SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

TPR-like alignments in Drosophila melanogaster 69_5

These alignments are sequences aligned to the 0050358 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1w3ba_        gpmela...............................................................................
FBpp0112455  aqqvvelrpydieswsvmireaqtrpihevrsl....................................................
FBpp0070351  daykeyefaegnpmsdvenp.................................................................
FBpp0070402  ednlrknrmvvshwikyaqwee...............................................................
FBpp0080138  lyrslytaskqlddakrnvqsvgqlfqheieekrsllvqlckqiifkdyqsvgkkvrevmwrrgyyefiafvkknwhkqcqdaat
FBpp0074609  qkalqlmaeaekkltqqkgflgslfggsnkve.....................................................
FBpp0084171  nivhlydqlmvlnqrnlilinwknfcyihdqlqdafkqllleqlkfvcehkvdvffwkllfynvrnylkrqqtdqahthtlllie
FBpp0085420  gei..................................................................................
FBpp0085420  lel..................................................................................
FBpp0077790  farkeke..............................................................................
FBpp0082545  eq...................................................................................
FBpp0084691  vtarwsfeegikrpyfhvkpleraqlknwkdyldfe.................................................
FBpp0072096  aeaedlvkqaekslklsmlkwvpdydsaa........................................................
FBpp0071560  pqakpgvs.............................................................................
FBpp0077790  ekaeeeke.............................................................................
FBpp0076600  pvtwcvs..............................................................................
FBpp0271716  medllnevvpqedlerfekkyhheleldgevttdtkfeyafclvrsry.....................................
FBpp0077790  kvnel................................................................................
FBpp0290896  eeql.................................................................................
FBpp0081673  eeaealigqtdsaaneyakagmyfkaatayriaksfdkrk.............................................
FBpp0077614  es...................................................................................
FBpp0084691  ravkedstdf...........................................................................
FBpp0296980  qsna.................................................................................
FBpp0080535  la...................................................................................
FBpp0296980  gdrtgmg..............................................................................
FBpp0072164  qykkan...............................................................................
FBpp0084016  tisfretqelrnmwsallnmelvysnnfddvlkealncndp............................................
FBpp0296980  ckdtqaaa.............................................................................
FBpp0296980  dra..................................................................................
FBpp0080894  petccvi..............................................................................
FBpp0081606  a....................................................................................
FBpp0084559  ravefyqenlklmrdlgdrgaqgr.............................................................
FBpp0075683  en...................................................................................
FBpp0081284  evsd.................................................................................
FBpp0079468  rlaeakvykek..........................................................................
FBpp0087297  q....................................................................................
FBpp0074835  klwmmk...............................................................................
FBpp0079893  gtfhllcgsyvesqqdfdaiiandyadpnlr......................................................
FBpp0082765  ltankekadkl..........................................................................
FBpp0079617  qlk..................................................................................
FBpp0084440  qfaerhrl.............................................................................
FBpp0080424  iaeekk...............................................................................
FBpp0085344  e....................................................................................
FBpp0081552  a....................................................................................
FBpp0087646  dckt.................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  kateeeveqaselraqaas..................................................................
FBpp0070575  kateeeveqaselraqaas..................................................................
FBpp0074835  rdqwfqeaieaeksgavnccqsivkavigigveeedr................................................
FBpp0080424  mken.................................................................................
FBpp0076113  q....................................................................................
FBpp0072561  y....................................................................................
FBpp0072561  dqshllgra............................................................................
FBpp0085923  .....................................................................................
FBpp0079893  eannykte.............................................................................
FBpp0075683  lrt..................................................................................
FBpp0077614  ei...................................................................................
FBpp0086749  rslkvwsmyadlee.......................................................................
FBpp0073411  dekmlatstlre.........................................................................
FBpp0070908  mmal.................................................................................
FBpp0085842  trkker...............................................................................
FBpp0077718  fqf..................................................................................
FBpp0296980  fral.................................................................................
FBpp0076600  esdeti...............................................................................
FBpp0086749  ehfvskhgksnhqlwnelcdlisknphkvhslnvdaiirgglrrytdqlgh..................................
FBpp0085479  lalnyke..............................................................................
FBpp0112016  ialgl................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  aelqrs...............................................................................
FBpp0111406  rvaqnf...............................................................................
FBpp0074918  ayw..................................................................................
FBpp0082818  pgslrvmkfkamry.......................................................................
FBpp0074480  elkqyknglklakqilsnpkyme..............................................................
FBpp0082819  ldtarfdiatkctkqlalef.................................................................
FBpp0085279  laealskakeafsldrtlhqfrdqhgen.........................................................
FBpp0081805  afrsvad..............................................................................
FBpp0100023  wsadec...............................................................................
FBpp0071879  slq..................................................................................
FBpp0084559  gtedlrtls............................................................................
FBpp0075591  srele................................................................................
FBpp0076526  ekarsdgnrdqvavsc.....................................................................
FBpp0079851  lhin.................................................................................
FBpp0072146  l....................................................................................
FBpp0296980  qar..................................................................................
FBpp0083238  ev...................................................................................
FBpp0111383  eqredva..............................................................................
FBpp0071560  qaalailllthalkthqrnldwrteyslfmsgvh...................................................
FBpp0080424  yd...................................................................................
FBpp0071879  pknil................................................................................
FBpp0292775  mdaalavyhkaedwfsqvkilcylgkiskadaiarqsg...............................................
FBpp0077934  lrdlv................................................................................
FBpp0087646  n....................................................................................
FBpp0079665  de...................................................................................
FBpp0086749  ye...................................................................................
FBpp0082652  adsfr................................................................................
FBpp0077619  ngnve................................................................................
FBpp0086164  ltadrv...............................................................................
FBpp0087232  aaeiker..............................................................................
FBpp0072561  .....................................................................................
FBpp0088148  eavrtwrsalkgtcqredcfqllgyly..........................................................
FBpp0075787  lle..................................................................................
FBpp0083319  nkfgnn...............................................................................
FBpp0076499  sek..................................................................................
FBpp0290580  l....................................................................................
FBpp0080720  w....................................................................................
FBpp0086164  lmgeanls.............................................................................
FBpp0080741  davamarratvliaeigrdknmeifcdtfl.......................................................
FBpp0087297  fvqgli...............................................................................
FBpp0070720  hvwlkylkarlvvtqtdeerkafeeqcakalgyyysiplseyvvnylvdqgnvqnhvlwaklladydverpdfgdklrslistit
FBpp0086683  kahtlfqagklwmrrmryhdaqrafekaitrlktcktssfeqqcrkkdmlialfeslmicfnkmrqsrcvcyvmkel........
FBpp0289328  nllnqvdqlgekfealrmylssvgyelhrslnekvqy................................................
FBpp0070667  d....................................................................................
FBpp0082624  qqlslas..............................................................................
FBpp0081552  reekhfaeciaageavlrnepeetmiryeghkvlctcytg.............................................
FBpp0086749  rtr..................................................................................
FBpp0087646  ainwyvqneetdatpas....................................................................
FBpp0071879  va...................................................................................
FBpp0080894  ygvvlk...............................................................................
FBpp0070906  ystgdfscaqdhvdkavnimqhlvpsnhlmlasakrvkallleeialdkmadgideedlllqseelhnfalllslqvfge.....
FBpp0087646  i....................................................................................
FBpp0082112  eyaalkaqqyyimkdfqmaakqlmrinnectqagtitpqlstc..........................................
FBpp0293629  fl...................................................................................
FBpp0076526  ltssvdyaklkg.........................................................................
FBpp0085279  elnk.................................................................................
FBpp0074835  lenpddarillsraveccnt.................................................................
FBpp0078887  yteaeqtnikealgalrmaq.................................................................
FBpp0290580  tad..................................................................................
FBpp0085047  qynsslkpidclaiglhlmnnsrwyaaeqwisasie.................................................
FBpp0296980  vgq..................................................................................
FBpp0086380  hpstileythlslysfanghvgmslkllyrarylmvlicgedhp.........................................
FBpp0083435  gingqaveelfiqiq......................................................................
FBpp0078891  w....................................................................................
FBpp0082419  asglptsassedlsqslseytdadesvsapteflaeflsav............................................
FBpp0086749  eeeilrnaysvkhwlryidhkakapnngvnm......................................................
FBpp0078027  ieqg.................................................................................
FBpp0088148  hr...................................................................................
FBpp0290863  m....................................................................................
FBpp0080720  qreqydkaeqmlhlalrmaqdiqskdgityvfdlmanlamereqfkkaekiftdvmkrlf.........................
FBpp0083319  v....................................................................................
FBpp0071288  qrmiiddmqekfprepglwdllaqrelrgfhlgdleeedldtsdeepaskksrsvngrslkrriqlcvtvyksaveelqttemwn
FBpp0081398  elfsqgsrnflvksydeaadelsqvcqlyeevygeladelgqplllyakaliamaldenkvidvpdeaaddddedvdddeeesae
FBpp0085016  rwrecy...............................................................................
FBpp0293235  var..................................................................................
FBpp0290580  l....................................................................................
FBpp0085012  syvnhdyyhtvlwmneamarmleeptnhtq.......................................................
FBpp0086380  tdaynfytt............................................................................
FBpp0071879  n....................................................................................
FBpp0076961  pteq.................................................................................
FBpp0075717  lqqalmaanlavmrapdrnadpvldegltl.......................................................
FBpp0080267  agndsy...............................................................................
FBpp0070908  nyk..................................................................................
FBpp0085033  lsvgaylfmknrpsdaiqwlqe...............................................................
FBpp0082507  qclqalftfmppsk.......................................................................
FBpp0292775  iw...................................................................................
FBpp0085676  sdevlh...............................................................................
FBpp0087091  vefrmlgn.............................................................................
FBpp0082624  smasafflyeqfeevlvymnsirsyf...........................................................
FBpp0070431  lnvwyvktldaafe.......................................................................
FBpp0075442  qahdmvrrrswaravalydqliapspgqgsggqsagsraqkdq..........................................
FBpp0070906  iidvlrqaakacvvkrdfaranllicqavrrareyfgpthq............................................
FBpp0089265  lrvr.................................................................................
FBpp0078634  ainelsivlaskeeynkgleilleaekiyedfka...................................................
FBpp0075754  yfslvgllrvhsllgdyyqaikvlepieihkksayshipa.............................................
FBpp0087625  sknlreegnlmfkesasgsskdsvlk...........................................................
FBpp0071288  rl...................................................................................
FBpp0110159  lamgrhlmnqsrwtiaeqwilagikaqdrkgpqtemill..............................................
FBpp0072679  qraeisafygefeeaeklyldadrrdlaielrmtlcdwfrvvqlyrmggsgvsdqqmeiawr.......................
FBpp0082624  wi...................................................................................
FBpp0084254  mamsmyevarvamhkenfdeallilleadelfsqcdskllegvdnyalinldivwcylrlknitqlpdaqrrldicergfvksyg
FBpp0085032  t....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  aqenmqklerflcagifnykrlsarmeeiydldlkylidfsiisdgyisdmigdtmesshsgthavdksleavsfaldtihssll
FBpp0074609  .....................................................................................
FBpp0084171  qaikfyrmlydklmakcvassrcdsalkvvaqrlliclgdltryrvn......................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  deneaaafvemlqkhcvtwtcnveqrqmiksvvdkfkqhldettrgwdwseqhkahvydvetlsldddlknavirfifersvakf
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  myldamlalnsdgkterilkqqcladalqaghrsqlmgvkhyatlrkmlctapsgreaavtiltealkndssvemhelllathiq
FBpp0081398  dgaakkeekkdtkeaangasssngkeldtikegsdeadstgeaeqaqsdekpskkvptgvdevsssnggggaavndderpstsng
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  eqfirlfsikgpssperalim................................................................
FBpp0085032  .....................................................................................


