_H00000349041    ..............................................................................
HGL_H00000378338    ..............................................................................
HGL_H00000367705    ..............................................................................
HGL_H00000396078    ..............................................................................
HGL_H00000419199    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000396747    ..............................................................................
HGL_M00000098100    ..............................................................................
HGL_H00000365830    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000350331-3  ..............................................................................
HGL_H00000368859    ..............................................................................
HGL_H00000347464    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000230792    ..............................................................................
HGL_H00000310447    ..............................................................................
HGL_H00000353732    ..............................................................................
HGL_H00000305721    ..............................................................................
HGL_H00000359982    ..............................................................................
HGL_H00000382659    ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000317379    ..............................................................................
HGL_H00000261740    ..............................................................................
HGL_H00000386897    ..............................................................................
HGL_H00000340913-2  ..............................................................................
HGL_H00000378328    ..............................................................................
HGL_H00000386532    ..............................................................................
HGL_H00000261739    ..............................................................................
HGL_H00000215941-1  ..............................................................................
HGL_H00000334879    ..............................................................................
HGL_H00000380413    ..............................................................................
HGL_H00000368966    ..............................................................................
HGL_H00000328160    ..............................................................................
HGL_H00000262839    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000369003    ..............................................................................
HGL_H00000232744    ..............................................................................
HGL_H00000419313    ..............................................................................
HGL_H00000161863    ..............................................................................
HGL_H00000402616-1  ..............................................................................
HGL_M00000035452    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_H00000373600    ..............................................................................
HGL_H00000321813    ..............................................................................
HGL_M00000056646    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000387907    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_N10020562       ..............................................................................
HGL_H00000350686    ..............................................................................
HGL_H00000321627    ..............................................................................
HGL_H00000386337    ..............................................................................
HGL_H00000378871    ..............................................................................
HGL_N000000797401   ..............................................................................
HGL_H00000307298-1  ..............................................................................
HGL_H00000340913-1  ..............................................................................
HGL_H00000320509    ..............................................................................
HGL_H00000262547    ..............................................................................


                                                                                                    
                                                                                                    
d2fo1e1               ..............................................................................
HGL_H00000312988    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000280772    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000306678    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000256707    ..............................................................................
HGL_H00000411147-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000330161    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000374171    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000263635    ..............................................................................
HGL_H00000386135    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000417980-1  ..............................................................................
HGL_H00000216797    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000373287    ..............................................................................
HGL_H00000345767    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000350297    ..............................................................................
HGL_H00000267116    ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000345065    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000348081    ..............................................................................
HGL_H00000388725-2  ..............................................................................
HGL_H00000389168    ..............................................................................
HGL_H00000402044    ..............................................................................
HGL_H00000281131    ..............................................................................
HGL_H00000353518    ..............................................................................
HGL_H00000217958-1  ..............................................................................
HGL_H00000388725-1  ..............................................................................
HGL_H00000275015    ..............................................................................
HGL_H00000299824-1  ..............................................................................
HGL_H00000325355    ..............................................................................
HGL_H00000369434    ..............................................................................
HGL_H00000338769    ..............................................................................
HGL_H00000403397    ..............................................................................
HGL_H00000226574    ..............................................................................
HGL_H00000349588    ..............................................................................
HGL_H00000382545-2  ..............................................................................
HGL_H00000328327-1  ..............................................................................
HGL_H00000356240    ..............................................................................
HGL_H00000301030    ..............................................................................
HGL_H00000391126-2  ..............................................................................
HGL_H00000351416    ..............................................................................
HGL_H00000417980-2  ..............................................................................
HGL_H00000333142    ..............................................................................
HGL_H00000411147-1  ..............................................................................
HGL_H00000160373    ..............................................................................
HGL_H00000350331-2  ..............................................................................
HGL_H00000345436    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000378210    ..............................................................................
HGL_H00000304292-1  ..............................................................................
HGL_H00000314556    ..............................................................................
HGL_H00000263388    ..............................................................................
HGL_H00000260047    ..............................................................................
HGL_H00000342295    ..............................................................................
HGL_H00000261537    ..............................................................................
HGL_H00000277541-1  ..............................................................................
HGL_H00000307298-2  smnrvknisdadvhsamdnyecnlytflylvcistktqcseedqckinkqiynlihldprtregftllhlavnsntpv
HGL_H00000386502    ..............................................................................
HGL_H00000347802    ..............................................................................
HGL_H00000296525    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000262457    ..............................................................................
HGL_H00000256646    ..............................................................................
HGL_H00000400113    ..............................................................................
HGL_H00000277541-2  ..............................................................................
HGL_H00000274457-2  ..............................................................................
HGL_H00000262970    ..............................................................................
HGL_H00000401369    ..............................................................................
HGL_H00000358983    ..............................................................................
HGL_H00000304586    ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000360826    ..............................................................................
HGL_H00000360762-1  ..............................................................................
HGL_H00000275699    ..............................................................................
HGL_H00000325663    ..............................................................................
HGL_H00000339115    ..............................................................................
HGL_H00000364158    ..............................................................................
HGL_H00000417914    ..............................................................................
HGL_H00000306163    ..............................................................................
HGL_H00000337056    ..............................................................................
HGL_H00000369855    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000370259-3  ..............................................................................
HGL_H00000375690    ..............................................................................
HGL_H00000164227    ..............................................................................
HGL_H00000263433    ..............................................................................
HGL_H00000391126-1  ..............................................................................
HGL_H00000357681    ..............................................................................
HGL_H00000360762-2  ..............................................................................
HGL_H00000357914-1  ..............................................................................
HGL_H00000284629-1  ..............................................................................
HGL_H00000320893    ..............................................................................
HGL_H00000217958-2  ..............................................................................
HGL_H00000284629-2  ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000345193-1  ..............................................................................
HGL_H00000304292-2  ..............................................................................
HGL_H00000276925-1  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000217958-3  ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000276925-2  ..............................................................................
HGL_H00000320291    ..............................................................................
HGL_H00000262209    ..............................................................................
HGL_H00000321679    ..............................................................................
HGL_H00000371734-2  ..............................................................................
HGL_H00000360689    ..............................................................................
HGL_H00000382545-1  ..............................................................................
HGL_H00000311579    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000252985    ..............................................................................
HGL_H00000392839    ..............................................................................
HGL_H00000217958-5  ..............................................................................
HGL_H00000303518-2  ..............................................................................
HGL_H00000357914-2  ..............................................................................
HGL_H00000296785-1  ..............................................................................
HGL_H00000405112-2  ..............................................................................
HGL_H00000349612    ..............................................................................
HGL_H00000260947    ..............................................................................
HGL_H00000403487    ..............................................................................
HGL_H00000415252    ..............................................................................
HGL_H00000398321    ..............................................................................
HGL_H00000305071    ..............................................................................
HGL_H00000379435    ..............................................................................
HGL_H00000262126    ..............................................................................
HGL_H00000264607    ..............................................................................
HGL_H00000303518-1  ..............................................................................
HGL_H00000331873    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000282272    ..............................................................................
HGL_H00000414663-2  ..............................................................................
HGL_H00000352358    ..............................................................................
HGL_H00000296785-2  ..............................................................................