                                                                                10        20        
                                                                                 |         |        
d1w3ba_        .........................................................------HREYQAGDFEAAERHCMQLWRQ
FBpp0112455  .........................................................----------------------------
FBpp0070351  .........................................................--FEKGKEYLSKGDIPSAVLCFEVAAKK
FBpp0070402  .........................................................----------------------------
FBpp0080138  .................................slgdlhryfldfridsklsiskeq----------------------------
FBpp0074609  .........................................................----------------------------
FBpp0084171  .........................................................----------------------------
FBpp0085420  .........................................................---------------WLAIHHFEKAVTL
FBpp0085420  .........................................................----------------------------
FBpp0077790  .........................................................----------------------------
FBpp0082545  .........................................................----------------------------
FBpp0084691  .........................................................---------IEKGDRERVLVLFERCLIA
FBpp0072096  .........................................................----------------------------
FBpp0071560  .........................................................-----------------------YHARI
FBpp0077790  .........................................................----------------------------
FBpp0076600  .........................................................----------------------------
FBpp0271716  .........................................................----------------------------
FBpp0077790  .........................................................----------------------------
FBpp0290896  .........................................................---------------------FRSAISI
FBpp0081673  .........................................................----------------------------
FBpp0077614  .........................................................----------------------------
FBpp0084691  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0080535  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0072164  .........................................................----------------------------
FBpp0084016  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0080894  .........................................................----------------------------
FBpp0081606  .........................................................----------------------------
FBpp0084559  .........................................................----------------------------
FBpp0075683  .........................................................----------------------------
FBpp0081284  .........................................................----------------------------
FBpp0079468  .........................................................----------------------------
FBpp0087297  .........................................................----------------------------
FBpp0074835  .........................................................----------------------------
FBpp0079893  .........................................................----------------------------
FBpp0082765  .........................................................----------------------------
FBpp0079617  .........................................................----------------------------
FBpp0084440  .........................................................----------------------------
FBpp0080424  .........................................................----------------------------
FBpp0085344  .........................................................--------------------SFEKALKF
FBpp0081552  .........................................................----------------------------
FBpp0087646  .........................................................----------------------------
FBpp0083769  .........................................................----------------------------
FBpp0070572  .........................................................----------------------------
FBpp0070575  .........................................................----------------------------
FBpp0074835  .........................................................----------------------------
FBpp0080424  .........................................................----------------------------
FBpp0076113  .........................................................----------------------------
FBpp0072561  .........................................................----------------------------
FBpp0072561  .........................................................----------------------------
FBpp0085923  .........................................................----------------------------
FBpp0079893  .........................................................----------------------------
FBpp0075683  .........................................................----------------------------
FBpp0077614  .........................................................----------------------------
FBpp0086749  .........................................................----------------------------
FBpp0073411  .........................................................----------------------------
FBpp0070908  .........................................................-----GKCLYYNGDYFQAEDIFSSTLCA
FBpp0085842  .........................................................----------------------------
FBpp0077718  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0076600  .........................................................----------------------------
FBpp0086749  .........................................................----------------------------
FBpp0085479  .........................................................----------------------------
FBpp0112016  .........................................................----------------------------
FBpp0079665  .........................................................----------------------------
FBpp0084076  .........................................................----------------------------
FBpp0111406  .........................................................----------------------------
FBpp0074918  .........................................................----------------------------
FBpp0082818  .........................................................----------------------------
FBpp0074480  .........................................................----------------------------
FBpp0082819  .........................................................----------------------------
FBpp0085279  .........................................................----------------------------
FBpp0081805  .........................................................----------------------------
FBpp0100023  .........................................................----------------------------
FBpp0071879  .........................................................----------------------------
FBpp0084559  .........................................................----------------------------
FBpp0075591  .........................................................----------------------------
FBpp0076526  .........................................................----------------------------
FBpp0079851  .........................................................----------------------------
FBpp0072146  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0083238  .........................................................----------------------------
FBpp0111383  .........................................................----------------------------
FBpp0071560  .........................................................----------------------------
FBpp0080424  .........................................................-----------TKSYRNVVFYLDSALKL
FBpp0071879  .........................................................----------------------------
FBpp0292775  .........................................................----------------------------
FBpp0077934  .........................................................----------------------------
FBpp0087646  .........................................................----------------------------
FBpp0079665  .........................................................----------------------------
FBpp0086749  .........................................................----------------------------
FBpp0082652  .........................................................----------------------------
FBpp0077619  .........................................................----------------------------
FBpp0086164  .........................................................----------------------------
FBpp0087232  .........................................................----------------------------
FBpp0072561  .........................................................----------------------------
FBpp0088148  .........................................................----------------------------
FBpp0075787  .........................................................----------------------------
FBpp0083319  .........................................................----------------------------
FBpp0076499  .........................................................----------------------------
FBpp0290580  .........................................................----------------------------
FBpp0080720  .........................................................----------------------------
FBpp0086164  .........................................................---------FVYGRYETAERICMEIIRQ
FBpp0080741  .........................................................----------------------------
FBpp0087297  .........................................................----------------------------
FBpp0070720  ...................pivdvlwlsyiefiqfegvtvpenedenevtaemvakr----------------------------
FBpp0086683  .........................................................----------------------------
FBpp0289328  .........................................................----------------------------
FBpp0070667  .........................................................----------------------------
FBpp0082624  .........................................................----------------------------
FBpp0081552  .........................................................-----------DEQFGKALQQCKEALDI
FBpp0086749  .........................................................----------------------------
FBpp0087646  .........................................................----------------------------
FBpp0071879  .........................................................----------------------------
FBpp0080894  .........................................................----------------------------
FBpp0070906  .........................................................----------------------------
FBpp0087646  .........................................................----------------------------
FBpp0082112  .........................................................----------------------------
FBpp0293629  .........................................................----------------------------
FBpp0076526  .........................................................----------------------------
FBpp0085279  .........................................................----------------------------
FBpp0074835  .........................................................----------------------------
FBpp0078887  .........................................................----------------------------
FBpp0290580  .........................................................----------------------------
FBpp0085047  .........................................................----------------------------
FBpp0296980  .........................................................----------------------------
FBpp0086380  .........................................................----------------------------
FBpp0083435  .........................................................----------------------------
FBpp0078891  .........................................................----------------------------
FBpp0082419  .........................................................----------------------------
FBpp0086749  .........................................................----------------------------
FBpp0078027  .........................................................----------------------------
FBpp0088148  .........................................................----------------------------
FBpp0290863  .........................................................----------------------------
FBpp0080720  .........................................................----------------------------
FBpp0083319  .........................................................----------------------------
FBpp0071288  sdsepliyelfnkiqksmgsealplwrsvilyyrtrqdslgarrldeiyglackaaw----------------------------
FBpp0081398  .................evtascsngaapaveeepeeeegvsgslqlaweileaaaq----------------------------
FBpp0085016  .........................................................----------------------------
FBpp0293235  .........................................................----------------------------
FBpp0290580  .........................................................----------------------------
FBpp0085012  .........................................................----------------------------
FBpp0086380  .........................................................----------------------------
FBpp0071879  .........................................................----------------------------
FBpp0076961  .........................................................----------------------------
FBpp0075717  .........................................................----------------------------
FBpp0080267  .........................................................----------------------------
FBpp0070908  .........................................................-----------ERNYRAALRHFDEII--
FBpp0085033  .........................................................----------------------------
FBpp0082507  .........................................................----------------------------
FBpp0292775  .........................................................----------------------------
FBpp0085676  .........................................................----------------------------
FBpp0087091  .........................................................----------------------------
FBpp0082624  .........................................................----------------------------
FBpp0070431  .........................................................----------------------------
FBpp0075442  .........................................................----------------------------
FBpp0070906  .........................................................----------------------------
FBpp0089265  .........................................................----------------------------
FBpp0078634  .........................................................----------------------------
FBpp0075754  .........................................................----------------------------
FBpp0087625  .........................................................----------------------------
FBpp0071288  .........................................................----------------------------
FBpp0110159  .........................................................----------------------------
FBpp0072679  .........................................................----------------------------
FBpp0082624  .........................................................----------------------------
FBpp0084254  .........................................................----------------------------
FBpp0085032  .........................................................----------------------------


               30        40          50                  60                                         
                |         |           |                   |                                         
d1w3ba_        EPDNTGVLLLLSSIHFQCR..RLDRSAHFSTL..........AIKQNP...........................LL......AE
FBpp0112455  -------------------..-----------..........------...........................--......--
FBpp0070351  QPERAEVWQLLGTSQTENE..MDPQAIAALKR..........AYDLQP...........................DN......QQ
FBpp0070402  -------------------..-----------..........------...........................--......--
FBpp0080138  -------------------..-----------..........------...........................--......--
FBpp0074609  --DAIECYQRAGNMFKMSK..NWTKAGECFCE..........AATLHA...........................RAgsrhdaGT
FBpp0084171  -------------------..-----------..........------...........................--......--
FBpp0085420  DPNFLDAYINLGNVLKEAR..IFDRAVAAYLR..........ALNLSP...........................NN......AV
FBpp0085420  -------------------..-----------..........------...........................--......--
FBpp0077790  -------------------..-----------..........------...........................--......--
FBpp0082545  -------------------..-------LFKS..........ALQVCP...........................DN......AK
FBpp0084691  CALYDEFWLKMLRYLESLE..DQSGVVDLVRD..........V-----...........................--......--
FBpp0072096  -------------------..-----------..........------...........................--......--
FBpp0071560  APNHLNVFINLANLIAKNQt.RLEEADHLYRQ..........AISMRS...........................DY......VQ
FBpp0077790  -------------------..-----------..........------...........................--......--
FBpp0076600  -------------------..-----------..........------...........................--......--
FBpp0271716  -------------------..-----------..........------...........................--......--
FBpp0077790  -------------------..-----------..........------...........................--......--
FBpp0290896  NPP--KALGNLGSVLSAQG..RYEEAELTLRM..........TLGHRP...........................TM......AD
FBpp0081673  -----DCLLKAIDCYENNK..SWFHAAKSYEQ..........IILLAK...........................ETdklse.VE
FBpp0077614  -------------------..-----------..........------...........................--......--
FBpp0084691  -------------------..-----------..........------...........................--......--
FBpp0296980  -------------------..-----------..........------...........................--......--
FBpp0080535  -----ESIKNEGNRLMKEN..KYNEALLQYNR..........AIAFDP...........................KN......PI
FBpp0296980  -------------------..-----------..........------...........................--......--
FBpp0072164  -------------------..-----------..........------...........................--......--
FBpp0084016  ----LEIYISVVDILKKNK..RKDRLSSVLTT..........VLNKFK...........................TE......LR
FBpp0296980  -------------------..-----------..........------...........................--......--
FBpp0296980  -----RALGHLGDCYAALG..DYEEALKCHDR..........QLQL--...........................--......--
FBpp0080894  -------------------..-----------..........------...........................--......--
FBpp0081606  -----EQYKNQGNEMLKTK..EFSKAIDMYTK..........AIELHP...........................NS......AI
FBpp0084559  -------------------..-----------..........------...........................--......--
FBpp0075683  -------------------..-----------..........------...........................--......--
FBpp0081284  -------------------..-----------..........------...........................--......--
FBpp0079468  -------------------..-----------..........------...........................--......--
FBpp0087297  -------------------..-----------..........------...........................--......--
FBpp0074835  -------------------..-----------..........------...........................--......--
FBpp0079893  -------------------..-----------..........------...........................--......AY
FBpp0082765  --------KVEGNELFKND..DAEGAAKTYTE..........ALDICP...........................SAssker.AV
FBpp0079617  -------------------..-----------..........------...........................--......--
FBpp0084440  ----------RGNESFKAK..EYENAIEEYNC..........SIIYDP...........................ENa.....VH
FBpp0080424  ---------KLGNDQYKAQ..NYQNALKLYTD..........AISLCP...........................DS......AA
FBpp0085344  SFGEQHVWRQYGLSLMAAE..KHSHALRVLQE..........SMKLTP...........................SDp.....LP
FBpp0081552  -------------------..-----------..........------...........................--......--
FBpp0087646  ----FEAYLLCG-------..-----------..........------...........................--......--
FBpp0083769  -------------------..-----------..........------...........................--......--
FBpp0070572  --------------AYGQQ..KFDEAIALYTK..........AIELSP...........................GN......AL
FBpp0070575  --------------AYGQQ..KFDEAIALYTK..........AIELSP...........................GN......AL
FBpp0074835  -------------------..-----------..........------...........................--......--
FBpp0080424  -------------------..-----------..........------...........................--......--
FBpp0076113  -------------------..-----------..........------...........................--......--
FBpp0072561  -------------------..-----------..........------...........................--......--
FBpp0072561  -------------------..-----------..........------...........................--......--
FBpp0085923  -PTEIEVYKKEGNDFLENG..KLVDAIDAYSA..........ALAKYP...........................QG......EV
FBpp0079893  -------------------..-----------..........------...........................--......--
FBpp0075683  -------------------..-----------..........------...........................--......--
FBpp0077614  -------------------..-----------..........------...........................--......--
FBpp0086749  -------------------..-----------..........------...........................--......--
FBpp0073411  -------------------..-----------..........------...........................--......--
FBpp0070908  NPDNVEAIGLMAVLCGQEG..GCE--------..........------...........................--......--
FBpp0085842  -----------ANFFYKRS..EFTTAIHLYRR..........ALDFLDnrdgdpdsefdkedlelsnsdtqtlleDR......LI
FBpp0077718  -------------------..-----------..........------...........................--......--
FBpp0296980  -------------------..-----------..........------...........................--......--
FBpp0076600  -------------------..-----------..........------...........................--......--
FBpp0086749  -------------------..-----------..........------...........................--......--
FBpp0085479  -------------------..-----------..........------...........................--......--
FBpp0112016  ---------------KEIKnaNPENAIHFFCK..........ALELNS...........................TD......IN
FBpp0079665  -------------------..-----------..........------...........................--......--
FBpp0084076  ----------QGNEAFRSQ..KYEKAILHYDK..........AIIKVK...........................DS......AI
FBpp0111406  -------------------..-----------..........------...........................--......--
FBpp0074918  -------------------..-----------..........------...........................--......--
FBpp0082818  -------------------..-----------..........------...........................--......--
FBpp0074480  -------------------..-----------..........------...........................-H......GE
FBpp0082819  -------------------..-----------..........------...........................--......--
FBpp0085279  -------------------..-----------..........------...........................--......--
FBpp0081805  -------------------..-----------..........------...........................--......--
FBpp0100023  -------------------..-----------..........------...........................--......--
FBpp0071879  -------------------..-----------..........------...........................--......--
FBpp0084559  -------------------..-----------..........------...........................--......--
FBpp0075591  ---------LKAIALSESG..ELDGALELFQQ..........SLNLAQ...........................-R......AS
FBpp0076526  --------NQLGDFYNQQG..KYTDAVREYV-..........------...........................--......--
FBpp0079851  -------------------..-----------..........------...........................--......--
FBpp0072146  -------------------..-----------..........------...........................--......--
FBpp0296980  -------------------..-----------..........------...........................--......--
FBpp0083238  -------------------..-----------..........------...........................--......--
FBpp0111383  -----ETFRRMGNYEYRKL..NFSLAKDYYSK..........GIQYIK...........................DS......PV
FBpp0071560  -------------------..-----------..........------...........................--......--
FBpp0080424  APACLKYRLLKAECLAFLG..RCDEALDIAVS..........VMKLDT...........................TS......AD
FBpp0071879  -------------------..-----------..........------...........................--......--
FBpp0292775  ---DRAACYHLARHYENVG..KFQEAIMFFTR..........A-----...........................--......-Q
FBpp0077934  -------------------..-----------..........------...........................--......--
FBpp0087646  -------------------..-----------..........------...........................--......--
FBpp0079665  -------------------..-----------..........------...........................--......--
FBpp0086749  -------------------..-----------..........------...........................--......--
FBpp0082652  ---------RLGNEEYRRT..NYEKAVYFYSK..........AIQYVA...........................DS......PV
FBpp0077619  -------------------..-----------..........------...........................--......--
FBpp0086164  -------------------..-----------..........------...........................--......--
FBpp0087232  -----------ATSAFKAK..KWLEAMMLYTRs.........YVALPS...........................ENvaei..RV
FBpp0072561  -------------------..-----------..........------...........................--......--
FBpp0088148  -------------------..-----------..........------...........................--......--
FBpp0075787  -------------------..-----------..........------...........................--......--
FBpp0083319  -------------------..-----------..........------...........................--......--
FBpp0076499  -----------ASSCMHLN..LLDDALKFCNA..........SLEKSP...........................AN......FK
FBpp0290580  -------------------..-----------..........------...........................--......--
FBpp0080720  -------------------..-----------..........------...........................--......--
FBpp0086164  NPLASEPFYTLAEIYENRD..EV-KFLNFST-..........------...........................--......--
FBpp0080741  -------------------..-----------..........------...........................--......--
FBpp0087297  -------------------..-----------..........------...........................--......--
FBpp0070720  -------------------..-----------..........------...........................--......--
FBpp0086683  -------------------..-----------..........------...........................--......--
FBpp0289328  -------------------..-----------..........------...........................--......--
FBpp0070667  -------------------..-----------..........------...........................--......--
FBpp0082624  -------------------..-----------..........------...........................--......--
FBpp0081552  MK-DAQVYCDRADALLGTE..MYDDAIHSFQA..........ALDLEE...........................SN......TR
FBpp0086749  -------------------..-----------..........------...........................--......--
FBpp0087646  -------------------..-----------..........------...........................--......--
FBpp0071879  -------------------..-----------..........------...........................--......--
FBpp0080894  -------------------..-----------..........------...........................--......--
FBpp0070906  -------------------..-----------..........------...........................--......--
FBpp0087646  -------------------..-----------..........------...........................--......--
FBpp0082112  -------------------..-----------..........------...........................--......--
FBpp0293629  -------------------..-----------..........------...........................--......--
FBpp0076526  -------------------..-----------..........------...........................--......--
FBpp0085279  -------------------..-----------..........------...........................--......--
FBpp0074835  -------------------..-----------..........------...........................--......--
FBpp0078887  -------------------..-----------..........------...........................--......--
FBpp0290580  -------------------..-----------..........------...........................--......--
FBpp0085047  -------------------..-----------..........------...........................--......--
FBpp0296980  -------------------..-----------..........------...........................--......--
FBpp0086380  -------------------..-----------..........------...........................--......--
FBpp0083435  -------------------..-----------..........------...........................--......--
FBpp0078891  -------------------..-----------..........------...........................--......--
FBpp0082419  -------------------..-----------..........------...........................--......--
FBpp0086749  -------------------..-----------..........------...........................--......--
FBpp0078027  -------------------..-----------..........------...........................--......--
FBpp0088148  -------------------..-----------..........------...........................--......--
FBpp0290863  -------------------..-----------..........------...........................--......--
FBpp0080720  -------------------..-----------..........------...........................--......--
FBpp0083319  -------------------..-----------..........------...........................--......--
FBpp0071288  -------------------..-----------..........------...........................--......--
FBpp0081398  -------------------..-----------..........------...........................--......--
FBpp0085016  -------------------..-----------..........------...........................--......--
FBpp0293235  -------------------..-----------..........------...........................--......--
FBpp0290580  -------------------..--RDALKDYEQ..........ALELY-...........................--......LP
FBpp0085012  -------------------..-----------..........------...........................--......--
FBpp0086380  -------------------..-----------..........------...........................--......--
FBpp0071879  -------------------..-----------..........------...........................--......--
FBpp0076961  -------------------..-----------..........------...........................--......--
FBpp0075717  -------------------..-----------..........------...........................--......AL
FBpp0080267  -------------------..-----------..........------...........................--......--
FBpp0070908  -------------------..-----------..........------...........................--......--
FBpp0085033  -------------------..-----------..........------...........................--......--
FBpp0082507  -------------------..-----------..........------...........................--......--
FBpp0292775  -------------------..-----------..........------...........................--......--
FBpp0085676  -------------------..-----------..........------...........................--......--
FBpp0087091  -------------EQFSLKnrNYFQALELYNK..........SICYAE...........................PNsehl..SI
FBpp0082624  -------------------..-----------..........------...........................--......--
FBpp0070431  -------------------..-----------..........------...........................--......--
FBpp0075442  ---QIACLLGRCECLLELG..KFEGCLADAYK..........VLTLLS...........................EQ......TE
FBpp0070906  --KYGDALLDYGFFLLNVD..SVFQSVNIYKE..........ALAV--...........................--......--
FBpp0089265  -------------------..-----------..........------...........................--......--
FBpp0078634  -------------------..-----------..........------...........................--......--
FBpp0075754  -------------------..-----------..........------...........................--......--
FBpp0087625  -------------------..-----------..........------...........................--......--
FBpp0071288  -------------------..-----------..........------...........................--......--
FBpp0110159  -------------------..-----------..........------...........................--......--
FBpp0072679  -------------------..-----------..........------...........................--......--
FBpp0082624  -------------------..-----------..........------...........................--......--
FBpp0084254  -------------------..-----------..........------...........................--......--
FBpp0085032  --------YAMGQILFDQK..NYLAAASWIYQsvvlmeafsmAAPLEI...........................SK......NE


               70        80                   90                                                    
                |         |                    |                                                    
d1w3ba_        AYSNLGNVYKERG...QLQ...EAIEH.....YRHAL....R..L.K......................................