HGL_H00000215941-2  ..............................................................................
HGL_H00000352814    ..............................................................................
HGL_H00000386239    ..............................................................................
HGL_H00000320076    ..............................................................................
HGL_H00000328327-3  ..............................................................................
HGL_H00000360998    ..............................................................................
HGL_H00000351881    ..............................................................................
HGL_H00000265310    ..............................................................................
HGL_H00000294053    ..............................................................................
HGL_H00000274361    ..............................................................................
HGL_H00000340836-1  ..............................................................................
HGL_H00000217958-4  ..............................................................................
HGL_H00000353796    ..............................................................................
HGL_H00000349140-1  ..............................................................................
HGL_H00000299234    ..............................................................................
HGL_H00000328327-2  ..............................................................................
HGL_H00000303570    ..............................................................................
HGL_H00000267339    ..............................................................................
HGL_H00000369579    ..............................................................................
HGL_H00000368848    ..............................................................................
HGL_H00000401089    ..............................................................................
HGL_H00000350331-1  ..............................................................................
HGL_H00000265140    ..............................................................................
HGL_H00000414663-1  ..............................................................................
HGL_H00000375751    ..............................................................................
HGL_H00000355827-2  ..............................................................................
HGL_H00000314103    ..............................................................................
HGL_H00000280758-2  ..............................................................................
HGL_H00000331065    ..............................................................................
HGL_H00000378013    ..............................................................................
HGL_H00000261312    ..............................................................................
HGL_H00000202556    ..............................................................................
HGL_H00000298992    ..............................................................................
HGL_H00000307541    ..............................................................................
HGL_H00000349140-2  ..............................................................................
HGL_H00000371734-1  ..............................................................................
HGL_H00000370259-2  ..............................................................................
HGL_H00000324287    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000403902    ..............................................................................
HGL_H00000253810    ..............................................................................
HGL_H00000384801    ..............................................................................
HGL_R00000013095    ..............................................................................
HGL_H00000277458    ..............................................................................
HGL_H00000335147    ..............................................................................
HGL_H00000158762    ..............................................................................
HGL_H00000303518-3  ..............................................................................
HGL_H00000299824-2  ..............................................................................
HGL_H00000356685    ..............................................................................
HGL_H00000240361    ..............................................................................
HGL_H00000265742    ..............................................................................
HGL_H00000320340    ..............................................................................
HGL_H00000308772    ..............................................................................
HGL_H00000349041    ..............................................................................
HGL_H00000378338    ..............................................................................
HGL_H00000367705    ..............................................................................
HGL_H00000396078    ..............................................................................
HGL_H00000419199    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000396747    ..............................................................................
HGL_M00000098100    ..............................................................................
HGL_H00000365830    ..............................................................................
HGL_H00000407057    ..............................................................................
HGL_H00000350331-3  ..............................................................................
HGL_H00000368859    ..............................................................................
HGL_H00000347464    ..............................................................................
HGL_H00000274457-1  ..............................................................................
HGL_H00000230792    ..............................................................................
HGL_H00000310447    ..............................................................................
HGL_H00000353732    ..............................................................................
HGL_H00000305721    ..............................................................................
HGL_H00000359982    ..............................................................................
HGL_H00000382659    ..............................................................................
HGL_H00000269856    ..............................................................................
HGL_H00000317379    ..............................................................................
HGL_H00000261740    ..............................................................................
HGL_H00000386897    ..............................................................................
HGL_H00000340913-2  ..............................................................................
HGL_H00000378328    ..............................................................................
HGL_H00000386532    ..............................................................................
HGL_H00000261739    ..............................................................................
HGL_H00000215941-1  ..............................................................................
HGL_H00000334879    ..............................................................................
HGL_H00000380413    ..............................................................................
HGL_H00000368966    ..............................................................................
HGL_H00000328160    ..............................................................................
HGL_H00000262839    ..............................................................................
HGL_H00000343362    ..............................................................................
HGL_H00000369003    ..............................................................................
HGL_H00000232744    ..............................................................................
HGL_H00000419313    ..............................................................................
HGL_H00000161863    ..............................................................................
HGL_H00000402616-1  ..............................................................................
HGL_M00000035452    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_H00000373600    ..............................................................................
HGL_H00000321813    ..............................................................................
HGL_M00000056646    ..............................................................................
HGL_H00000385887    ..............................................................................
HGL_H00000387907    ..............................................................................
HGL_H00000416826    ..............................................................................
HGL_N10020562       ..............................................................................
HGL_H00000350686    ..............................................................................
HGL_H00000321627    ..............................................................................
HGL_H00000386337    ..............................................................................
HGL_H00000378871    ..............................................................................
HGL_N000000797401   ..............................................................................
HGL_H00000307298-1  ..............................................................................
HGL_H00000340913-1  ..............................................................................
HGL_H00000320509    ..............................................................................
HGL_H00000262547    ..............................................................................


                                          210                                        220            
                                            |                                          |            
d2fo1e1               .....................EKG.....SN..........KDKQ.........DE.........DGKTP........
HGL_H00000312988    .....................RAG.....AN..........PTAR.........MY.........GGRTP........
HGL_H00000407057    .....................KHG.....VT..........VDST.........TR.........MGYTP........
HGL_H00000280772    .....................NQG.....AN..........VDAQ.........TK.........MGYTP........
HGL_H00000349588    .....................KQG.....AN..........VNAK.........TK.........NGYTP........
HGL_H00000281131    .....................AYH.....AD..........VNAA.........DN.........EKRSA........
HGL_H00000280772    .....................QHN.....VP..........VDDV.........TN.........DYLTA........
HGL_H00000407057    .....................DHG.....AP..........IQAK.........TK.........NGLSP........
HGL_H00000306678    .....................QCG.....AH..........PNAA.........EQ.........SGWTP........
HGL_H00000282272    .....................NLG.....VE..........IDEI.........NI.........YGNTA........
HGL_H00000267116    .....................NNG.....AD..........VNYQ.........SK.........EGKSP........
HGL_H00000256707    .....................DAG.....TY..........VNIP.........DR.........SGDTV........
HGL_H00000411147-2  .....................DHG.....AD..........ICMR.........GE.........REKTP........
HGL_H00000351416    .....................GRG.....AH..........IDVR.........NK.........KGNTP........
HGL_H00000330161    .....................HRG.....AG..........KEAV.........TA.........EGCTA........
HGL_H00000253810    .....................NRG.....AH..........IDVR.........NK.........KGNTP........
HGL_H00000351416    .....................ERG.....AS..........LEEV.........ND.........EGYTP........
HGL_H00000374171    .....................DNG.....AA..........TDHA.........DK.........NGRTP........
HGL_H00000373287    .....................TSG.....TDm.........LNDT.........DGr........ATISP........
HGL_H00000262457    .....................ENN.....AD..........PNIQ.........DK.........EGRTA........
HGL_H00000263635    .....................EEG.....AE..........IDQS.........DK.........NGRTP........
HGL_H00000386135    .....................NQG.....CL..........VDFQ.........DR.........HGNTP........
HGL_H00000373287    .....................SHN.....AQ..........VNSV.........DS.........SGKTP........
HGL_H00000267116    .....................EKG.....ST..........ADAA.........DL.........RGRTA........
HGL_H00000349588    .....................DKR.....AN..........PNAR.........AL.........NGFTP........
HGL_H00000417980-1  .....................AAR.....CD..........LHAV.........NI.........HGDSP........
HGL_H00000216797    .....................SLG.....AD..........VNAQ.........EPc........NGRTA........
HGL_H00000369579    .....................DAH.....SD..........LNAI.........DN.........RQQTP........
HGL_H00000373287    .....................AHG.....AE..........VTCK.........DK.........KSYTP........
HGL_H00000345767    .....................SAF.....CS..........VHEK.........NQ.........AGDTA........
HGL_H00000311579    .....................RHG.....AS..........VNVA.........DL.........WKFTP........
HGL_H00000360689    .....................KHG.....AV..........VNVA.........DL.........WKFTP........
HGL_H00000350297    .....................QNC.....GN..........LDKQ.........TS.........MGNTV........
HGL_H00000267116    .....................QHQ.....AE..........VNAT.........DH.........MGRTA........
HGL_H00000360689    .....................KHG.....AC..........VNAM.........DL.........WQFTP........
HGL_H00000311579    .....................KHG.....AC..........VNAM.........DL.........WQFTP........
HGL_H00000345065    .....................SAQ.....HD..........TDIL.........DQ.........RQRTP........
HGL_H00000282272    .....................RHN.....AQ..........VNAV.........DN.........SGKTA........
HGL_H00000281419    .....................QNS.....GN..........LDKQ.........TS.........KGSTA........
HGL_H00000348081    .....................EGR.....CD..........VNAR.........NR.........KLQSP........
HGL_H00000388725-2  .....................DHG.....AD..........VNSR.........DK.........NGRTA........
HGL_H00000389168    .....................QAG.....YD..........VNIK.........DY.........DGWTP........
HGL_H00000402044    .....................KHG.....AD..........INTQ.........AS.........DSASA........
HGL_H00000281131    .....................QHG.....AE..........VNKA.........DN.........EGRTA........
HGL_H00000353518    .....................DAG.....MD..........SNYQ.........TE.........MG-SA........
HGL_H00000217958-1  .....................YYK.....AS..........TNIQ.........DT.........EGNTP........
HGL_H00000388725-1  .....................DHG.....AD..........VNSR.........DK.........NGRTA........
HGL_H00000275015    .....................QAG.....AQ..........VDAR.........ML.........NGCTP........
HGL_H00000299824-1  .....................DHG.....VR..........VDVK.........DW.........DGWEP........
HGL_H00000325355    .....................RAG.....IE..........INRQ.........TK.........TG-TA........
HGL_H00000369434    .....................DLG.....ID..........VDVR.........AAt........TGLTA........
HGL_H00000338769    .....................QNG.....GH..........LDAK.........AA.........DGNTA........
HGL_H00000403397    .....................TFN.....VS..........VNLG.........DKy........HKNTA........
HGL_H00000226574    .....................EGE.....AH..........VDST.........TY.........DGTTA........
HGL_H00000349588    .....................QND.....HNadvqskmm..VNRT.........TE.........SGFTP........
HGL_H00000382545-2  .....................KFS.....PT..........LGLL.........-K.........NGTTA........
HGL_H00000328327-1  .....................QRG.....AD..........TNLG.........RLe........DGQTP........
HGL_H00000356240    .....................QAG.....YE..........LNVQ.........DH.........DGWTP........
HGL_H00000301030    .....................AAG.....AE..........VNTK.........GL.........DDDTP........
HGL_H00000391126-2  .....................EHG.....AS..........LSAK.........DQ.........DGWEP........
HGL_H00000351416    .....................SKG.....AN..........VNRT.........TAn........NDHTV........
HGL_H00000417980-2  .....................NAR.....CD..........LHAV.........NY.........HGDTP........
HGL_H00000333142    .....................THG.....AN..........ADAR.........GE.........HGNTP........
HGL_H00000411147-1  .....................DSG.....AQ..........VNAA.........GW.........LHKTP........
HGL_H00000160373    .....................VVP.....ADl.........INHA.........DR.........EGWTA........
HGL_H00000350331-2  .....................NAG.....AN..........VNAA.........-K.........LHETA........
HGL_H00000345436    .....................QAG.....ID..........INRQ.........TK.........SG-TA........
HGL_H00000343362    .....................LAG.....AK..........VNEL.........TK.........HRQTA........
HGL_H00000378210    .....................SNG.....AD..........PNLY.........CNed.......SWQLP........
HGL_H00000304292-1  .....................---.....--..........----.........--.........EKGSA........
HGL_H00000314556    .....................DRG.....AD..........INSR.........DK.........QNRTA........
HGL_H00000263388    .....................KNG.....AN..........KDMQ.........DS.........KEETP........
HGL_H00000260047    .....................EGI.....IS..........FNER.........DD.........NGSTP........
HGL_H00000342295    .....................VPE.....CN..........LQAL.........DV.........DDRTP........
HGL_H00000261537    .....................KGN.....AN..........LDIQ.........NV.........NQQTA........
HGL_H00000277541-1  .....................KNG.....AN..........KDMQ.........NN.........KEETP........
HGL_H00000307298-2  ddfhtndvcsfpnalvtklllDCG.....AE..........VNAV.........DN.........EGNSA........
HGL_H00000386502    .....................SLL.....SN..........VNVS.........DR.........AGRTA........
HGL_H00000347802    .....................QRG.....AR..........VNVT.........DK.........DDKSA........
HGL_H00000296525    .....................YAG.....AD..........VQ-K.........GK.........YWDTP........
HGL_H00000274457-1  .....................MYC.....AK..........-MEK.........DG.........YGMTP........
HGL_H00000262457    .....................AAP.....TEsl........LNWQ.........DY.........EGRTP........
HGL_H00000256646    .....................KNG.....AN..........RDMQ.........DN.........KEETP........
HGL_H00000400113    .....................KFN.....PS..........LNVG.........DKt........HQNTP........
HGL_H00000277541-2  .....................QAG.....AD..........KDAQ.........DG.........REQTP........
HGL_H00000274457-2  .....................ECG.....AD..........VNIR.........DS.........DDSSP........
HGL_H00000262970    .....................QQG.....AA..........ANDQ.........DL.........QGRTA........
HGL_H00000401369    .....................SCG.....VS..........ANAM.........DY.........GGHTA........
HGL_H00000358983    .....................KLH.....AN..........VNAR.........TF.........AGNTP........
HGL_H00000304586    .....................DSG.....AN..........ANVR.........EPv........YGFTP........
HGL_H00000304292-2  .....................QHG.....AS..........INAS.........NN.........MGNTA........
HGL_H00000360826    .....................EFQ.....AD..........VNIE.........DN.........EGNLP........
HGL_H00000360762-1  .....................ACE.....AD..........LNSK.........DR.........EGDTP........
HGL_H00000275699    .....................ESG.....FD..........VNMLladhisqsyDD.........DRKTA........
HGL_H00000325663    .....................ELP.....SClsf.......VNAK.........AY.........NGNTA........