FBpp0112455  -------------...---...-----.....-----....-..-.-......................................
FBpp0070351  VLMALAACYTNEG...LQN...NAVRM.....LCNWL....T..V.H......................................
FBpp0070402  ----------QQQ...EIQ...RARSI.....WERAL....D..N.E......................................
FBpp0080138  -------------...---...-----.....-----....-..-.-......................................
FBpp0074609  CYVDASNCYKKVD...VES...AVNCL.....M----....-..-.-......................................
FBpp0084171  -------------...---...-----.....-----....-..-.-......................................
FBpp0085420  VHGNLACVYYEQG...LID...LAIDT.....YRRAI....E..L.Q......................................
FBpp0085420  -------------...---...-----.....-----....-..-.-......................................
FBpp0077790  -------------...---...-----.....-----....-..-.-......................................
FBpp0082545  VHYNIARLATDMG...NNT...KAFQH.....YHRAI....E..L.Y......................................
FBpp0084691  -YR----------...---...-----.....-RACR....I..H.H......................................
FBpp0072096  -------------...---...-----.....-----....-..-.-......................................
FBpp0071560  AYINRGDILMKLN...RTA...QAQEV.....YEQAL....L..Y.D......................................
FBpp0077790  -------------...---...-----.....-----....-..-.-......................................
FBpp0076600  -------------...---...-----.....-----....-..-.-......................................
FBpp0271716  -------------...---...-----.....-----....-..-.-......................................
FBpp0077790  -------------...---...-----.....-----....-..-.-......................................
FBpp0290896  AHFNLGVVHQKQL...NFS...SAIPC.....FRRAI....E..L.R......................................
FBpp0081673  DYANRACCLYQQH...GSP...EAAAAaldkaAKMTE....S..K.H......................................
FBpp0077614  -------------...---...-----.....-----....-..-.-......................................
FBpp0084691  -------------...---...-----.....-----....-..-.-......................................
FBpp0296980  -------------...---...-----.....-----....-..-.-......................................
FBpp0080535  FYCNRAAAHIRLG...ENE...RAVTD.....CKSAL....V..Y.N......................................
FBpp0296980  -------------...---...-----.....-----....-..-.-......................................
FBpp0072164  -------------...---...-----.....-----....-..-.-......................................
FBpp0084016  VWPVAAEAYFWLG...KSD...QVHNL.....LQRAL....R..A.L......................................
FBpp0296980  -------------...---...-----.....-----....-..-.-......................................
FBpp0296980  -------------...---...-----.....-ALGL....T..S.H......................................
FBpp0080894  -------------...---...-----.....-----....-..-.-......................................
FBpp0081606  YYANRSLAHLRQE...SFG...FALQD.....GVSAV....K..A.D......................................
FBpp0084559  -------------...---...-----.....-----....-..-.-......................................
FBpp0075683  -------------...---...-----.....-----....-..-.-......................................
FBpp0081284  -------------...---...-----.....-----....-..-.-......................................
FBpp0079468  -------------...---...-----.....-----....-..-.-......................................
FBpp0087297  -------------...QQD...EARTY.....FELAV....Q..S.G......................................
FBpp0074835  -----GQIEEQQR...RTD...DAAAT.....YTLGL....K..K.C......................................
FBpp0079893  AYIKRAALYIQLD...QRE...KGIAD.....FAEAE....R..L.N......................................
FBpp0082765  LYGNRAAAKIKLE...ANK...AAIDD.....CTKAI....E..L.W......................................
FBpp0079617  -------------...---...-----.....-----....-..-.-......................................
FBpp0084440  AYNNRAVAHLKLK...KYF...SAISD.....CQACL....Q..I.D......................................
FBpp0080424  YYGNRAACYMMLL...NYN...SALTD.....ARHAI....R..I.D......................................
FBpp0085344  CLLASRLCYESLE...TVK...QGLDY.....AQQAL....K..R.Evkglrpsrsqlfvgighqqlaiqsnlkserdachklal
FBpp0081552  -------------...---...-----.....-----....-..-.S......................................
FBpp0087646  ------KLHMALK...NYS...DALNY.....VLKAT....R..L.R......................................
FBpp0083769  -------CLVENG...DFN...RLFYV.....AHKLV....D..R.Y......................................
FBpp0070572  FHAKRGQAFLKLK...KPN...ACIRD.....CDVAL....E..L.N......................................
FBpp0070575  FHAKRGQAFLKLK...KPN...ACIRD.....CDVAL....E..L.N......................................
FBpp0074835  -------------...---...-----.....-----....-..-.-......................................
FBpp0080424  -------------...---...-----.....-----....-..-.-......................................
FBpp0076113  -------------...---...-----.....-----....-..-.-......................................
FBpp0072561  ---NLARLNEAMS...SYD...VADKL.....YKEIL....K..E.H......................................
FBpp0072561  -----YFCLLEGD...KMD...QADAQ.....FNFVL....N..Q.S......................................
FBpp0085923  LYLNRATALMRRGwfgDIY...AALRD.....CHEAL....R..L.D......................................
FBpp0079893  -------------...---...-----.....-----....-..-.-......................................
FBpp0075683  -------------...---...-----.....-----....-..-.-......................................
FBpp0077614  LYQRIGDVLGRLQ...QWD...EAERH.....HRAAL....E..L.Q......................................
FBpp0086749  -------------...---...-----.....-----....-..-.-......................................
FBpp0073411  -------------...---...-----.....-----....-..-.-......................................
FBpp0070908  ------------Q...DSA...DMDYL.....FAKVS....S..E.V......................................
FBpp0085842  VYNNLAMTQIKIA...AYD...AALQS.....VEHVL....R..C.Q......................................
FBpp0077718  -------LYYHEA...DVQ...KAHSL.....CQAVL....E..V.E......................................
FBpp0296980  -------------...---...-----.....-----....-..-.-......................................
FBpp0076600  -------------...---...-----.....-----....-..-.-......................................
FBpp0086749  -------------...---...-----.....-----....-..-.-......................................
FBpp0085479  -------------...---...-----.....-----....-..-.-......................................
FBpp0112016  ALISRSKCYLLLG...EAS...KALQD.....AETAL....G..E.D......................................
FBpp0079665  -------------...---...-----.....-----....-..-.-......................................
FBpp0084076  TYCNRALCYIKLQ...NYK...RALKD.....CQYVL....E..KlQ......................................
FBpp0111406  -------------...---...-----.....-----....-..-.-......................................
FBpp0074918  -------------...---...-----.....-----....-..-.-......................................
FBpp0082818  -------------...---...-----.....-----....-..-.-......................................
FBpp0074480  TLAMKGLTLNGLG...RRE...EAYKY.....VRLGL....R..N.D......................................
FBpp0082819  -------------...---...-----.....-----....-..-.-......................................
FBpp0085279  VYHNFDLTYAQYE...RSEmhiEALNT.....YSIMA....KnkM.F......................................
FBpp0081805  -------------...---...-----.....-----....-..-.-......................................
FBpp0100023  -------------...---...-----.....-----....-..-.-......................................
FBpp0071879  --YNRGLVLEELH...MFT...LAAEN.....YKSIT....K..E.Y......................................
FBpp0084559  -------------...---...-----.....-----....-..-.-......................................
FBpp0075591  VLNNRAQTLRLAK...RDE...EALDD.....LNKAL....E..L.A......................................
FBpp0076526  -------------...--Q...EAQIY.....ASMGK....E..L.E......................................
FBpp0079851  -------------...---...-----.....-----....-..-.-......................................
FBpp0072146  -------------...---...-----.....-----....-..-.-......................................
FBpp0296980  -------------...---...-----.....-----....-..-.-......................................
FBpp0083238  -------------...---...-----.....-----....-..-.-......................................
FBpp0111383  LYVNRALCFIKLR...EFK...LGIID.....CDYVL....A..K.I......................................
FBpp0071560  -------------...---...-----.....-----....-..-.-......................................
FBpp0080424  AIYVRGLCLYYTD...NLD...KGILH.....FERAL....T..L.D......................................
FBpp0071879  -------------...---...-----.....-----....-..-.-......................................
FBpp0292775  TFSNAIRICKEND...FQE...ELWTV.....ASSSR....Q..R.D......................................
FBpp0077934  -------------...---...-----.....-----....-..-.-......................................
FBpp0087646  -------------...---...-----.....-----....-..-.-......................................
FBpp0079665  -------------...---...-----.....-----....-..-.-......................................
FBpp0086749  -------------...---...-----.....-----....-..-.-......................................
FBpp0082652  LYCNRALAKIKKR...DFK...LALFD.....LDYVI....-..-.-......................................
FBpp0077619  -------------...---...-----.....-----....-..-.-......................................
FBpp0086164  -------------...---...-----.....-----....-..-.-......................................
FBpp0087232  VLANRSATLYHMQ...KYQ...ECLID.....IKRAL....D..L.S......................................
FBpp0072561  -------------...---...-----.....-----....-..-.-......................................
FBpp0088148  -------------...---...-----.....-----....-..-.-......................................
FBpp0075787  -------------...---...-----.....-----....-..-.-......................................
FBpp0083319  -------------...---...-----.....-----....-..-.-......................................
FBpp0076499  SLCLRAEVLLKLS...HYQ...SSLAD.....IENAL....R..T.R......................................
FBpp0290580  -----GHCYYHAQ...KYE...EAATC.....YEQLC....Q..L.A......................................
FBpp0080720  -------------...---...-----.....-----....-..-.-......................................
FBpp0086164  -------------...---...-----.....--LAA....H..L.N......................................
FBpp0080741  -------------...---...-----.....-----....-..-.-......................................
FBpp0087297  -------------...---...-----.....-----....-..-.-......................................
FBpp0070720  -------------...---...-----.....-----....-..-.-......................................
FBpp0086683  -------------...---...-----.....-----....-..-.-......................................
FBpp0289328  -------------...---...-----.....-----....-..-.-......................................
FBpp0070667  -------------...---...-----.....-----....-..-.-......................................
FBpp0082624  -------MHYMRA...H--...-----.....-----....-..-.-......................................
FBpp0081552  A------------...---...-----.....-----....-..-.-......................................
FBpp0086749  -------------...---...-----.....-----....-..-.-......................................
FBpp0087646  -------------...---...-----.....-----....-..-.-......................................
FBpp0071879  -------------...---...-----.....-----....-..-.-......................................
FBpp0080894  -------------...---...-----.....-----....-..-.-......................................
FBpp0070906  -------------...---...-----.....-----....-..-.-......................................
FBpp0087646  -------------...---...-----.....-----....-..-.-......................................
FBpp0082112  -------------...---...-----.....-----....-..-.-......................................
FBpp0293629  -------------...---...-----.....-----....-..-.-......................................
FBpp0076526  -------------...---...-----.....-----....-..-.-......................................
FBpp0085279  -------------...---...-----.....-----....-..-.-......................................
FBpp0074835  -------------...---...-----.....-----....-..-.-......................................
FBpp0078887  -------------...---...-----.....-----....-..-.-......................................
FBpp0290580  -------------...---...-----.....-----....-..-.-......................................
FBpp0085047  -------------...---...-----.....-----....-..-.-......................................
FBpp0296980  -------------...---...-----.....-----....-..-.-......................................
FBpp0086380  -------------...---...-----.....-----....-..-.-......................................
FBpp0083435  --TNLAACLLQEK...RYE...HVIYH.....TQFVE....T..E.E......................................
FBpp0078891  -------------...---...-----.....-----....-..-.-......................................
FBpp0082419  -------------...---...-----.....-----....-..-.-......................................
FBpp0086749  -------------...---...-----.....-----....-..-.-......................................
FBpp0078027  -------------...---...-----.....-----....-..-.-......................................
FBpp0088148  -------------...---...-----.....-----....-..-.-......................................
FBpp0290863  -------------...---...-----.....-----....-..-.-......................................
FBpp0080720  -------------...---...-----.....AEGHT....E..E.S......................................
FBpp0083319  -------------...---...-----.....-----....-..-.-......................................
FBpp0071288  -------------...---...-----.....-----....-..-.-......................................
FBpp0081398  -------------...---...-----.....-----....-..-.-......................................
FBpp0085016  -------------...---...-----.....-----....-..-.-......................................
FBpp0293235  -------------...---...-----.....-----....-..-.-......................................
FBpp0290580  VVMARAWISWRDD...DFV...GAERE.....FHASA....E..F.C......................................
FBpp0085012  -------------...---...-----.....-----....-..-.-......................................
FBpp0086380  -------------...---...-----.....-----....-..-.-......................................
FBpp0071879  -------------...---...-----.....-----....-..-.-......................................
FBpp0076961  -------------...---...-----.....-----....-..-.-......................................
FBpp0075717  AYRSRASILIRLG...EGE...AALND.....LKLAInfglE..L.K......................................
FBpp0080267  -------------...---...-----.....-----....-..-.-......................................
FBpp0070908  ------HKRRLMM...RHK...NAVLV.....AIESS....Y..P.E......................................
FBpp0085033  -------------...---...-----.....-----....-..-.-......................................
FBpp0082507  -------------...---...-----.....-----....-..-.-......................................
FBpp0292775  -------------...---...-----.....-----....-..-.-......................................
FBpp0085676  -------------...---...-----.....-----....-..-.-......................................
FBpp0087091  GYANRSAVLFEWK...RYR...QCLDN.....IKLA-....-..-.-......................................
FBpp0082624  -------------...---...-----.....-----....-..-.-......................................
FBpp0070431  -------------...---...-----.....-----....-..-.-......................................
FBpp0075442  CLASVSRARR---...---...-----.....-----....-..-.-......................................
FBpp0070906  -------------...---...-----.....-----....-..-.-......................................
FBpp0089265  -------------...---...-----.....-----....-..-.-......................................
FBpp0078634  -------------...---...-----.....-----....-..-.-......................................
FBpp0075754  -------------...---...-----.....-----....-..-.-......................................
FBpp0087625  -------------...---...-----.....-----....-..-.-......................................
FBpp0071288  -------------...---...-----.....-----....-..-.-......................................