HGL_H00000339115    .....................LMG.....A-..........PGTR.........DS.........WGGTP........
HGL_H00000364158    .....................ERH.....AD..........IDKQ.........DSv........HGWTA........
HGL_H00000417914    .....................ELG.....AS..........VDNG.........Q-.........WMDTP........
HGL_H00000306163    .....................SLG.....VD..........INVR.........DR.........EGDSA........
HGL_H00000337056    .....................EYG.....AD..........VNMP.........DG.........TGSLP........
HGL_H00000369855    .....................ESG.....AS..........VNQ-.........GR.........DLDSP........
HGL_H00000282272    .....................TTG.....AN..........VNET.........DD.........WGRTA........
HGL_H00000370259-3  .....................KHG.....AD..........VNAK.........DM.........LKMTA........
HGL_H00000375690    .....................FYG.....AE..........PGAQ.........NA.........SGNTA........
HGL_H00000164227    .....................ERG.....AD..........IDAV.........DIk........SGRSP........
HGL_H00000263433    .....................QAG.....YD..........PELR.........DG.........DGWTP........
HGL_H00000391126-1  .....................AHG.....GD..........LDVA.........DD.........QHWTP........
HGL_H00000357681    .....................EAG.....AN..........VNVK.........DK.........DGKTP........
HGL_H00000360762-2  .....................ACK.....AD..........LNSK.........NK.........GGDTP........
HGL_H00000357914-1  .....................RNG.....AD..........VNAK.........DM.........LKMTA........
HGL_H00000284629-1  .....................VHG.....AD..........INAQ.........DE.........NGYTA........
HGL_H00000320893    .....................ESG.....AS..........VNAL.........DY.........NNDTP........
HGL_H00000217958-2  .....................YYK.....AS..........TNIQ.........DT.........EGNTP........
HGL_H00000284629-2  .....................VHG.....AD..........INAQ.........DE.........NGYTA........
HGL_H00000269856    .....................---.....--..........----.........--.........-----........
HGL_H00000345193-1  .....................FYG.....AN..........MGAQ.........NA.........SGNTA........
HGL_H00000304292-2  .....................YYD.....VQscr.......LDIG.........NE.........KGDTP........
HGL_H00000276925-1  .....................LHG.....AE..........PNCA.........DP.........ATLTP........
HGL_H00000343362    .....................QCG.....SN..........TDAP.........DTv........TGNCL........
HGL_H00000262209    .....................--G.....AD..........INIT.........DS.........EGRSP........
HGL_H00000217958-3  .....................ITG.....TEs.........LTKE.........NI.........FSETA........
HGL_H00000343362    .....................EHQ.....AD..........INVS.........RTq........DGETA........
HGL_H00000276925-2  .....................LHG.....AD..........PNCA.........DPv........TLTLP........
HGL_H00000320291    .....................PNP.....PD..........VNCV.........DQ.........LGNTP........
HGL_H00000262209    .....................TNL.....KC..........TDRL.........DE.........EGNTA........
HGL_H00000321679    .....................ECG.....PH..........TDAQ.........DKiggdlpsphKGDTA........
HGL_H00000371734-2  .....................ACG.....AD..........VNIQ.........DD.........EGSTA........
HGL_H00000360689    .....................KYN.....AC..........VNAT.........DK.........WAFTP........
HGL_H00000382545-1  .....................LHG.....AE..........RDAM.........QN.........DGTTA........
HGL_H00000311579    .....................KYN.....TC..........VNAT.........DK.........WAFTP........
HGL_H00000392839    .....................ESG.....AS..........IDAL.........SI.........NNSTP........
HGL_H00000252985    .....................LPR.....GD..........LRTF.........VNmka......HGNTA........
HGL_H00000392839    .....................AYN.....GD..........MGMI.........AM.........NGNTP........
HGL_H00000217958-5  .....................---.....--..........----.........--.........-----........
HGL_H00000303518-2  .....................QHD.....AD..........INAQ.........TK.........GLLTP........
HGL_H00000357914-2  .....................RNG.....AD..........VNAK.........DV.........PRVTA........
HGL_H00000296785-1  .....................DCG.....VD..........VNEY.........DW.........NGGTP........
HGL_H00000405112-2  .....................KEK.....AN..........IHAV.........DK.........-----........
HGL_H00000349612    .....................---.....--..........----.........--.........-----........
HGL_H00000260947    .....................QHK.....AL..........VNTT.........GY.........QNDSP........
HGL_H00000403487    .....................QYK.....AD..........INAV.........NE.........HGNVP........
HGL_H00000415252    .....................ACE.....AD..........VNIQ.........DD.........DGSTA........
HGL_H00000398321    .....................SHG.....SD..........PQLV.........DD.........DGMTS........
HGL_H00000305071    .....................EHD.....VD..........INIY.........DW.........NGGTP........
HGL_H00000379435    .....................LHG.....ADpd........YNCT.........DKgllvhvp..QPRTL........
HGL_H00000262126    .....................AAG.....AD..........VNTQ.........GL.........DDDTP........
HGL_H00000264607    .....................---.....--..........----.........--.........---SPgc......
HGL_H00000303518-1  .....................QHD.....AD..........INAQ.........TK.........GLLTP........
HGL_H00000331873    .....................---.....--..........----.........--.........-----........
HGL_H00000274361    .....................KAG.....AN..........VNCE.........SI.........HGILP........
HGL_H00000282272    .....................NQG.....AS..........IFVR.........DSv........TKRTP........
HGL_H00000414663-2  .....................EAG.....AF..........VNVQ.........QS.........NGETA........
HGL_H00000352358    .....................EHG.....AD..........IRAQ.........DS.........LGNTV........
HGL_H00000296785-2  .....................DGG.....VD..........VNEY.........DW.........NGGIP........
HGL_H00000215941-2  .....................DHG.....AD..........PNQR.........DG.........LGNTP........
HGL_H00000352814    .....................ECG.....AD..........VNAQ.........DS.........EGATA........
HGL_H00000386239    .....................DHG.....AS..........VDDP.........GGqgc......EGITP........
HGL_H00000320076    .....................SFG.....AN..........IWCL.........DN.........DYHTP........
HGL_H00000328327-3  .....................QHV.....SD..........VDVE.........DE.........MGQTA........
HGL_H00000360998    .....................DAG.....VE..........VNAT.........DC.........YGCTA........
HGL_H00000351881    .....................SNG.....LK..........IDIC.........NH.........QGATP........
HGL_H00000265310    .....................EHG.....AG..........IWGQ.........DS.........LGNTV........
HGL_H00000294053    .....................DGG.....AN..........PLQR.........NE.........MGHTP........
HGL_H00000274361    .....................KGG.....AD..........VNIK.........GM.........YQITP........
HGL_H00000340836-1  .....................QPN.....IE..........LNQQ.........NK.........LGDTP........
HGL_H00000217958-4  .....................GKG.....AQ..........VNAV.........NQ.........SGCTP........
HGL_H00000353796    .....................---.....--..........----.........--.........-----........
HGL_H00000349140-1  .....................LLF.....II..........PQAP.........DK.........HHITP........
HGL_H00000299234    .....................QAG.....AD..........LEQP.........GY.........DGRSA........
HGL_H00000328327-2  .....................QHV.....SD..........VDVE.........DA.........MGQTA........
HGL_H00000303570    .....................RHG.....AD..........VNCH.........QHe........HGYTA........
HGL_H00000267339    .....................QAG.....AN..........INKP.........DC.........EGETP........
HGL_H00000369579    .....................---.....--..........----.........--.........-----........
HGL_H00000368848    .....................EQG.....IS..........LDEV.........DQ.........DGNSA........
HGL_H00000401089    .....................DNR.....AD..........PNIQ.........DK.........SGKTA........
HGL_H00000350331-1  .....................SYG.....VK..........VNSP.........-L.........YTASP........
HGL_H00000265140    .....................QHG.....GPll........L---.........--.........-----........
HGL_H00000414663-1  .....................EAG.....AF..........VNVQ.........QS.........NGETA........
HGL_H00000375751    .....................QFG.....VN..........VNAA.........DS.........DGWTP........
HGL_H00000355827-2  .....................---.....--..........----.........--.........-----........
HGL_H00000314103    .....................EQG.....AD..........PNIA.........DR.........LGRTA........
HGL_H00000280758-2  .....................ERG.....ADpligtmyrngISTT.........PQ.........GDMNS........
HGL_H00000331065    .....................KYG.....AD..........IHQR.........DE.........TGWTP........
HGL_H00000378013    .....................KGK.....CN..........PNLL.........NG.........HLSSP........
HGL_H00000261312    .....................ERG.....AD..........VNRG.........Q-.........-RSSS........
HGL_H00000202556    .....................DFG.....VN..........VNAA.........DS.........DGWTP........
HGL_H00000298992    .....................---.....--..........----.........--.........-----........
HGL_H00000307541    .....................---.....--..........----.........--.........----Qtkrpgytw
HGL_H00000349140-2  .....................---.....--..........----.........--.........-----........
HGL_H00000371734-1  .....................ACG.....AD..........INIQ.........GE.........KGSTA........
HGL_H00000370259-2  .....................KHG.....AD..........VNAK.........DV.........LKMTA........
HGL_H00000324287    .....................QNG.....AN..........VNQR.........DV.........QGRGP........
HGL_H00000346733    .....................QNG.....AD..........VNQR.........DS.........RGRAP........
HGL_H00000403902    .....................AAG.....AN..........VNSP.........DS.........HGWTP........
HGL_H00000253810    .....................AHG.....AD..........PTHR.........LK.........DGSTM........
HGL_H00000384801    .....................HVG.....VS..........RDDL.........TK.........VDWTP........
HGL_R00000013095    .....................EHG.....AR..........PCLV.........TD.........VGWTP........
HGL_H00000277458    .....................ESG.....AA..........YNC-.........--.........-----........
HGL_H00000335147    .....................QTG.....AD..........LNQQ.........DV.........LGEAP........
HGL_H00000158762    .....................QNG.....AN..........VNQA.........DS.........AGRGP........
HGL_H00000303518-3  .....................---.....--..........----.........--.........-----........
HGL_H00000299824-2  .....................DHG.....VR..........VDVK.........DW.........DGWEP........
HGL_H00000356685    .....................KYG.....VN..........LNEK.........TA.........RGYTL........
HGL_H00000240361    .....................DYG.....SD..........PNHR.........CF.........DGSTP........
HGL_H00000265742    .....................WKG.....AKldqgeyeraaIDAV.........DN.........KKNTP........
HGL_H00000320340    .....................HAP.....PEi.........LDAV.........EE.........NGETC........
HGL_H00000308772    .....................SFG.....GN..........IFSL.........DN.........NLQSP........
HGL_H00000349041    .....................---.....--..........----.........--.........-----........
HGL_H00000378338    .....................SLG.....AQ..........ANFF.........HPe........KGTTP........
HGL_H00000367705    .....................EYG.....AD..........VNCS.........AQ.........DGTRP........
HGL_H00000396078    .....................DHG.....PSel........LDMA.........DSe........TGETA........
HGL_H00000419199    .....................RHG.....AN..........VNYF.........CR.........V--NP........
HGL_H00000385887    .....................SHG.....AS..........PNLL.........-W.........SGHSP........
HGL_H00000396747    .....................EHG.....AS..........CRRR.........SP.........VGRTA........
HGL_M00000098100    .....................ELG.....AS..........TNSK.........GA.........FGRTP........
HGL_H00000365830    .....................QLP.....VN..........INAR.........TS.........GGYTA........
HGL_H00000407057    .....................---.....--..........----.........--.........-----........
HGL_H00000350331-3  .....................---.....--..........----.........--.........-----........
HGL_H00000368859    .....................PKD.....VD..........DTCS.........DF.........NFGTA........
HGL_H00000347464    .....................SLG.....AQ..........ANFF.........HPe........KGNTP........
HGL_H00000274457-1  .....................ECG.....AD..........VNVR.........DS.........DDNSP........
HGL_H00000230792    .....................HSP.....SL..........LDET.........SE.........NGWTA........
HGL_H00000310447    .....................LSA.....MN..........MEQK.........DY.........DSRTA........
HGL_H00000353732    .....................-KG.....ARprvvn.....STCS.........DF.........NHGSA........
HGL_H00000305721    .....................EKG.....VD..........PLVK.........DKe........SGWTA........
HGL_H00000359982    .....................-RT.....HN..........IGQK.........DN.........HGNTP........
HGL_H00000382659    .....................---.....--..........----.........--.........-----........
HGL_H00000269856    .....................DCG.....AD..........PDSR.........DF.........DNNTP........
HGL_H00000317379    .....................LSA.....MD..........MEQR.........DY.........DSRTA........
HGL_H00000261740    .....................---.....--..........----.........--.........-----........
HGL_H00000386897    .....................WYG.....VD..........VMTR.........DA.........QGNTA........
HGL_H00000340913-2  .....................RKG.....A-..........----.........--.........-----........
HGL_H00000378328    .....................AHG.....AD..........VGRE.........NR.........SGWTV........
HGL_H00000386532    .....................---.....--..........----.........--.........-----........
HGL_H00000261739    .....................---.....--..........----.........--.........-----........
HGL_H00000215941-1  .....................DHR.....AD..........PNQR.........NG.........MGNTL........
HGL_H00000334879    .....................GAGkagivLD..........VNVR.........SS.........CGYTP........
HGL_H00000380413    .....................WYG.....VD..........VRSR.........DA.........RGLTP........
HGL_H00000368966    .....................---.....--..........----.........--.........-----........
HGL_H00000328160    .....................WYG.....AD..........VAAR.........DA.........QSRTA........
HGL_H00000262839    .....................---.....--..........----.........--.........-----........
HGL_H00000343362    .....................RSG.....AR..........LGVN.........NN.........QGV--........
HGL_H00000369003    .....................QKG.....V-..........----.........--.........-----........
HGL_H00000232744    .....................QRD.....VE..........VNVR.........DK.........WDSTP........
HGL_H00000419313    .....................KQ-.....--..........----.........--.........-----........
HGL_H00000161863    .....................SMG.....AN..........VHSK.........AS.........NGWMA........