FBpp0110159  -------------...---...-----.....-----....-..-.-......................................
FBpp0072679  -------------...---...-----.....-----....-..-.-......................................
FBpp0082624  -------------...---...-----.....-----....-..-.-......................................
FBpp0084254  -------------...---...-----.....-----....-..-.-......................................
FBpp0085032  VRMVYAETLLKLN...QHA...DALKV.....VNIAL....T..D.N......................................


                           100               110          120           130                         
                             |                 |            |             |                         
d1w3ba_        ..........P..DF...ID.....GYINLAAAL.VAA.GDMEG.AVQAYVS....ALQYNPDL.....................
FBpp0112455  ..........-..--...--.....---------.---.-----.----YES....LVNVFPTT.....................
FBpp0070351  ..........P..--...--.....---------.---.-----.---KYQH....LVAAHPEL.....................
FBpp0070402  ..........H..RN...VT.....LWLKYAEME.MKN.KQVNH.ARNLWDR....AVTIMPRV.....................
FBpp0080138  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0074609  ..........-..KS...ID.....IYTDMGRFT.MAA.KHHQS.IAEMYE-....---SDPNN.....................
FBpp0084171  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085420  ..........P..NF...PD.....AYCNLANAL.KEK.GQVKE.AEDCYNT....ALRL----.....................
FBpp0085420  ..........-..--...--.....-----AHRE.YQA.VDYES.AEKHCMQ....LWRQDSTN.....................
FBpp0077790  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0082545  ..........P..NY...ES.....ALMNLGNLY.REH.GQLST.AEEYIRL....ALQAYPAF.....................
FBpp0084691  ..........P..DK...PS.....LHLMWAAFE.ECQ.MNFDD.AAEILQR....IDQRCPNL.....................
FBpp0072096  ..........-..--...-D.....EYSKAATAY.RIA.KSYDK.SKECFLK....AIDAYKNN.....................
FBpp0071560  ..........N..EN...AD.....IYYNLGVVF.LEQ.GKSQQ.AQVYFNK....AIELYPEH.....................
FBpp0077790  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0076600  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0271716  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0077790  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0290896  ..........P..QL...AV.....AYLNLGTSL.ISL.GDHRQeAISVLRT....GARLEGSGvrdrgahvear..........
FBpp0081673  ..........P..DL...AL.....GFYKRALAV.VLI.GDSTH.-------....------QA.....................
FBpp0077614  ..........-..--...--.....---------.---.-----.---LYRS....AIAINP--.....................
FBpp0084691  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0296980  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0080535  ..........N..NY...SK.....AYCRLGVAY.SNM.GNFEK.AEQAYAK....AIELEPDN.....................
FBpp0296980  ..........-..--...-K.....AYG------.---.-----.-------....--------.....................
FBpp0072164  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0084016  ..........PnqEH...IP.....CIVSFAKLY.AKH.DNNDM.AQTLLDD....VVTSYPKR.....................
FBpp0296980  ..........-..--...--.....------AAL.TSL.GHVYT.ASGDYPN....ALASHKQC.....................
FBpp0296980  ..........R..DQ...ER.....AYRGLGQAR.RAL.GQLPA.ALVCLEKrlvvAHELHSPE.....................
FBpp0080894  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0081606  ..........P..AY...LK.....GYYRRAAAH.MSL.GKFKQ.ALCDFEF....VAKCRPN-.....................
FBpp0084559  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075683  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0081284  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0079468  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087297  ..........-..RK...LE.....SYVRLAELY.RKD.KQYQK.AIEILEN....CLHLTPEN.....................
FBpp0074835  ..........P..TS...IP.....LWILSANLE.ERK.GVLTK.ARSILER....GRLRNPKV.....................
FBpp0079893  ..........P..EN...PD.....VYHQRAQIL.LLL.EQIEP.ALAEFEK....AVSIAPNHaiafvqk..............
FBpp0082765  ..........P..EY...VR.....VLLRRAKLY.EQE.DKPDE.ALEDYKK....VTEIDPGQ.....................
FBpp0079617  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0084440  ..........P..MN...IK.....AHLRMAEAH.NAE.GKHLE.SLNVYKK....LLDFEPDN.....................
FBpp0080424  ..........P..GF...EK.....AYVRVAKCC.LAL.GD---.-------....--------.....................
FBpp0085344  daleravqfdG..ND...HL.....AEYYLSLQY.ALL.GQLAE.ALVHIRF....ALALRMEH.....................
FBpp0081552  ..........P..AD...IE.....NHLELGKEF.LAR.GQLSD.ALTHYHA....AVEGDANN.....................
FBpp0087646  ..........P..HF...AE.....CFDYLGKLYpLAT.GDFSR.ARKCYEK....CISLNPLA.....................
FBpp0083769  ..........P..DK...AI.....SWYAVGCYY.DMI.GKSDP.ARRYLSK....ATALDRLY.....................
FBpp0070572  ..........S..DL...AA.....GYKFRGRAR.RLL.GDFEL.AAHDLRQ....ACKL----.....................
FBpp0070575  ..........S..DL...AA.....GYKFRGRAR.RLL.GDFEL.AAHDLRQ....ACKL----.....................
FBpp0074835  ..........-..--...KQ.....TWIDDAEFC.AKE.NAFEC.ARAVYAH....ALQIFPSK.....................
FBpp0080424  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0076113  ..........-..--...--.....----SGNHF.YQL.GRYHE.ARAKYRK....ANR-----.....................
FBpp0072561  ..........P..NY...ID.....CYLRLGCMA.RDK.GLIFV.ASDFFKD....ALNINNDN.....................
FBpp0072561  ..........P..SN...IP.....SLLGKACIA.FNR.KDYRG.AMAFYKK....ALRTNPNC.....................
FBpp0085923  ..........P..SY...VK.....AHFRLARAL.LEL.HRPQD.ADQCLQA....LIQRFPDF.....................
FBpp0079893  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075683  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0077614  ..........P..NQ...VA.....AHLSYGITL.ARNsSRASE.AEMWFKR....ALKLAPEQ.....................
FBpp0086749  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0073411  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070908  ..........K..YT...AS.....HWFAHAQLL.YDE.GKFER.GLNFVEK....CLDSEPRN.....................
FBpp0085842  ..........P..NN...SK.....ALYRKGRIL.EGK.ADTQG.AIKLLQK....VATLEPEN.....................
FBpp0077718  ..........R..QK...PS.....GSTGCTLSW.WWQ.QQMGR.CLLALHY....PRRAEPFLqqsltsfph............
FBpp0296980  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0076600  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086749  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085479  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0112016  ..........K..NN...IR.....AIYQKAESL.YYL.GQFEQ.SLMFFHR....GLRARPEL.....................
FBpp0079665  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0084076  ..........E..SN...LR.....AWLYQAHAY.KGL.KQDDK.FEESVVK....AREHNPKQ.....................
FBpp0111406  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0074918  ..........-..--...--.....-----GNHF.YRS.ADYAQ.AMDHFEI....SLEINNLQ.....................
FBpp0082818  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0074480  ..........L..RS...HV.....CWHVYGLLQ.RSD.KKYDE.AIKCYRN....ALKWEKDN.....................
FBpp0082819  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085279  ..........P..HV...NQ.....LKLNMGNIY.YSM.GIYQK.AVKMYRM....ALDSVPKSlsqlr................
FBpp0081805  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0100023  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0071879  ..........S..--...--.....---------.---.-----.-------....------SY.....................
FBpp0084559  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075591  ..........N..DQ...QTrtkchAHCQRGVLY.RKL.DNLEA.ARADFEA....AAQLGSKF.....................
FBpp0076526  ..........T..--...--.....-----AKAK.RMV.GEMYT.LLCDYDA....AKD-----.....................
FBpp0079851  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0072146  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0296980  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0083238  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0111383  ..........-..--...--.....---------.---.-----.-------....----DEHY.....................
FBpp0071560  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0080424  ..........P..DH...YK.....S--------.---.-----.-------....--------.....................
FBpp0071879  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0292775  ..........K..AI...AA.....AYF------.EEC.GNFKH.AVELYHR....AGMLHKALemafesqqpeileiiasdlap
FBpp0077934  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087646  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0079665  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086749  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0082652  ..........-..--...--.....---------.---.-----.-------....-FNLDPIH.....................
FBpp0077619  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086164  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087232  ..........Y..SKdliYK.....LYERQARCY.MAL.KDYPH.TIDSFKK....CITA----.....................
FBpp0072561  ..........-..--...--.....--YGLGQMY.IYR.GDTEN.AAQCFEK....VLKIQPGN.....................
FBpp0088148  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075787  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0083319  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0076499  ..........C..TS...PK.....AHYLRALAL.SGL.GRLEE.ALY----....--------.....................
FBpp0290580  ..........P..KE...AK.....YRFYYAQSL.YQA.GIFAD.ALRVLKQ....MGDQEDEL.....................
FBpp0080720  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086164  ..........P..QD...RD.....MWIRVSDLL.VQQ.GNLAR.ARLIYTK....AIKMLPKV.....................
FBpp0080741  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087297  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070720  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086683  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0289328  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070667  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0082624  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0081552  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086749  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087646  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0071879  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0080894  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070906  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087646  ..........-..--...--.....---------.-KL.GKHAE.AIPKCQR....LLKSEPEN.....................
FBpp0082112  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0293629  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0076526  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085279  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0074835  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0078887  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0290580  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085047  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0296980  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086380  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0083435  ..........S..PS...EK.....SIYRRALAY.YHL.KEFAK.AQA----....--------.....................
FBpp0078891  ..........-..--...--.....-HLATAIVY.CHD.GQFEN.ALKILHG....STNLESMA.....................
FBpp0082419  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086749  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0078027  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0088148  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0290863  ..........-..--...--.....-YSDWAMFF.FTQ.QRYAN.GLRYFNS....ALDLNPFN.....................
FBpp0080720  ..........P..KI...LH.....ISSKIAHMS.QLQ.GDLEK.SFQGFTW....TLQ-----.....................
FBpp0083319  ..........-..--...--.....---QLAYVL.QLQ.GKTKE.ASSIYAD....CLRHKPKDaalvavasnnlvvvnkdqnvf
FBpp0071288  ..........P..EF...GE.....LRSDYLRYL.WQE.RSVEE.ARKEYAK....LAILPPM-.....................
FBpp0081398  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085016  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0293235  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0290580  ..........S..EN...SI.....WRLNAGHVL.FMQ.GD---.-------....--------.....................
FBpp0085012  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0086380  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0071879  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0076961  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075717  ..........-..SS...VD.....YYLKMAKAY.AVM.GEPAR.AEIS---....--------.....................
FBpp0080267  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070908  ..........F..GD...AE.....QRRRAAECY.RQI.GNTDM.AIE---T....LLQVPPTL.....................
FBpp0085033  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0082507  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0292775  ..........-..--...--.....--TNLAKMC.VHT.NRLDV.AKVCMGH....LEQAR---.....................
FBpp0085676  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087091  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0082624  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070431  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075442  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0070906  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0089265  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0078634  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0075754  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0087625  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0071288  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0110159  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0072679  ..........-..--...--.....---EIGHHF.ANL.RSWES.AREYYEK....SHYLE---.....................
FBpp0082624  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0084254  ..........-..--...--.....---------.---.-----.-------....--------.....................
FBpp0085032  ..........P..HD...IK.....LLL------.---.-----.-------....--------.....................