HGL_H00000402616-1  .....................---.....--..........----.........--.........-----........
HGL_M00000035452    .....................RLG.....AD..........PAHQ.........DR.........HGDTA........
HGL_H00000416826    .....................---.....--..........----.........--.........-----........
HGL_H00000373600    .....................THG.....ADpqsyavr...RNEF.........PV.........IVRLP........
HGL_H00000321813    .....................WNQ.....QA..........LSIP.........DS.........LGRLP........
HGL_M00000056646    .....................GAG.....GN..........INAR.........DA.........FWWTP........
HGL_H00000385887    .....................DNL.....AY..........ADVA.........DA.........KGYTV........
HGL_H00000387907    .....................CSV.....LC..........LECK.........TA.........AGQTP........
HGL_H00000416826    .....................DHE.....PEwksh......INQK.........DE.........DGCTV........
HGL_N10020562       .....................---.....--..........----.........--.........-----........
HGL_H00000350686    .....................---.....--..........----.........--.........-----........
HGL_H00000321627    .....................---.....--..........----.........--.........-----........
HGL_H00000386337    .....................---.....--..........---L.........GS.........GGFTL........
HGL_H00000378871    .....................---.....--..........VNLA.........DR.........NGNTA........
HGL_N000000797401   .....................---.....--..........----.........--.........DGSTP........
HGL_H00000307298-1  .....................DCG.....TE..........VNAV.........DS.........EGNSA........
HGL_H00000340913-1  .....................---.....--..........----.........--.........-----........
HGL_H00000320509    .....................---.....--..........----.........--.........---TL........
HGL_H00000262547    .....................GRG.....VD..........VDQQ.........WG.........LYSTS........


                               230                                                                  
                                 |                                                                  
d2fo1e1               ....IML..AAQ...........EG.......RI............................................
HGL_H00000312988    ....LGS..ALL...........RP.......NA............................................
HGL_H00000407057    ....LHV..ASH...........YG.......NI............................................
HGL_H00000280772    ....LHV..GCH...........YG.......NI............................................
HGL_H00000349588    ....LHQ..AAQ...........QG.......HT............................................
HGL_H00000281131    ....LQS..AAW...........QG.......HM............................................
HGL_H00000280772    ....LHV..AAH...........CG.......HY............................................
HGL_H00000407057    ....IHM..AAQ...........GD.......HL............................................
HGL_H00000306678    ....LHL..AVQ...........RG.......AF............................................
HGL_H00000282272    ....LHI..ACY...........NG.......QD............................................
HGL_H00000267116    ....LHM..AAI...........HG.......RF............................................
HGL_H00000256707    ....LIG..AVR...........GG.......HV............................................
HGL_H00000411147-2  ....LIL..AVE...........KK.......HV............................................
HGL_H00000351416    ....LWL..AAN...........GG.......HL............................................
HGL_H00000330161    ....LHL..AAR...........SG.......HL............................................
HGL_H00000253810    ....LWL..ASN...........GG.......HF............................................
HGL_H00000351416    ....LME..AAR...........EG.......HE............................................
HGL_H00000374171    ....LDL..AAF...........YG.......DA............................................
HGL_H00000373287    ....LHL..AAY...........HG.......HH............................................
HGL_H00000262457    ....LHW..SCN...........NG.......YL............................................
HGL_H00000263635    ....LDL..AAF...........YG.......DA............................................
HGL_H00000386135    ....LHV..ACK...........DG.......NV............................................
HGL_H00000373287    ....LMM..AAE...........NG.......QT............................................
HGL_H00000267116    ....LHR..GAV...........TG.......CE............................................
HGL_H00000349588    ....LHI..ACK...........KN.......RI............................................
HGL_H00000417980-1  ....LHI..AAR...........EN.......RY............................................
HGL_H00000216797    ....LHL..AVD...........LQ.......NP............................................
HGL_H00000369579    ....LHL..AAE...........HA.......RQ............................................
HGL_H00000373287    ....LHA..AAS...........SG.......MI............................................
HGL_H00000345767    ....LHV..AAA...........LN.......HK............................................
HGL_H00000311579    ....LHE..AAA...........KG.......KY............................................
HGL_H00000360689    ....LHE..AAA...........KG.......KY............................................
HGL_H00000350297    ....LHY..CSV...........YS.......KP............................................
HGL_H00000267116    ....LMT..AAE...........NG.......QT............................................
HGL_H00000360689    ....LHE..AAS...........KN.......RV............................................
HGL_H00000311579    ....LHE..AAS...........KN.......RV............................................
HGL_H00000345065    ....LHV..AAD...........LG.......NV............................................
HGL_H00000282272    ....LMM..AAE...........NG.......QA............................................
HGL_H00000281419    ....LHY..CCL...........TD.......NA............................................
HGL_H00000348081    ....LHL..AVQ...........QG.......HV............................................
HGL_H00000388725-2  ....LML..ACE...........IG.......NL............................................
HGL_H00000389168    ....LHA..AAH...........WG.......KE............................................
HGL_H00000402044    ....LYE..ACK...........N-.......--............................................
HGL_H00000281131    ....LIA..AAY...........MG.......HR............................................
HGL_H00000353518    ....LHE..AAL...........FG.......KT............................................
HGL_H00000217958-1  ....LHL..ACD...........EE.......RV............................................
HGL_H00000388725-1  ....LML..ACE...........IG.......NS............................................
HGL_H00000275015    ....LHL..AAG...........RG.......LG............................................
HGL_H00000299824-1  ....LHA..AAF...........WG.......QM............................................
HGL_H00000325355    ....LHE..AAL...........YG.......KT............................................
HGL_H00000369434    ....LHY..AAK...........EG.......HT............................................
HGL_H00000338769    ....LHY..AAL...........HG.......QS............................................
HGL_H00000403397    ....LHW..AVL...........AG.......NT............................................
HGL_H00000226574    ....LHI..AAG...........RG.......ST............................................
HGL_H00000349588    ....LHI..AAH...........YG.......NV............................................
HGL_H00000382545-2  ....LHA..AVL...........SG.......NI............................................
HGL_H00000328327-1  ....LHL..SAL...........RD.......DV............................................
HGL_H00000356240    ....LHA..AAH...........WG.......VK............................................
HGL_H00000301030    ....LHD..AAN...........NG.......HY............................................
HGL_H00000391126-2  ....LHA..AAY...........WG.......QV............................................
HGL_H00000351416    ....LSL..ACA...........GG.......HL............................................
HGL_H00000417980-2  ....LHI..AAR...........ES.......YH............................................
HGL_H00000333142    ....LHL..AML...........KD.......NV............................................
HGL_H00000411147-1  ....LHL..ATE...........HN.......QR............................................
HGL_H00000160373    ....AHI..AAS...........KG.......FK............................................
HGL_H00000350331-2  ....LHH..AAK...........VK.......NV............................................
HGL_H00000345436    ....LHE..AAL...........CG.......KT............................................
HGL_H00000343362    ....LHL..AAQ...........QD.......LP............................................
HGL_H00000378210    ....IHA..AAQ...........MG.......HT............................................
HGL_H00000304292-1  ....LHE..AAL...........FG.......KV............................................