                                                                            140        150          
                                                                              |          |          
d1w3ba_        ..........................................................YCVRSDL.GNLLKALGRLEE...AKAC
FBpp0112455  ..........................................................ARYWKLY.IEMEMRSRYYER...VEKL
FBpp0070351  ..........................................................QAEGTSL.ASSLIGPSKLRD...LQQI
FBpp0070402  ..........................................................NQFWYKY.TYMEEMLENVAG...ARQV
FBpp0080138  ..........................................................-------.------------...----
FBpp0074609  ..........................................................-------.---------LAK...SIQH
FBpp0084171  ..........................................................-------.------------...----
FBpp0085420  ..........................................................-------.------------...----
FBpp0085420  ..........................................................TGVLLLL.SSIHFQCRRLDK...SAQF
FBpp0077790  ..........................................................-------.------------...----
FBpp0082545  ..........................................................PAAWMNL.GIVQSAQGKYDK...ALAS
FBpp0084691  ..........................................................LQLSYRR.INVERRRGALDK...CREL
FBpp0072096  ..........................................................KSW----.----------FH...AAKA
FBpp0071560  ..........................................................EQALLNS.AILLQELGGEEArrvSRSR
FBpp0077790  ..........................................................-------.------------...----
FBpp0076600  ..........................................................-------.------------...----
FBpp0271716  ..........................................................-------.------------...----
FBpp0077790  ..........................................................-------.------------...----
FBpp0290896  ..........................................................YTCYLQL.SVLYRSDGRLQD...AAAA
FBpp0081673  ..........................................................SEFASKV.SRILVRLKKYEE...AT--
FBpp0077614  ..........................................................PKALGNL.GSVLSSQGRYEE...AKQV
FBpp0084691  ..........................................................-TGWTYL.LQYVDNESDAEA...AREA
FBpp0296980  ..........................................................-------.------------...----
FBpp0080535  ..........................................................EVYKSNL.------------...----
FBpp0296980  ..........................................................-------.------------...----
FBpp0072164  ..........................................................-------.------------...----
FBpp0084016  ..........................................................IDIWSVY.VDMLIKAGLIDS...ARNV
FBpp0296980  ..........................................................VQLFKQL.GDRLQEARE---...----
FBpp0296980  ..........................................................IKA----.------------...----
FBpp0080894  ..........................................................-------.GNYYSIRCDHQV...AISY
FBpp0081606  ..........................................................-------.------------...----
FBpp0084559  ..........................................................-------.------------...----
FBpp0075683  ..........................................................-------.------------...----
FBpp0081284  ..........................................................-------.------------...----
FBpp0079468  ..........................................................-------.------------...----
FBpp0087297  ..........................................................SEVLIEI.SVLYLKINETQK...AHDR
FBpp0074835  ..........................................................AVLWLEA.IRVELRAGLKEI...ASTM
FBpp0079893  ..........................................................CYAEYRL.SLLAGDQRRLES...VMHT
FBpp0082765  ..........................................................QEA----.------------...----
FBpp0079617  ..........................................................-------.------------...----
FBpp0084440  ..........................................................AIA----.------------...----
FBpp0080424  ..........................................................-------.------------...----
FBpp0085344  ..........................................................APCLHLF.ALLLTSSRRPRE...ALGV
FBpp0081552  ..........................................................YLT----.------------...----
FBpp0087646  ..........................................................EEAVDAL.SFIYQEQGEEEL...NETL
FBpp0083769  ..........................................................GPAWLAY.GHSFANENEHEQ...AMAA
FBpp0070572  ..........................................................-------.------------...----
FBpp0070575  ..........................................................-------.------------...----
FBpp0074835  ..........................................................KSIWLRA.AYFEKNHGTRES...LEAL
FBpp0080424  ..........................................................-------.------------...----
FBpp0076113  ..........................................................-YYHYLS.RQFGWQQLNPLK...KHLV
FBpp0072561  ..........................................................PDARSLL.GNLHLAKMQFAL...GQKN
FBpp0072561  ..........................................................PANVR--.------------...----
FBpp0085923  ..........................................................A------.------------...----
FBpp0079893  ..........................................................-------.------------...----
FBpp0075683  ..........................................................-------.------------...----
FBpp0077614  ..........................................................ASVYHHY.AEFLSLQSRHHE...SAIY
FBpp0086749  ..........................................................-------.------------...----
FBpp0073411  ..........................................................-------.------------...----
FBpp0070908  ..........................................................HEALILR.GRLLIALERHTQ...AVCA
FBpp0085842  ..........................................................RAVQSDL.ARLFIKARREE-...----
FBpp0077718  ..........................................................PDTYLLL.SRVYQRIKQPER...ALLV
FBpp0296980  ..........................................................-------.------------...----
FBpp0076600  ..........................................................----FLL.ATSYFRSNQVHQ...AYWL
FBpp0086749  ..........................................................--LWNSL.ADYYVRSGLFDR...ARDI
FBpp0085479  ..........................................................-------.------------...----
FBpp0112016  ..........................................................A------.------------...----
FBpp0079665  ..........................................................-------.------------...----
FBpp0084076  ..........................................................L------.------------...----
FBpp0111406  ..........................................................-------.------------...----
FBpp0074918  ..........................................................EAILLRC.GYCAIQLERWEP...AVKY
FBpp0082818  ..........................................................-------.------------...----
FBpp0074480  ..........................................................LQILKDL.SLLQIQMRDLEG...YKET
FBpp0082819  ..........................................................-------.------------...----
FBpp0085279  ..........................................................LKIRENI.GILFIRMGSYSD...AASS
FBpp0081805  ..........................................................-------.------------...----
FBpp0100023  ..........................................................-------.------------...----
FBpp0071879  ..........................................................HDCYLRL.GVMAIQKNNHTQ...AIEH
FBpp0084559  ..........................................................-------.------------...----
FBpp0075591  ..........................................................-------.------------...----
FBpp0076526  ..........................................................-------.------------...----
FBpp0079851  ..........................................................-------.------------...----
FBpp0072146  ..........................................................-------.------------...----
FBpp0296980  ..........................................................-------.------------...----
FBpp0083238  ..........................................................-------.------------...----
FBpp0111383  ..........................................................LRAWLYR.AAAYKRLN----...----
FBpp0071560  ..........................................................-------.------------...----
FBpp0080424  ..........................................................-------.------------...----
FBpp0071879  ..........................................................-------.------------...----
FBpp0292775  .......................................................dsdAELINRC.ADFFCSIEQFQK...AVHL
FBpp0077934  ..........................................................-------.------------...----
FBpp0087646  ..........................................................-------.------------...----
FBpp0079665  ..........................................................-------.------------...----
FBpp0086749  ..........................................................-------.------------...----
FBpp0082652  ..........................................................LRAWLYR.AGALARLNNESE...----
FBpp0077619  ..........................................................-------.------------...----
FBpp0086164  ..........................................................-------.------------...----
FBpp0087232  ..........................................................-------.------------...----
FBpp0072561  ..........................................................YETMKIL.GSLYAHSNS---...----
FBpp0088148  ..........................................................-------.------------...----
FBpp0075787  ..........................................................-------.------------...----
FBpp0083319  ..........................................................-------.-------QEFDK...AVKA
FBpp0076499  ..........................................................-------.------------...----
FBpp0290580  ..........................................................REQCLQLqSAILYSSEDFAG...AQSL
FBpp0080720  ..........................................................-------.------------...----
FBpp0086164  ..........................................................YQLRLRK.AQLLQKMGETNA...SMFT
FBpp0080741  ..........................................................-------.------------...----
FBpp0087297  ..........................................................-------.------------...----
FBpp0070720  ..........................................................-------.------A-----...----
FBpp0086683  ..........................................................-------.------------...----
FBpp0289328  ..........................................................-------.------------...----
FBpp0070667  ..........................................................-------.------------...----
FBpp0082624  ..........................................................-------.------------...----
FBpp0081552  ..........................................................-------.------------...----
FBpp0086749  ..........................................................-------.------------...----
FBpp0087646  ..........................................................-------.------------...----
FBpp0071879  ..........................................................-------.-QMYLHEGELNR...SKAF
FBpp0080894  ..........................................................-------.------------...----
FBpp0070906  ..........................................................-------.------------...----
FBpp0087646  ..........................................................AMGYLLL.GAAYQNIDKAEA...AKNL
FBpp0082112  ..........................................................-------.------------...----
FBpp0293629  ..........................................................-------.-------GHHRQ...ATTI
FBpp0076526  ..........................................................-------.------------...----
FBpp0085279  ..........................................................-------.------------...----
FBpp0074835  ..........................................................-------.------------...----
FBpp0078887  ..........................................................-------.------------...----
FBpp0290580  ..........................................................-------.------------...----
FBpp0085047  ..........................................................-------.------------...----
FBpp0296980  ..........................................................-------.------------...----
FBpp0086380  ..........................................................-------.------------...----
FBpp0083435  ..........................................................-------.------------...----
FBpp0078891  ..........................................................LSV----.-QCLLRLQRVDL...AKQL
FBpp0082419  ..........................................................-------.------------...----
FBpp0086749  ..........................................................-------.------------...----
FBpp0078027  ..........................................................-------.------------...----
FBpp0088148  ..........................................................-------.------------...----
FBpp0290863  ..........................................................ERALMRR.SQLKRSMGLASE...ALKD
FBpp0080720  ..........................................................-------.------------...---Q
FBpp0083319  dskkkiraaladacesrltsrqkqvialnncllalytnagdqvqqlsqklaqtypqveFEALLIR.CTQLAKDRKHKE...AIEQ
FBpp0071288  ..........................................................-------.------------...----
FBpp0081398  ..........................................................-------.------------...--IF
FBpp0085016  ..........................................................-------.------------...----
FBpp0293235  ..........................................................-------.------------...----
FBpp0290580  ..........................................................-------.--------KYNE...AAAF
FBpp0085012  ..........................................................-------.------------...----
FBpp0086380  ..........................................................-------.------------...----
FBpp0071879  ..........................................................-------.------------...----
FBpp0076961  ..........................................................-------.------------...----
FBpp0075717  ..........................................................-------.------------...----
FBpp0080267  ..........................................................-------.------------...----
FBpp0070908  ..........................................................RSPRINL.MLARLQHHGSRH...G---
FBpp0085033  ..........................................................-------.------------...VPQR
FBpp0082507  ..........................................................-------.------------...----
FBpp0292775  ..........................................................-------.------------...SVRA
FBpp0085676  ..........................................................-------.------------...----
FBpp0087091  ..........................................................-------.------------...----
FBpp0082624  ..........................................................-------.------------...----
FBpp0070431  ..........................................................-------.------------...----
FBpp0075442  ..........................................................-------.------------...----
FBpp0070906  ..........................................................-------.------------...----
FBpp0089265  ..........................................................-------.------------...----
FBpp0078634  ..........................................................-------.------------...----
FBpp0075754  ..........................................................-------.------------...----
FBpp0087625  ..........................................................-------.------------...----
FBpp0071288  ..........................................................-------.------------...----
FBpp0110159  ..........................................................-------.------------...----
FBpp0072679  ..........................................................-----GY.MEALYHLEQFDD...L---
FBpp0082624  ..........................................................-------.------------...----
FBpp0084254  ..........................................................-------.------------...----
FBpp0085032  ..........................................................-------.------------...----


               160                                                                                  
                 |                                                                                  
d1w3ba_        YLKA.................................................................................
FBpp0112455  FQRClvkilnidlwklyltyvketksglsthkekmaqaydfalekigmdlhsfsiwqdyiyflrgveavgnyaenqkitavrrvy
FBpp0070351  YLEA.................................................................................
FBpp0070402  FERW.................................................................................
FBpp0080138  ----.................................................................................
FBpp0074609  YEQA.................................................................................
FBpp0084171  ----.................................................................................
FBpp0085420  ----.................................................................................
FBpp0085420  STLA.................................................................................
FBpp0077790  ----.................................................................................
FBpp0082545  YEKA.................................................................................
FBpp0084691  YKHY.................................................................................
FBpp0072096  YEQI.................................................................................
FBpp0071560  LYKV.................................................................................
FBpp0077790  ----.................................................................................
FBpp0076600  ----.................................................................................
FBpp0271716  ----.................................................................................
FBpp0077790  ----.................................................................................
FBpp0290896  LRES.................................................................................
FBpp0081673  ----.................................................................................
FBpp0077614  LQEA.................................................................................
FBpp0084691  YDTF.................................................................................
FBpp0296980  ----.................................................................................
FBpp0080535  ----.................................................................................
FBpp0296980  ----.................................................................................
FBpp0072164  ----.................................................................................
FBpp0084016  LERA.................................................................................
FBpp0296980  ----.................................................................................
FBpp0296980  ----.................................................................................
FBpp0080894  FQRA.................................................................................
FBpp0081606  ----.................................................................................
FBpp0084559  ----.................................................................................
FBpp0075683  ----.................................................................................
FBpp0081284  ----.................................................................................
FBpp0079468  ----.................................................................................
FBpp0087297  LAEV.................................................................................
FBpp0074835  MARA.................................................................................
FBpp0079893  FQNA.................................................................................
FBpp0082765  ----.................................................................................
FBpp0079617  ----.................................................................................
FBpp0084440  ----.................................................................................
FBpp0080424  ----.................................................................................
FBpp0085344  VEDA.................................................................................
FBpp0081552  ----.................................................................................
FBpp0087646  LLNT.................................................................................
FBpp0083769  YFKA.................................................................................
FBpp0070572  ----.................................................................................
FBpp0070575  ----.................................................................................
FBpp0074835  LQRA.................................................................................
FBpp0080424  ----.................................................................................
FBpp0076113  DEDL.................................................................................
FBpp0072561  FETI.................................................................................
FBpp0072561  ----.................................................................................
FBpp0085923  ----.................................................................................
FBpp0079893  ----.................................................................................
FBpp0075683  ----.................................................................................
FBpp0077614  HRRA.................................................................................
FBpp0086749  ----.................................................................................
FBpp0073411  ----.................................................................................
FBpp0070908  FRTA.................................................................................
FBpp0085842  ----.................................................................................
FBpp0077718  IGEV.................................................................................
FBpp0296980  ----.................................................................................
FBpp0076600  LKEK.................................................................................
FBpp0086749  YEEAiqtvttvrdftqvfdeyaqfeelslnrrmeqvaaneaateeddidvelrlsrfeylmerrllllnsvl.............
FBpp0085479  ----.................................................................................
FBpp0112016  ----.................................................................................
FBpp0079665  ----.................................................................................
FBpp0084076  ----.................................................................................
FBpp0111406  ----.................................................................................
FBpp0074918  YLAY.................................................................................
FBpp0082818  ----.................................................................................
FBpp0074480  RHHL.................................................................................
FBpp0082819  ----.................................................................................
FBpp0085279  FEFImteranirssihlllcyfalgdvekvklafrrlcdvqteaiesdmesetniiklqqqaepiqqigetdgyqslnnepvtgs
FBpp0081805  ----.................................................................................
FBpp0100023  ----.................................................................................
FBpp0071879  LKDI.................................................................................
FBpp0084559  ----.................................................................................
FBpp0075591  ----.................................................................................
FBpp0076526  ----.................................................................................
FBpp0079851  ----.................................................................................
FBpp0072146  ----.................................................................................
FBpp0296980  ----.................................................................................
FBpp0083238  ----.................................................................................
FBpp0111383  ----.................................................................................
FBpp0071560  ----.................................................................................
FBpp0080424  ----.................................................................................
FBpp0071879  ----.................................................................................
FBpp0292775  LAK-.................................................................................
FBpp0077934  ----.................................................................................
FBpp0087646  ----.................................................................................
FBpp0079665  ----.................................................................................
FBpp0086749  ----.................................................................................
FBpp0082652  ----.................................................................................
FBpp0077619  ----.................................................................................
FBpp0086164  ----.................................................................................
FBpp0087232  ----.................................................................................
FBpp0072561  ----.................................................................................
FBpp0088148  ----.................................................................................
FBpp0075787  ----.................................................................................
FBpp0083319  VNRI.................................................................................
FBpp0076499  ----.................................................................................
FBpp0290580  LNQR.................................................................................
FBpp0080720  ----.................................................................................
FBpp0086164  YLKM.................................................................................
FBpp0080741  ----.................................................................................
FBpp0087297  ----.................................................................................
FBpp0070720  ----.................................................................................
FBpp0086683  ----.................................................................................
FBpp0289328  ----.................................................................................
FBpp0070667  ---G.................................................................................
FBpp0082624  ----.................................................................................
FBpp0081552  ----.................................................................................
FBpp0086749  ----.................................................................................
FBpp0087646  ----.................................................................................
FBpp0071879  LESF.................................................................................
FBpp0080894  ----.................................................................................
FBpp0070906  ----.................................................................................
FBpp0087646  RQCIkctdgpapaallglancapsnelpeiydqladlqpeqslnyweklfnlasdsnvapfcftvlkkrvqdtengnftkiqeyl
FBpp0082112  ----.................................................................................
FBpp0293629  HELL.................................................................................
FBpp0076526  ----.................................................................................
FBpp0085279  ----.................................................................................
FBpp0074835  ----.................................................................................
FBpp0078887  ----.................................................................................
FBpp0290580  ----.................................................................................
FBpp0085047  ----.................................................................................
FBpp0296980  ----.................................................................................
FBpp0086380  ----.................................................................................
FBpp0083435  ----.................................................................................
FBpp0078891  VAKM.................................................................................
FBpp0082419  ----.................................................................................
FBpp0086749  ----.................................................................................
FBpp0078027  ----.................................................................................
FBpp0088148  ----.................................................................................
FBpp0290863  ----.................................................................................
FBpp0080720  LAKL.................................................................................
FBpp0083319  LQKF.................................................................................
FBpp0071288  ----.................................................................................
FBpp0081398  SRQG.................................................................................
FBpp0085016  ----.................................................................................
FBpp0293235  ----.................................................................................
FBpp0290580  YEPI.................................................................................
FBpp0085012  ----.................................................................................
FBpp0086380  ----.................................................................................
FBpp0071879  ----.................................................................................
FBpp0076961  ----.................................................................................
FBpp0075717  ----.................................................................................
FBpp0080267  ----.................................................................................
FBpp0070908  ----.................................................................................
FBpp0085033  LQEE.................................................................................
FBpp0082507  ----.................................................................................
FBpp0292775  LRQA.................................................................................
FBpp0085676  ----.................................................................................
FBpp0087091  ----.................................................................................
FBpp0082624  ----.................................................................................
FBpp0070431  ----.................................................................................
FBpp0075442  ----.................................................................................
FBpp0070906  ----.................................................................................
FBpp0089265  ----.................................................................................
FBpp0078634  ----.................................................................................
FBpp0075754  ----.................................................................................
FBpp0087625  ----.................................................................................
FBpp0071288  ----.................................................................................
FBpp0110159  ----.................................................................................
FBpp0072679  -EKC.................................................................................
FBpp0082624  ----.................................................................................
FBpp0084254  ----.................................................................................
FBpp0085032  ----.................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  qkavvtpivgieqlwkdyiafeqninpiisekmslerskdymnarrvakeleyhtkglnrnlpavpptltkeevkqvelwkrfit
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  vikaegggklnetvkfaatvkhryvvqalkkdelavyrnerrnavkrsitmivdlispfiednyndgynwcieiiktsnlawlan
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  griwvsndfeiapedtqlykttmeallqnsepsarsvvykrylkwlykkqdyetcvrhacnmteshpkdvygfewicktycehhe
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  yeksnplrtedtalvtrrvmfateqcllv........................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  elelnkalvylrqndvhqaietlqmydrksegsmtasaltnlsfiyikmashcvnqlheigslknnapglinagivelgshnlil
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  qseivswqqelrhpiqvyaeql...............................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                   170                                                              
                                     |                                                              
d1w3ba_        ........IETQPNF......AVA..WSN........................................................
FBpp0112455  ........LTHHPAV......WHQ..ASQfldtsarvltekgvrtsvenispilcvpvvnqiewv....................
FBpp0070351  ........VRQHPSE......VDAevQDA........................................................
FBpp0070402  ........MEWQPEEqa....WQT..YVN........................................................