HGL_H00000314556    ....LML..GCE...........YG.......CR............................................
HGL_H00000263388    ....LFL..AAR...........EG.......SY............................................
HGL_H00000260047    ....MHK..AAE...........QG.......HI............................................
HGL_H00000342295    ....LHW..AAA...........AG.......KA............................................
HGL_H00000261537    ....LHL..AVE...........RQ.......HTqivrlimglgtqgaekksaa........................
HGL_H00000277541-1  ....LFL..AAR...........EG.......SY............................................
HGL_H00000307298-2  ....LHI..IVQ...........YN.......RPisdfltlh....................................
HGL_H00000386502    ....LHH..AAF...........SG.......HG............................................
HGL_H00000347802    ....LIL..ACE...........KG.......SA............................................
HGL_H00000296525    ....LHA..AAQ...........QS.......ST............................................
HGL_H00000274457-1  ....LLS..ASV...........TG.......HT............................................
HGL_H00000262457    ....LHF..AVA...........DG.......NV............................................
HGL_H00000256646    ....LFL..AAR...........EG.......SY............................................
HGL_H00000400113    ....LHW..AIT...........SG.......NV............................................
HGL_H00000277541-2  ....LFL..AAR...........EG.......AV............................................
HGL_H00000274457-2  ....LHI..AAL...........NN.......HP............................................
HGL_H00000262970    ....LML..ACE...........GA.......SP............................................
HGL_H00000401369    ....LHC..ALQ...........GPaaalaqtPE............................................
HGL_H00000358983    ....LHL..AAG...........LG.......SP............................................
HGL_H00000304586    ....LME..AAA...........AG.......HE............................................
HGL_H00000304292-2  ....LHE..AVI...........EK.......HI............................................
HGL_H00000360826    ....LHL..AAK...........EG.......HL............................................
HGL_H00000360762-1  ....LHD..AVR...........LN.......RY............................................
HGL_H00000275699    ....LYF..AVS...........NN.......DI............................................
HGL_H00000325663    ....LHV..AAS...........LQyrvt...QL............................................
HGL_H00000339115    ....LHD..AAE...........NG.......HLeyfpifssspttlpgfgptlcgrgktllvlhmchllllqlsgap
HGL_H00000364158    ....LMQ..ATY...........HG.......NK............................................
HGL_H00000417914    ....LHA..AAS...........QS.......SA............................................
HGL_H00000306163    ....LHD..AVR...........LN.......RY............................................
HGL_H00000337056    ....IHL..AVR...........EG.......HA............................................
HGL_H00000369855    ....LHA..VAR...........LS.......NG............................................
HGL_H00000282272    ....LHY..AAA...........SD.......--............................................
HGL_H00000370259-3  ....LHW..ATE...........HN.......HQ............................................
HGL_H00000375690    ....LHI..CAL...........YN.......KE............................................
HGL_H00000164227    ....LIH..AVA...........NN.......SL............................................
HGL_H00000263433    ....LHA..AAH...........WG.......VE............................................
HGL_H00000391126-1  ....LHL..AAK...........YG.......QT............................................
HGL_H00000357681    ....LMV..AVL...........NN.......HE............................................
HGL_H00000360762-2  ....LQD..AVR...........LN.......RC............................................
HGL_H00000357914-1  ....LHW..ATE...........HH.......HR............................................
HGL_H00000284629-1  ....LTW..AAR...........QG.......HK............................................
HGL_H00000320893    ....LSW..AAM...........KG.......NL............................................
HGL_H00000217958-2  ....L--..---...........--.......--............................................
HGL_H00000284629-2  ....LTW..AAH...........QG.......HK............................................
HGL_H00000269856    ....---..---...........--.......--............................................
HGL_H00000345193-1  ....LHI..CAL...........YN.......QE............................................
HGL_H00000304292-2  ....LHI..AAR...........WG.......YQ............................................
HGL_H00000276925-1  ....AHX..-XR...........EG.......FI............................................
HGL_H00000343362    ....LQR..AAG...........AG.......NE............................................
HGL_H00000262209    ....LVL..ATA...........SA.......SW............................................
HGL_H00000217958-3  ....FHS..ACT...........YGk......SI............................................
HGL_H00000343362    ....LQL..AIR...........NQ.......LP............................................
HGL_H00000276925-2  ....VHD..AAR...........AG.......FL............................................
HGL_H00000320291    ....LHC..AAY...........RA.......HK............................................
HGL_H00000262209    ....LHF..AAR...........EG.......HA............................................
HGL_H00000321679    ....LHE..AVC...........QS.......HY............................................
HGL_H00000371734-2  ....LMC..ASE...........HG.......HV............................................
HGL_H00000360689    ....LHE..AAQ...........KG.......RT............................................
HGL_H00000382545-1  ....LLK..AAK...........--.......--............................................
HGL_H00000311579    ....LHE..AAQ...........KG.......RT............................................
HGL_H00000392839    ....LSR..AIE...........SC.......RM............................................
HGL_H00000252985    ....LHM..AAA...........LPpgpl...QE............................................
HGL_H00000392839    ....LHY..AAM...........GG.......FT............................................
HGL_H00000217958-5  ....---..---...........--.......--............................................
HGL_H00000303518-2  ....LHL..AAG...........NRd......SK............................................
HGL_H00000357914-2  ....LHW..ATE...........PQ.......HR............................................
HGL_H00000296785-1  ....LLY..AVH...........GN.......HV............................................
HGL_H00000405112-2  ....---..---...........--.......--............................................
HGL_H00000349612    ....---..---...........--.......--............................................
HGL_H00000260947    ....LHD..AAR...........NG.......HL............................................
HGL_H00000403487    ....LHY..ACF...........WG.......QD............................................
HGL_H00000415252    ....LMC..ACE...........HG.......HK............................................
HGL_H00000398321    ....LHK..AAE...........RG.......HG............................................
HGL_H00000305071    ....LLY..AVR...........GN.......HV............................................
HGL_H00000379435    ....LEI..CLH...........HNc......EP............................................
HGL_H00000262126    ....LHD..SAS...........SG.......HR............................................
HGL_H00000264607    ....VMD..AVL...........RHgc.....EA............................................
HGL_H00000303518-1  ....LHL..AAG...........NRd......SK............................................
HGL_H00000331873    ....---..---...........--.......--............................................
HGL_H00000274361    ....LHK..AVA...........SN.......HL............................................
HGL_H00000282272    ....LHA..SVI...........NG.......HT............................................
HGL_H00000414663-2  ....LMK..ACK...........RG.......NS............................................
HGL_H00000352358    ....LHI..LIL...........QP.......NKtfac........................................
HGL_H00000296785-2  ....LLY..AVH...........GN.......HV............................................
HGL_H00000215941-2  ....LHL..AAC...........TN.......HV............................................
HGL_H00000352814    ....LMC..ASE...........YG.......RL............................................
HGL_H00000386239    ....LHD..ALN...........CG.......HF............................................
HGL_H00000320076    ....LDM..AAM...........KG.......HM............................................
HGL_H00000328327-3  ....LHV..ACQ...........NG.......HK............................................
HGL_H00000360998    ....LHY..ACK...........MK.......NQ............................................