FBpp0080138  ........-------......---..---........................................................
FBpp0074609  ........ADYFKGEesvssaNKC..MLK........................................................
FBpp0084171  ........-------......---..---........................................................
FBpp0085420  ........---CSNH......ADS..LNN........................................................
FBpp0085420  ........IKQNPVL......AEA..YSN........................................................
FBpp0077790  ........-------......---..---........................................................
FBpp0082545  ........LKYRANF......AVC..YYN........................................................
FBpp0084691  ........IESTKNKgiag..SLA..IKY........................................................
FBpp0072096  ........ILLSKDA......DK-..---........................................................
FBpp0071560  ........LENDDQN......EKV..YFN........................................................
FBpp0077790  ........-------......---..---........................................................
FBpp0076600  ........-------......---..---........................................................
FBpp0271716  ........-------......---..---........................................................
FBpp0077790  ........-------......---..-KE........................................................
FBpp0290896  ........LKALPLLpqkqr.AVL..HLR........................................................
FBpp0081673  ........-------......---..---........................................................
FBpp0077614  ........IRFRPNM......ADV..HFN........................................................
FBpp0084691  ........LSHYPYC......YGY..WRK........................................................
FBpp0296980  ........-------......---..---........................................................
FBpp0080535  ........-------......---..---........................................................
FBpp0296980  ........-------......---..--N........................................................
FBpp0072164  ........-------......--D..IKD........................................................
FBpp0084016  ........VVQK---......---..---........................................................
FBpp0296980  ........-------......---..IGN........................................................
FBpp0296980  ........-------......-LA..YGD........................................................
FBpp0080894  ........LKLNPKY......LAA..WTL........................................................
FBpp0081606  ........-------......---..---........................................................
FBpp0084559  ........-------......--A..CGN........................................................
FBpp0075683  ........---HPAV......AAT..LNN........................................................
FBpp0081284  ........-------......---..---........................................................
FBpp0079468  ........-------......---..---........................................................
FBpp0087297  ........VSIERKCs.....PKG..LLA........................................................
FBpp0074835  ........LQECPN-......---..---........................................................
FBpp0079893  ........IERFPSC......VEC..YSL........................................................
FBpp0082765  ........-------......---..---........................................................
FBpp0079617  ........-------......---..--E........................................................
FBpp0084440  ........-------......---..---........................................................
FBpp0080424  ........-------......---..---........................................................
FBpp0085344  ........LHEFPDN......LQL..LHV........................................................
FBpp0081552  ........-------......---..LFK........................................................
FBpp0087646  ........LSH----......---..---........................................................
FBpp0083769  ........TQLMRGC......HLP..LLY........................................................
FBpp0070572  ........-------......---..---........................................................
FBpp0070575  ........-------......---..---........................................................
FBpp0074835  ........VAHCPKS......EIL..WLM........................................................
FBpp0080424  ........-------......---..---........................................................
FBpp0076113  ........LKVDGFS......VVN..NIN........................................................
FBpp0072561  ........LKNPSTS......TDA..YSLialgnfslqtlhqp..........................................
FBpp0072561  ........-------......---..-IG........................................................
FBpp0085923  ........-------......---..---........................................................
FBpp0079893  ........-------......---..---........................................................
FBpp0075683  ........-------......---..LHN........................................................
FBpp0077614  ........AELAPND......YTL..VVA........................................................
FBpp0086749  ........-------......---..---........................................................
FBpp0073411  ........-------......---..---........................................................
FBpp0070908  ........QMVAPYR......FEI..YRG........................................................
FBpp0085842  ........-------......---..---........................................................
FBpp0077718  ........VDSRPFD......VTY..RLE........................................................
FBpp0296980  ........-------......---..-GN........................................................
FBpp0076600  ........ARRSPQC......RFL..QAKcayelkkyaeaesalistgfadakncdelqrdfgdlacfayql.............
FBpp0086749  ........LRQNPHN......VHE..WHKrvtlyedkpaeiistyteavqtvqpkqavgklhtlwve..................
FBpp0085479  ........-------......---..---........................................................
FBpp0112016  ........-------......---..---........................................................
FBpp0079665  ........-------......---..---........................................................
FBpp0084076  ........-------......---..---........................................................
FBpp0111406  ........-------......---..-RK........................................................
FBpp0074918  ........THLEPNG......FES..WNN........................................................
FBpp0082818  ........-------......---..---........................................................
FBpp0074480  ........FTLRPSQ......HAS..WIG........................................................
FBpp0082819  ........-------......---..---........................................................
FBpp0085279  aserfegaLQLQPMN......FEA..RYN........................................................
FBpp0081805  ........-------......---..---........................................................
FBpp0100023  ........-------......---..---........................................................
FBpp0071879  ........LVEDNLN......MTA..RTY........................................................
FBpp0084559  ........-------......---..---........................................................
FBpp0075591  ........-------......---..---........................................................
FBpp0076526  ........------H......IND..YLK........................................................
FBpp0079851  ........-------......---..---........................................................
FBpp0072146  ........-------......---..---........................................................
FBpp0296980  ........-------......---..---........................................................
FBpp0083238  ........-------......---..---........................................................
FBpp0111383  ........-------......---..---........................................................
FBpp0071560  ........-------......---..---........................................................
FBpp0080424  ........-------......---..---........................................................
FBpp0071879  ........-------......---..---........................................................
FBpp0292775  ........-------......---..---........................................................
FBpp0077934  ........-------......---..---........................................................
FBpp0087646  ........-------......---..---........................................................
FBpp0079665  ........-------......---..---........................................................
FBpp0086749  ........-------......---..---........................................................
FBpp0082652  ........-------......---..---........................................................
FBpp0077619  ........-------......---..---........................................................
FBpp0086164  ........-------......---..---........................................................
FBpp0087232  ........-------......---..---........................................................
FBpp0072561  ........-------......---..---........................................................
FBpp0088148  ........-------......---..---........................................................
FBpp0075787  ........-------......---..---........................................................
FBpp0083319  ........LGVAPDD......PTA..LHC........................................................
FBpp0076499  ........-------......---..---........................................................
FBpp0290580  ........A------......---..---........................................................
FBpp0080720  ........-------......---..---........................................................
FBpp0086164  ........LPLMPPDe.....WKM..CLNtakn....................................................
FBpp0080741  ........-------......---..---........................................................
FBpp0087297  ........-------......---..---........................................................
FBpp0070720  ........-------......---..---........................................................
FBpp0086683  ........-------......---..---........................................................
FBpp0289328  ........-------......---..---........................................................
FBpp0070667  ........LQHHPAS......WKF..HTL........................................................
FBpp0082624  ........-------......---..---........................................................
FBpp0081552  ........-------......---..---........................................................
FBpp0086749  ........-------......---..---........................................................
FBpp0087646  ........-------......---..---........................................................
FBpp0071879  ........LTSEPDE......PVV..MDL........................................................
FBpp0080894  ........-------......---..---........................................................
FBpp0070906  ........-------......---..---........................................................
FBpp0087646  ........LELNPNS......NLA..LLV........................................................
FBpp0082112  ........-------......---..---........................................................
FBpp0293629  ........INRLPED......PRL..RNQ........................................................
FBpp0076526  ........-------......---..---........................................................
FBpp0085279  ........-------......---..---........................................................
FBpp0074835  ........-------......---..---........................................................
FBpp0078887  ........-------......---..---........................................................
FBpp0290580  ........-------......---..---........................................................
FBpp0085047  ........-------......---..---........................................................
FBpp0296980  ........-------......---..---........................................................
FBpp0086380  ........-----EV......ALI..DSN........................................................
FBpp0083435  ........-------......---..---........................................................
FBpp0078891  ........QEISDDA......TLT..QLA........................................................
FBpp0082419  ........-------......---..---........................................................
FBpp0086749  ........-------......---..---........................................................
FBpp0078027  ........-------......--I..YKD........................................................
FBpp0088148  ........-------......---..---........................................................
FBpp0290863  ........-------......---..---........................................................
FBpp0080720  ........LEKMPDD......KDI..LEL........................................................
FBpp0083319  ........AAAHKSH......EFV..SKFaiiqlqllqgnrkdaietllslgeakykpgvvsalvslylgtdnktaasallksav
FBpp0071288  ........-------......---..---........................................................
FBpp0081398  ........LSGLPYL......AEV..QTE........................................................
FBpp0085016  ........-------......---..---........................................................
FBpp0293235  ........-------......---..---........................................................
FBpp0290580  ........VRQHSDDimsvs.AAV..LAN........................................................
FBpp0085012  ........-------......---..---........................................................
FBpp0086380  ........-------......---..---........................................................
FBpp0071879  ........-------......---..---........................................................
FBpp0076961  ........------Q......RWI..YRS........................................................
FBpp0075717  ........-------......---..---........................................................
FBpp0080267  ........-------......---..---........................................................
FBpp0070908  ........-------......---..---........................................................
FBpp0085033  ........LLIQPRHlpike.VDA..LRL........................................................
FBpp0082507  ........-------......---..---........................................................
FBpp0292775  ........I--EDDD......LET..EAK........................................................
FBpp0085676  ........-------......-DI..YRD........................................................
FBpp0087091  ........-------......---..---........................................................
FBpp0082624  ........-------......---..---........................................................
FBpp0070431  ........-------......---..---........................................................
FBpp0075442  ........-------......---..---........................................................
FBpp0070906  ........-------......---..---........................................................
FBpp0089265  ........-------......---..---........................................................
FBpp0078634  ........-------......---..---........................................................
FBpp0075754  ........-------......---..---........................................................
FBpp0087625  ........-------......---..---........................................................
FBpp0071288  ........-------......---..---........................................................
FBpp0110159  ........-------......---..---........................................................
FBpp0072679  ........VERLPEK......SPL..LPK........................................................
FBpp0082624  ........-------......---..---........................................................
FBpp0084254  ........-------......---..---........................................................
FBpp0085032  ........-------......---..---........................................................


                                     180          190                                     200       
                                       |            |                                       |       
d1w3ba_        ...................LGCVFN...AQGEIWLAIH......HFEKA........VT........LD........PNFLD...
FBpp0112455  ...................MAFAWW...WAKDVQAAKI......FADEC........AN........IL........ERSINg..
FBpp0070351  ...................LGVLYN...LSGEFDKAVD......CYQSA........LQ........VD........PQNAK...
FBpp0070402  ...................FELRYK...EIDR---ARE......IYERF........VY........VH........P-DVK...
FBpp0080138  ...................------...----------......-----........--........--........-----...
FBpp0074609  ...................VAQYAA...QLEDYEKAIS......IYEQV........AA........SS........LE---...
FBpp0084171  ...................------...----------......-----........--........--........-----...
FBpp0085420  ...................LANIKR...EQGYIEEATR......LYLKA........LE........VF........PDFAA...
FBpp0085420  ...................LGNVFK...ERGQLQEALD......NYRRA........VR........LK........PDFID...
FBpp0077790  ...................LGNAAY...KKKDFETALK......HYHAA........IE........HD........PTDIT...
FBpp0082545  ...................MGNLYL...EQKRYAEALH......HWQHA........VA........LN........PRQPK...
FBpp0084691  ...................ARFLNK...ICHDLDAGLA......ALQQA........LE........RD........PANTR...
FBpp0072096  ...................------...----------......-----........--........--........LHEVEe..
FBpp0071560  ...................LGMLAM...DESSFDEAEQ......FFKRA........IH........LK........ADFRS...
FBpp0077790  ...................QGNLFF...KKGDYSTAVK......HYTEA........IK........RN........PDDPK...
FBpp0076600  ...................-GNCFS...LQKEHETAIK......FFKRA........VQ........VD........PDFVY...
FBpp0271716  ...................------...----------......-----........--........--........-----...
FBpp0077790  ...................KGNQAL...SAEKFDEAVA......AYTEA........IA........LD........DQNHV...
FBpp0290896  ...................LGEILA...ELQDWNEAEH......QQRLA........MQ........LQ........PEQGA...
FBpp0081673  ...................------...---------K......ALKKE........I-........--........-----...
FBpp0077614  ...................LGILHQ...NQQVYPAAVE......CFQRA........IK........FR........PNLAV...
FBpp0084691  ...................YADYEK...RKGIKANCYK......VFERG........LE........AI........PLSVD...
FBpp0296980  ...................----AC...QSGDFATAVL......LYTDA........LQ........LD........PGNHI...
FBpp0080535  ...................------...----------......-----........--........--........-----...
FBpp0296980  ...................MARMAH...MAGSYEAAVKyhkqelAINQA........MN........DR........SAEAA...
FBpp0072164  ...................RGNTYV...KQGEYEKAIV......AYSTA........IA........VY........PHDPI...
FBpp0084016  ...................------...----------......-----........--........LK........PN---...
FBpp0296980  ...................VGAVYL...ALGECEAALD......CHSQH........LR........LA........RKLHD...
FBpp0296980  ...................LGHVHA...ALGNHAQALN......CLEHQ........RE........LA........QGLQDral
FBpp0080894  ...................MGHEFM...ELKNTNAAIQ......SYRKA........VE........VN........KRDYR...
FBpp0081606  ...................------...----------......-----........--........--........-----...
FBpp0084559  ...................LGNTYY...LLGDFQAAIE......HHQER........LR........IA........REFGDraa
FBpp0075683  ...................LAVLYG...KRGKYKDAEP......LCKRA........LE........IRekvlgkdhPDVAK...
FBpp0081284  ...................------...----------......-----........--........--........-----...
FBpp0079468  ...................-GTNYF...KKENWALAIK......MYTKC........KN........IL........PTTVHtne
FBpp0087297  ...................FGAILQ...SRNDIDGALS......KYSQI........AN........AE........PEIAE...
FBpp0074835  ...................------...-------AGE......LWAEA........IF........ME........TKP--...
FBpp0079893  ...................TAQVLA...DQQQFTQAEE......YYKKA........MV........LA........PTNPA...
FBpp0082765  ...................------...----------......-----........--........--........-----...
FBpp0079617  ...................QGNCLF...AARKYDDAIN......CYSKA........II........KN........PTNAT...
FBpp0084440  ...................------...----------......-----........--........--........-----...
FBpp0080424  ...................------...----------......-----........--........--........-----...
FBpp0085344  ...................KAHLQL...HLEDAETALG......TVQHM........LA........--........-----...
FBpp0081552  ...................RGTVYL...ALGKTRFAVQ......DFSRV........LE........LK........PDFMA...
FBpp0087646  ...................------...----------......-----........--........LG........SNESIr..
FBpp0083769  ...................IGVECG...LTKNLELAEK......FFLQA........MN........IA........PLDVY...
FBpp0070572  ...................------...----------......-----........--........--........-----...
FBpp0070575  ...................------...----------......-----........--........--........-----...
FBpp0074835  ...................GAKSKW...MAGDVPAARG......ILSLA........FQ........AN........PNSED...
FBpp0080424  ...................-GNMLF...KSGRYREAHV......IYTDA........LK........ID........EHNKDins
FBpp0076113  ...................AAAVDL...KVGNYTSARE......VCNEA........IR........LD........PKCSK...
FBpp0072561  ...................SRDKEK...ERKHQEKALA......IFKQV........LR........ND........PRNIW...
FBpp0072561  ...................MAHCFL...KMGNPEKAKL......AFERA........LQ........LD........QQCVG...
FBpp0085923  ...................------...----------......-----........--........--........-----...
FBpp0079893  ...................------...----------......-----........--........--........-----...
FBpp0075683  ...................LVIQYA...SQGRYEVAVP......LCKQA........LEdlertsghDH........PDVAT...
FBpp0077614  ...................AATAMR...LLDRKVDAEM......WYRKA........VA........LR........PGDA-...
FBpp0086749  ...................------...SFGTFKTCKA......VYERI........ID........LK........ICTPQ...