HGL_H00000351881    ....LVL..AKR...........RGv......NK............................................
HGL_H00000265310    ....LHI..LIL...........QP.......NKtfac........................................
HGL_H00000294053    ....LDY..AREgevmkllrtseAK.......SL............................................
HGL_H00000274361    ....LHD..AVV...........NG.......HH............................................
HGL_H00000340836-1  ....LHA..AAW...........KG.......YA............................................
HGL_H00000217958-4  ....LHY..AAS...........KN.......RQ............................................
HGL_H00000353796    ....---..---...........--.......--............................................
HGL_H00000349140-1  ....LLS..AVY...........EG.......HV............................................
HGL_H00000299234    ....LRV..AEA...........AG.......NL............................................
HGL_H00000328327-2  ....LHV..ACQ...........NG.......LK............................................
HGL_H00000303570    ....LMF..AAL...........SG.......NK............................................
HGL_H00000267339    ....IHK..AAR...........SG.......SL............................................
HGL_H00000369579    ....---..---...........--.......--............................................
HGL_H00000368848    ....VHV..ASQ...........HG.......YL............................................
HGL_H00000401089    ....LIH..ACI...........RRa......GG............................................
HGL_H00000350331-1  ....LHE..AC-...........--.......--............................................
HGL_H00000265140    ....---..---...........--.......--............................................
HGL_H00000414663-1  ....LMK..ACK...........RG.......NS............................................
HGL_H00000375751    ....LHC..AAS...........CN.......NV............................................
HGL_H00000355827-2  ....---..---...........--.......--............................................
HGL_H00000314103    ....LMH..ACA...........GGg......GA............................................
HGL_H00000280758-2  ....FSQ..AAA...........HG.......HR............................................
HGL_H00000331065    ....LHI..ACS...........DG.......YP............................................
HGL_H00000378013    ....LHF..AAG...........GG.......HA............................................
HGL_H00000261312    ....LHY..AAC...........FG.......RP............................................
HGL_H00000202556    ....LHC..AAS...........CN.......SV............................................
HGL_H00000298992    ....---..---...........--.......--............................................
HGL_H00000307541    qlvpVHD..AVV...........ND.......NL............................................
HGL_H00000349140-2  ....---..---...........--.......--............................................
HGL_H00000371734-1  ....LMC..DSE...........HG.......HA............................................
HGL_H00000370259-2  ....LHR..ASQ...........HN.......DQ............................................
HGL_H00000324287    ....LHH..ATV...........LG.......HT............................................
HGL_H00000346733    ....LHH..ATL...........LG.......RT............................................
HGL_H00000403902    ....LHC..AAS...........CN.......DT............................................
HGL_H00000253810    ....LIE..AAK...........GG.......HT............................................
HGL_H00000384801    ....LHM..AAT...........DG.......HV............................................
HGL_R00000013095    ....AHF..AAE...........SG.......HL............................................
HGL_H00000277458    ....---..---...........--.......--............................................
HGL_H00000335147    ....LHK..AAK...........VG.......SL............................................
HGL_H00000158762    ....LHH..ATI...........LG.......HT............................................
HGL_H00000303518-3  ....---..---...........--.......--............................................
HGL_H00000299824-2  ....LHT..AAF...........WG.......QM............................................
HGL_H00000356685    ....LHC..AAA...........WG.......RL............................................
HGL_H00000240361    ....VHA..AAF...........SG.......SQ............................................
HGL_H00000265742    ....LHY..AAA...........SG.......MK............................................
HGL_H00000320340    ....LHQ..AAA...........LG.......QR............................................
HGL_H00000308772    ....LDA..AAS...........RE.......QG............................................
HGL_H00000349041    ....---..---...........--.......--............................................
HGL_H00000378338    ....LHV..AAK...........AG.......QT............................................
HGL_H00000367705    ....LHD..AVE...........ND.......HL............................................
HGL_H00000396078    ....LHK..AAC...........QR.......NR............................................
HGL_H00000419199    ....LHFpsALQ...........YTlk.....DE............................................
HGL_H00000385887    ....LSL..SIA...........SG.......ND............................................
HGL_H00000396747    ....LHV..ASA...........MG.......RL............................................
HGL_M00000098100    ....LYR..AAF...........GG.......HL............................................
HGL_H00000365830    ....LHL..AAM...........HG.......HV............................................
HGL_H00000407057    ....---..---...........--.......--............................................
HGL_H00000350331-3  ....---..---...........--.......--............................................
HGL_H00000368859    ....LHI..AAY...........NL.......CA............................................
HGL_H00000347464    ....LHV..ASK...........AG.......QI............................................
HGL_H00000274457-1  ....LHI..AAL...........NN.......HP............................................
HGL_H00000230792    ....LMY..AAR...........NG.......HS............................................
HGL_H00000310447    ....LHV..AAA...........EG.......HV............................................
HGL_H00000353732    ....LHI..AAS...........NL.......CL............................................
HGL_H00000305721    ....LHR..SIF...........YG.......HI............................................
HGL_H00000359982    ....LHL..AVM...........LG.......NK............................................
HGL_H00000382659    ....---..---...........--.......--............................................
HGL_H00000269856    ....LHI..AAQ...........NN.......CP............................................
HGL_H00000317379    ....LHV..AAA...........EG.......HV............................................
HGL_H00000261740    ....---..---...........--.......--............................................
HGL_H00000386897    ....LAY..ARQ...........AS.......SQ............................................
HGL_H00000340913-2  ....---..---...........--.......--............................................
HGL_H00000378328    ....LQE..AVS...........TR.......DL............................................
HGL_H00000386532    ....---..---...........--.......--............................................
HGL_H00000261739    ....---..---...........--.......--............................................
HGL_H00000215941-1  ....LHL..VAC...........TN.......HF............................................
HGL_H00000334879    ....LHL..AAI...........HG.......HQ............................................
HGL_H00000380413    ....LAY..ARR...........AG.......SQ............................................
HGL_H00000368966    ....---..---...........--.......--............................................
HGL_H00000328160    ....LFY..ARQ...........AG.......SQ............................................
HGL_H00000262839    ....---..---...........--.......--............................................
HGL_H00000343362    ....---..---...........--.......--............................................
HGL_H00000369003    ....---..---...........--.......--............................................
HGL_H00000232744    ....LYY..ACL...........CG.......HE............................................
HGL_H00000419313    ....---..---...........--.......--............................................
HGL_H00000161863    ....LDW..AKH...........FG.......QT............................................
HGL_H00000402616-1  ....---..---...........--.......--............................................
HGL_M00000035452    ....LHA..AAR...........QGpda....YT............................................
HGL_H00000416826    ....---..---...........--.......--............................................
HGL_H00000373600    ....LYA..AIK...........AG.......NE............................................
HGL_H00000321813    ....LSV..AHS...........RG.......HV............................................
HGL_M00000056646    ....LMC..AAR...........AG.......QG............................................
HGL_H00000385887    ....LAA..AAV...........HC.......HN............................................
HGL_H00000387907    ....LTI..AFK...........HK.......HK............................................
HGL_H00000416826    ....LHV..VAA...........HSpgyhikrQT............................................