FBpp0073411  ...................RGNNFY...KASRFTEAET......CYREAvgiveqlmLK........EK........PHDEEwqe
FBpp0070908  ...................LFHSYL...AQKRFKEANA......LCNWT........IR........LF........QNSPR...
FBpp0085842  ...................------...----------......-----........--........--........-----...
FBpp0077718  ...................QARIHQ...AMEQQEDALQ......LYRLA........AK........LH........PINVE...
FBpp0296980  ...................IGDILI...RTGSHEEAIK......LYQRQ........LA........LA........RAAGDrsm
FBpp0076600  ...................MAQICM...RTERNKLAVS......ALRRA........LK........LN........PFMWH...
FBpp0086749  ...................FAKFYE...ANGQVEDARV......VFERG........TE........VE........YVKVEdla
FBpp0085479  ...................DGNFYM...KHKKFRMAIY......SFTEG........IK........TK........TDNPDvla
FBpp0112016  ...................------...----------......-----........--........--........-----...
FBpp0079665  ...................------...-------ALN......FLQKS........IE........AD........PKSGQ...
FBpp0084076  ...................------...----------......-----........--........--........-----...
FBpp0111406  ...................LGNAEY...RKGNYEAAMK......VYTEA........IE........NI........RDSHI...
FBpp0074918  ...................LAKALI...KLGDKQRAHR......VLGEA........LK........CN........YSNWK...
FBpp0082818  ...................------...----------......-----........--........--........-----...
FBpp0074480  ...................FAMSYH...LLGDYDMANS......ILETF........SQ........SQ........TSIEA...
FBpp0082819  ...................------...----------......-----........--........--........PGSLR...
FBpp0085279  ...................LGLVAL...AQNDYELAEE......RFELLkeqlm...LP........SS........VQHSH...
FBpp0081805  ...................------...----------......-----........--........--........-----...
FBpp0100023  ...................------...----------......-----........--........--........-----...
FBpp0071879  ...................MGDCFK...GLSLDKFATF......NYNMI........LA........RQ........SKFTN...
FBpp0084559  ...................------...----------......-----........--........--........-----...
FBpp0075591  ...................------...----------......-----........--........--........-----...
FBpp0076526  ...................IAKR--...----------......-----........LK........NQ........VEEQR...
FBpp0079851  ...................------...----------......-----........--........--........-----...
FBpp0072146  ...................------...----------......-----........--........--........-----...
FBpp0296980  ...................------...----------......-----........--........--........-----...
FBpp0083238  ...................------...----------......-----........--........--........-----...
FBpp0111383  ...................------...----------......-----........--........--........-----...
FBpp0071560  ...................------...----------......-----........--........VN........QRNAK...
FBpp0080424  ...................------...----------......-----........--........--........-----...
FBpp0071879  ...................------...----------......-----........--........--........-----...
FBpp0292775  ...................------...-TRHLERALG......ICSE-........--........--........-KGVP...
FBpp0077934  ...................------...----------......-----........--........--........-----...
FBpp0087646  ...................------...--GHLETATK......ACKMA........IK........EC........SNRWQ...
FBpp0079665  ...................------...----------......-----........--........--........-HYVN...
FBpp0086749  ...................------...------EVNS......AFERA........LV........FM........HKMPR...
FBpp0082652  ...................------...----------......-----........--........--........-----...
FBpp0077619  ...................-----F...QRGNLEEAAL......YYESA........LT........LP........PPEVNerd
FBpp0086164  ...................------...----------......-----........--........--........----E...
FBpp0087232  ...................------...----------......-----........--........--........-----...
FBpp0072561  ...................------...-QTKRDMAKT......HLKKV........TE........QF........PEDIE...
FBpp0088148  ...................------...----------......-----........--........--........-----...
FBpp0075787  ...................------...----------......-----........--........--........-----...
FBpp0083319  ...................KVVCLV...QLSKFEEAYK......FIEK-........--........--........NRLSS...
FBpp0076499  ...................------...----------......-----........--........--........-----...
FBpp0290580  ...................------...----------......-----........--........--........GGTAD...
FBpp0080720  ...................------...----------......-----........--........--........-----...
FBpp0086164  ...................VARYFH...VLEK------......-----........--........--........-----...
FBpp0080741  ...................------...----------......-----........-E........--........-----...
FBpp0087297  ...................------...----------......-----........--........--........-----...
FBpp0070720  ...................------...----------......-----........--........--........-----...
FBpp0086683  ...................------...----------......-----........--........--........-----...
FBpp0289328  ...................------...----------......-----........--........--........-----...
FBpp0070667  ...................SSYYWR...MRGNAREALP......CARLA........AL........LA........PPIFKdi.
FBpp0082624  ...................------...----------......-----........--........--........-----...
FBpp0081552  ...................------...----------......-----........--........--........-----...
FBpp0086749  ...................------...---------E......IYEKA........IE........SL........PEQNMrh.
FBpp0087646  ...................------...----------......-----........--........--........-----...
FBpp0071879  ...................LAKIYLeykCPEKIDKAIE......MLVKV........VE........SA........SYHQNtn.
FBpp0080894  ...................------...ALNLNQAAEQ......MLVQA........IR........LV........PMLWS...
FBpp0070906  ...................------...----------......-----........--........--........-----...
FBpp0087646  ...................KALDLF...AEGQVVASRQ......LALQA........QK........SQ........PAYKV...
FBpp0082112  ...................------...----------......-----........--........--........-----...
FBpp0293629  ...................LSLTYL...MVNNLQQVEK......VAVET........LK........LW........PNNAV...
FBpp0076526  ...................------...----------......-----........--........--........-----...
FBpp0085279  ...................-ALVYL...RQNDVHQAIE......TLQMY........DR........KS........EGSMTas.
FBpp0074835  ...................------...----------......-----........--........--........-----...
FBpp0078887  ...................------...----------......-----........--........--........-----...
FBpp0290580  ...................------...----------......-----........--........--........-----...
FBpp0085047  ...................------...----------......-----........--........--........-----...
FBpp0296980  ...................---ELL...QATQYSAAVT......VLEAA........LR........IG........SCSLKlrg
FBpp0086380  ...................ISLILH...ALGEYELSLR......FIEHA........LK........LN........LKYFG...
FBpp0083435  ...................------...----------......-----........--........--........-----...
FBpp0078891  ...................QAWVAL...AQGT------......-----........--........--........-----...
FBpp0082419  ...................------...----------......-----........--........--........-----...
FBpp0086749  ...................------...----------......VYERA........LK........EL........PGSYK...
FBpp0078027  ...................WGTYYS...RRRRENLGMY......YFDKA........LK........LG........PADFT...
FBpp0088148  ...................------...----------......-----........--........--........-----...
FBpp0290863  ...................------...----------......-----........--........--........-----...
FBpp0080720  ...................YGLTKN...WFGQ------......-----........--........--........-----...
FBpp0083319  dwykknevssgdlsdmwrqAAEFHL...RGGASETAAS......SLEEL........LK........LN........PND--...
FBpp0071288  ...................------...----------......-----........--........--........-----...
FBpp0081398  ...................LANIEF...ENGILEAARE......DYEKA........LK........IH........GELPT...
FBpp0085016  ...................------...----------......-----........--........--........-----...
FBpp0293235  ...................------...----------......-----........--........--........-----...
FBpp0290580  ...................LCVSYI...MTFQNEEAEE......LMRK-........--........--........-----...
FBpp0085012  ...................------...----------......-----........--........--........-----...
FBpp0086380  ...................-GQAKI...QQGLFKEGYE......LISGA........LN........LL........NNVFG...
FBpp0071879  ...................SAHIAL...VSGQYRLAIQ......TYERC........LKdh......LP........KNRVD...
FBpp0076961  ...................WGQYFA...RMRKNTFAQK......YFDKC........IT........EN........ESTDHk..
FBpp0075717  ...................------...----------......-----........--........--........-----...
FBpp0080267  ...................-----R...KERHPLKASD......LFTEA........IF........LA........PARNTlaa
FBpp0070908  ...................------...-TTKKSEAVL......AYKEV........IR........EC........PMALQ...
FBpp0085033  ...................LAEAQI...KDQNYSEALP......LLHNC........LK........LQ........PHDAR...
FBpp0082507  ...................------...----------......-----........--........--........-----...
FBpp0292775  ...................VAVLAI...ELGMIEEAKD......LYRRC........KR........FD........-----...
FBpp0085676  ...................WGTYYS...RRRRENFALH......YLNKA........LA........LE........PTDHM...
FBpp0087091  ...................------...----------......-----........--........--........-----...
FBpp0082624  ...................------...----------......-----........--........--........VNDDV...
FBpp0070431  ...................------...----------......-----........--........--........-----...
FBpp0075442  ...................------...----------......-----........--........--........-----...
FBpp0070906  ...................------...----------......-----........--........--........-----...
FBpp0089265  ...................------...----------......-----........--........--........-----...
FBpp0078634  ...................------...----------......-----........--........--........-----...
FBpp0075754  ...................------...----------......-----........--........--........-----...
FBpp0087625  ...................------...-------ACR......LYSEA........VF........EA........ENAVEels
FBpp0071288  ...................------...----------......-YREA........LA........KF........NHDRR...
FBpp0110159  ...................------...----------......-----........--........--........-----...
FBpp0072679  ...................LAEMLA...SVGMCSEAVQ......-----........--........--........-----...
FBpp0082624  ...................------...----------......-----........--........--........-----...
FBpp0084254  ...................------...----------......-----........--........--........-----...
FBpp0085032  ...................------...----------......-----........--........--........-----...


                                                                                                    
                                                                                                    
d1w3ba_        ........AYINL........................................................................
FBpp0112455  ........VLNRN........................................................................
FBpp0070351  ........TWNRL........................................................................
FBpp0070402  ........NWIKF........................................................................
FBpp0080138  ........-----........................................................................
FBpp0074609  ........-----........................................................................
FBpp0084171  ........-----........................................................................
FBpp0085420  ........AHSNL........................................................................
FBpp0085420  ........GYINL........................................................................
FBpp0077790  ........FYNNI........................................................................
FBpp0082545  ........AWANI........................................................................
FBpp0084691  ........VALQM........................................................................
FBpp0072096  ........YANKS........................................................................
FBpp0071560  ........ALFNL........................................................................
FBpp0077790  ........LYSNR........................................................................
FBpp0076600  ........SYTLL........................................................................
FBpp0271716  ........-----........................................................................
FBpp0077790  ........LYSNR........................................................................
FBpp0290896  ........AYVTY........................................................................
FBpp0081673  ........-----........................................................................
FBpp0077614  ........AYLNL........................................................................
FBpp0084691  ........LWIHY........................................................................
FBpp0296980  ........LYSNR........................................................................
FBpp0080535  ........-----........................................................................
FBpp0296980  ........THGNL........................................................................
FBpp0072164  ........YHINR........................................................................
FBpp0084016  ........-----........................................................................
FBpp0296980  ........-----........................................................................
FBpp0296980  .....esdAMCAL........................................................................
FBpp0080894  ........AWYGL........................................................................
FBpp0081606  ........-----........................................................................
FBpp0084559  .....errANSNL........................................................................
FBpp0075683  ........QLNNL........................................................................
FBpp0081284  ........-----........................................................................
FBpp0079468  evkkikvaTHSNI........................................................................
FBpp0087297  ........LWNNI........................................................................
FBpp0074835  ........-----........................................................................
FBpp0079893  ........LIVHQ........................................................................
FBpp0082765  ........-----........................................................................
FBpp0079617  ........YFTNR........................................................................
FBpp0084440  ........-----........................................................................
FBpp0080424  ........-----........................................................................
FBpp0085344  ........----Vwrdvyeaqlageeekhsdtksgvhlahssqmsdkdsnsvyaaslaavsrveqalseaasslssftqrpgprr
FBpp0081552  ........ARIQR........................................................................
FBpp0087646  ........LQYKL........................................................................
FBpp0083769  ........VLHEL........................................................................
FBpp0070572  ........-----........................................................................
FBpp0070575  ........-----........................................................................
FBpp0074835  ........IWLAA........................................................................
FBpp0080424  .......kLLYNR........................................................................
FBpp0076113  ........AFYRR........................................................................
FBpp0072561  ........ATNGI........................................................................
FBpp0072561  ........ALIGL........................................................................
FBpp0085923  ........-----........................................................................
FBpp0079893  ........-----........................................................................
FBpp0075683  ........MLNIL........................................................................
FBpp0077614  ........-----........................................................................
FBpp0086749  ........IIINY........................................................................
FBpp0073411  .laaiktpLLLNY........................................................................
FBpp0070908  ........SFTMF........................................................................
FBpp0085842  ........-----........................................................................
FBpp0077718  ........SLASI........................................................................
FBpp0296980  .....eaaACGAL........................................................................
FBpp0076600  ........AFADLcllgqdtdaaaifqihstdvfntcqgssvnanamvlfgaeqqgqqhqerqslitnlsnvsnyilttpvdqqq
FBpp0086749  .......aVWCEW........................................................................
FBpp0085479  .......vLYNNR........................................................................
FBpp0112016  ........-----........................................................................
FBpp0079665  ........SLYLL........................................................................
FBpp0084076  ........-----........................................................................
FBpp0111406  ........LYINR........................................................................
FBpp0074918  ........VWENY........................................................................
FBpp0082818  ........-----........................................................................
FBpp0074480  ........HDYRH........................................................................
FBpp0082819  ........VMKFK........................................................................
FBpp0085279  ........VFYQL........................................................................
FBpp0081805  ........-----........................................................................
FBpp0100023  ........-----........................................................................
FBpp0071879  ........TYVSM........................................................................
FBpp0084559  ........-----........................................................................
FBpp0075591  ........-----........................................................................
FBpp0076526  ........AYATL........................................................................
FBpp0079851  ........-----........................................................................
FBpp0072146  ........--HLH........................................................................
FBpp0296980  ........-----........................................................................
FBpp0083238  ........-----........................................................................
FBpp0111383  ........-----........................................................................
FBpp0071560  ........LYNNV........................................................................
FBpp0080424  ........-----........................................................................
FBpp0071879  ........ALIGR........................................................................
FBpp0292775  ........VTEEL........................................................................
FBpp0077934  ........-----........................................................................
FBpp0087646  ........NWNLL........................................................................
FBpp0079665  ........ALCKL........................................................................
FBpp0086749  ........IWMDY........................................................................
FBpp0082652  ........-----........................................................................
FBpp0077619  ....ffevSRLRL........................................................................
FBpp0086164  ........LYMDI........................................................................
FBpp0087232  ........-----........................................................................
FBpp0072561  ........AWIEL........................................................................
FBpp0088148  ........-----........................................................................
FBpp0075787  ........-----........................................................................
FBpp0083319  ........LFFEK........................................................................
FBpp0076499  ........-----........................................................................
FBpp0290580  ........TLNDE........................................................................
FBpp0080720  ........----F........................................................................
FBpp0086164  ........-----........................................................................
FBpp0080741  ........----R........................................................................
FBpp0087297  ........-----........................................................................
FBpp0070720  ........-----........................................................................
FBpp0086683  ........-----........................................................................
FBpp0289328  ........-----........................................................................
FBpp0070667  ........PLLSL........................................................................
FBpp0082624  ........-----........................................................................
FBpp0081552  ........-----........................................................................
FBpp0086749  ........MCVKF........................................................................
FBpp0087646  ........-----........................................................................
FBpp0071879  ........SWLNL........................................................................
FBpp0080894  ........AYLEL........................................................................
FBpp0070906  ........-----........................................................................
FBpp0087646  ........TLELL........................................................................
FBpp0082112  ........-----........................................................................
FBpp0293629  ........AQLHY........................................................................
FBpp0076526  ........LYEKL........................................................................
FBpp0085279  ........ALTNL........................................................................
FBpp0074835  ........-----........................................................................
FBpp0078887  ........-----........................................................................
FBpp0290580  ........-----........................................................................
FBpp0085047  ........-----........................................................................
FBpp0296980  .......sVFSAL........................................................................
FBpp0086380  ........-----........................................................................
FBpp0083435  ........-----........................................................................
FBpp0078891  ........-----........................................................................
FBpp0082419  ........-----........................................................................
FBpp0086749  ........IWHN-........................................................................
FBpp0078027  ........TLYRR........................................................................
FBpp0088148  ........-----........................................................................
FBpp0290863  ........-----........................................................................
FBpp0080720  ........-----........................................................................
FBpp0083319  ........-----........................................................................
FBpp0071288  ........-----........................................................................
FBpp0081398  ........-----........................................................................
FBpp0085016  ........-----........................................................................
FBpp0293235  ........-----........................................................................
FBpp0290580  ........-----........................................................................
FBpp0085012  ........-----........................................................................
FBpp0086380  ........AL---........................................................................
FBpp0071879  ........VMHCL........................................................................
FBpp0076961  ........ALYLR........................................................................
FBpp0075717  ........-----........................................................................
FBpp0080267  ......alAHANR........................................................................
FBpp0070908  ........VIEALlelgvngneinslvmhaatvpdhfdwlskwikalaqmfnfkhsdasqtflmlhdnttl..............
FBpp0085033  ........-----........................................................................
FBpp0082507  ........-----........................................................................
FBpp0292775  ........---LL........................................................................
FBpp0085676  ........TLYKR........................................................................
FBpp0087091  ........-----........................................................................
FBpp0082624  ........FNYNF........................................................................
FBpp0070431  ........-----........................................................................
FBpp0075442  ........-----........................................................................
FBpp0070906  ........-----........................................................................
FBpp0089265  ........-----........................................................................
FBpp0078634  ........-----........................................................................
FBpp0075754  ........-----........................................................................
FBpp0087625  .......lAFANR........................................................................
FBpp0071288  ........LWSNW........................................................................
FBpp0110159  ........-----........................................................................
FBpp0072679  ........-----........................................................................
FBpp0082624  ........-----........................................................................
FBpp0084254  ........-----........................................................................
FBpp0085032  ........-----........................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  pwmlqieiwlll.........................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  qqinqnqnqhhnsnmvtpinnnnnnnnlnssismlrgglvqnssmlamledtpmgapqdpagqyqqnqqlydmssgtpfrkqfky
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  lsaispptpsfgimpltspctgndgsfignhtpvmnisyspmpqmlvevnqepkmmgkklkthvgglinrkegslnkpavftqag
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  nitprtpnnnnvgnngnmnvppnpnaavrrssrlfsnsysvkennkspniankfvqprspprkaksrmtkiclnneliedkshhl
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  sekrkekvetitssgannnsggrsaaeeakvllnnslnnaqtmahqlmglkkqsadglmallrglaeayqllsnfqckaaikqle
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                              210                                220               230              
                                |                                  |                 |              
d1w3ba_        .................GNVLKEA.........................RIFDR........AVAAYLRAL.SL........S..
FBpp0112455  .................ALLYFAYadfeegr..................LKYEK........VHTMYNKLL.QL........P..
FBpp0070351  .................GASLANG.........................SRSVE........AVEAYQQAL.QL........Q..
FBpp0070402  .................ARFEESH.........................GFIHG........SRRVFERAV.EFfgd.....D..
FBpp0080138  .................-------.........................-----........---------.--........-..
FBpp0074609  .................-------.........................-----........---------.--........-..
FBpp0084171  .................-------.........................-----........---------.--........-..
FBpp0085420  .................ASVLQQQ.........................GKLKE........ALMHYKEAI.RI........Q..
FBpp0085420  .................AAALVAA.........................RDMES........AVQAYITAL.QY........N..
FBpp0077790  .................AAVHFER.........................KEYEE........CIKQCEKGI.EV........G..
FBpp0082545  .................LTMLDNK.........................GLQDD........ALRISNQAL.QH........L..
FBpp0084691  .................IDLCLQR.........................PKVDEqe......VVEIMDKF-.--........-..
FBpp0072096  .................ASLYQQH.........................GSPEA........AASALDKAA.KL........T..
FBpp0071560  .................ALLLADT.........................KRPLD........AVPFLNQLI.RH........H..
FBpp0077790  .................AACYTKL.........................AAFDL........GLKDCDTCI.KL........D..
FBpp0076600  .................GHELVLT.........................EEFDK........AMDYFRAAV.VR........D..
FBpp0271716  .................-------.........................-----........---------.--........-..
FBpp0077790  .................SAAFAKA.........................GKFQE........ALEDAEKTI.QL........N..
FBpp0290896  .................GQTLARNg........................SRLAE........AESWFKRAL.QL........A..
FBpp0081673  .................-------.........................-----........---------.--........-..
FBpp0077614  .................GISFIAL.........................GKRQQ........AIEILQAGS.NL........D..
FBpp0084691  .................LMHVKSN.........................HGDDEtf......VRSQYERAV.KAcglefr..S..
FBpp0296980  .................SAALLKQ.........................GQFTA........ALQDATQAR.DL........C..
FBpp0080535  .................-------.........................-----........---------.--........-..
FBpp0296980  .................AVAYQAL.........................GAHDA........ALTHYRAHL.ATarslkd..T..
FBpp0072164  .................ALCYLKQ.........................ESFDQ........CVEDCEAAI.AL........D..
FBpp0084016  .................-------.........................-----........---------.--........-..
FBpp0296980  .................-------.........................-----........---------.--........Q..
FBpp0296980  .................GQVQQRM.........................GQHAQ........ALELHRQDL.EIctelsa..P..
FBpp0080894  .................GQAYEII.........................KMHYY........SLYYFKIAH.QL........R..
FBpp0081606  .................-------.........................-----........---------.--........-..
FBpp0084559  .................GNSHIFL.........................GQFED........AAEHYKRTL.ALavelge..R..
FBpp0075683  .................ALLCQNQ.........................GKYDE........VEKYYQRAL.DI........Y..
FBpp0081284  .................-------.........................-----........---------.--........-..
FBpp0079468  .................ALCHQKS.........................NDHFE........AKQECNEVL.AL........D..
FBpp0087297  .................GLCFFKK.........................QKFIV........AISSLRKSV.WL........S..
FBpp0074835  .................-------.........................QRKTK........SVD----AL.KK........C..
FBpp0079893  .................AIMVLQWr........................GDINL........AVQLLNKAI.EV........D..
FBpp0082765  .................-------.........................-----........---------.--........-..
FBpp0079617  .................ALCNLKL.........................KRWEL........CCQDSRRAL.DI........D..
FBpp0084440  .................-------.........................-----........---------.--........-..
FBpp0080424  .................-------.........................-----........---------.--........-..
FBpp0085344  .................ADVYLRI.........................DQPNE........ALNCIHEAS.QI........Y..
FBpp0081552  .................GVVHMKS.........................GEYEQ........AIQDFDQVL.QE........E..
FBpp0087646  .................GLHFSHV.........................KKWDS........AIQCFRIAI.KN........D..
FBpp0083769  .................GVIKYEY.........................EFFDG........AATIFQCTV.DIvkqraksnN..
FBpp0070572  .................-------.........................-----........---------.--........-..
FBpp0070575  .................-------.........................-----........---------.--........-..
FBpp0074835  .................VKLESEN.........................SEYER........ARRLLAKAR.GS........A..
FBpp0080424  .................ALVNTRI.........................GNLRE........AVADCNRVL.EL........N..
FBpp0076113  .................AQAQRGL.........................RNYEE........AINDLKTAH.NL........L..
FBpp0072561  .................GAVLAHK.........................GCVIE........ARDIFAQVR.EA........T..
FBpp0072561  .................AVLKLNQ.........................LEPES........---------.--........-..
FBpp0085923  .................-------.........................-----........---------.--........-..
FBpp0079893  .................-------.........................-----........---------.--........-..
FBpp0075683  .................ALVYRDQ.........................NKYKE........AANLLNDAL.SI........R..
FBpp0077614  .................-------.........................-----........---------.--........-..
FBpp0086749  .................GMFLEEH.........................NYFEE........AYRAYEKGI.SL........Fkw
FBpp0073411  .................AQCRLIA.........................GDFYA........VIEHCNEVL.TL........D..
FBpp0070908  .................GRTLFLFpdp......................RMRRT........ARKFAEKSL.KI........N..
FBpp0085842  .................-------.........................-----........---------.--........-..
FBpp0077718  .................AVGYFYD.........................NNPEM........ALMYYRRIL.SL........G..
FBpp0296980  .................GLAHRLM.........................RRWDK........ALGHHTQEL.TL........R..
FBpp0076600  ttipkhhlnsswvqsliGLARYEM.........................REYEA........AVA------.--........-..
FBpp0086749  .................AEMELRQ.........................QQFEA........ALKLMQRAT.AM........P..
FBpp0085479  .................SAAHFFI.........................KNYRS........SLSDAQRAL.FY........K..
FBpp0112016  .................-------.........................-----........---------.--........-..
FBpp0079665  .................GRCYAGI.........................NKVHD........AFLAYRNSV.EK........S..
FBpp0084076  .................-------.........................-----........---------.--........-..
FBpp0111406  .................ALCFIKS.........................GKFKR........GIVDCDFVLnKL........D..
FBpp0074918  .................MLVSVDT.........................SHWDD........AMRAYQRMA.EL........K..
FBpp0082818  .................----EAL.........................EQYDE........ADEVLDAII.AK........D..
FBpp0074480  .................SELLLYQnqilies..................NRLQQ........AVDHLTKYQ.GQ........I..
FBpp0082819  .................AMRYEAL.........................EQYDE........ADEVLDAII.AK........D..
FBpp0085279  .................AKLQERRles......................G---LisnftpgaALQAYLQVV.GI........Sas
FBpp0081805  .................GIEHFKN.........................GQQVE........AFQCLNKAL.NI........D..
FBpp0100023  .................-------.........................-----........---------.--........-..
FBpp0071879  .................AMGNFCL.........................EKLQN........---------.--........-..
FBpp0084559  .................-------.........................-----........---------.--........-..
FBpp0075591  .................-------.........................-----........---------.--........-..
FBpp0076526  .................GRVHLLH.........................GQSLA........---------.--........-..
FBpp0079851  .................GSVEYSR.........................GRCDE........ALKYFQELL.SVvdpmd...N..
FBpp0072146  .................GKDSVKL.........................GRYQS........AATAFERAV.SSlnycr...M..
FBpp0296980  .................-------.........................-----........---------.--........-..
FBpp0083238  .................-------.........................GNNRK........ALQESEKLL.RK........H..
FBpp0111383  .................-------.........................-----........---------.--........-..
FBpp0071560  .................GHALENE.........................GKFEE........ALLYFQQAV.RI........Q..
FBpp0080424  .................-------.........................-----........---------.--........-..
FBpp0071879  .................ACLAYNR.........................QDYIG........ALGYFKSVL.LI........Q..
FBpp0292775  .................SEMLTPEk........................GEFEE........ATR------.--........-..
FBpp0077934  .................-------.........................-----........---------.--........-..
FBpp0087646  .................GVINMNS.........................E----........---------.--........-..
FBpp0079665  .................GHLHLLL.........................GEYSE........ALSAYQKYL.RF........R..
FBpp0086749  .................GAFMTSQ.........................CKITR........TRHVFDRAL.RA........L..
FBpp0082652  .................-------.........................-----........---------.--........-..
FBpp0077619  .................GYISYEL.........................GNYNK........CIEALSFPF.AG........Q..
FBpp0086164  .................TEALMQE.........................HKYAE........AIALMSPIT.DG........Dtv
FBpp0087232  .................-------.........................-----........---------.--........-..
FBpp0072561  .................AQILEQN.........................DLQASlsaygt..ASSILRDKA.KY........Ei.
FBpp0088148  .................-QAHMDW.........................GKFRE........AIEFSHQQL.GI........S..
FBpp0075787  .................-------.........................-----........---------.--........-..
FBpp0083319  .................AYCEYQL.........................NKQQQ........ALKTIDDAG.L-........Q..
FBpp0076499  .................-------.........................-----........---------.--........-..
FBpp0290580  .................GCLLFQA.........................DQHEA........AVQRFQAAL.QV........G..
FBpp0080720  .................GQLLMKQ.........................GKYLE........AKNLFKEAF.DTlinvygavN..
FBpp0086164  .................-------.........................-----........---------.--........-..
FBpp0080741  .................AYFLMEI.........................GNFNS........AQQCLEQIK.TQilactey.Rfv
FBpp0087297  .................---DREE.........................GNHIE........ALRHLQKSA.EL........N..
FBpp0070720  .................-------.........................-----........---------.--........-..
FBpp0086683  .................-------.........................-----........------RLL.TI........N..
FBpp0289328  .................-------.........................-----........---------.--........-..
FBpp0070667  .................GTILFRM.........................GRLAD........ADLILTAAV.EH........A..
FBpp0082624  .................-------.........................--YQE........AIDVYKRVL.VD........N..
FBpp0081552  .................-------.........................-----........---------.--........-..
FBpp0086749  .................AELETKL.........................GEVDR........ARAIYAHCS.QV........C..
FBpp0087646  .................-------.........................-----........---------.--........-..
FBpp0071879  .................AFAYEQK.........................RLWAH........GVNAYQKAI.DI........-..
FBpp0080894  .................SPLIMEKkkllslqlgghwmrhffmahtylelYLNDD........GLKIYEDLQ.AS........Gf.
FBpp0070906  .................-------.........................-----........---------.--........-..
FBpp0087646  .................ARIHMEL.........................GAYKL........ALQLWQEIG.QE........N..
FBpp0082112  .................-------.........................-----........---------.--........-..
FBpp0293629  .................GLALRQFh........................ADYAK........ALPYLKYAV.ES........Gee
FBpp0076526  .................GDGCCHL.........................MNYEK........ALTYYQKML.EN........A..
FBpp0085279  .................SFIYIKM.........................-----........ASHCVNQLH.EI........Gsl
FBpp0074835  .................-------.........................-----........---------.--........-..
FBpp0078887  .................-------.........................-----........---------.--........-..
FBpp0290580  .................-------.........................-----........---------.--........-..
FBpp0085047  .................-------.........................-----........---AYDQKS.SQtdmellr.G..
FBpp0296980  .................SSAHWAL.........................NQLDQ........AIGYMQQDL.AVakslgd..T..
FBpp0086380  .................-------.........................-----........---------.--........-..
FBpp0083435  .................-------.........................-----........---------.--........-..
FBpp0078891  .................-------.........................EQMQD........AFHIYQEFC.EK........F..
FBpp0082419  .................-------.........................-----........---------.--........-..
FBpp0086749  .................-------.........................-----........---------.--........-..
FBpp0078027  .................SQSKRKN.........................AQADG........ALKDSLEAK.RLlknl....Q..
FBpp0088148  .................-------.........................-----........---------.--........-..
FBpp0290863  .................-------.........................-----........---------.--........-..
FBpp0080720  .................--LLMKQ.........................GKYLE........AKNLFK---.--........-..
FBpp0083319  .................-------.........................-----........---------.--........-..
FBpp0071288  .................-------.........................-----........---------.--........-..
FBpp0081398  .................-------.........................-----........---------.--........-..
FBpp0085016  .................-------.........................-----........---------.--........-..
FBpp0293235  .................-------.........................-----........---------.--........-..
FBpp0290580  .................-------.........................-----........---------.--........-..
FBpp0085012  .................-------.........................-----........---------.--........-..
FBpp0086380  .................-------.........................-----........---------.--........-..
FBpp0071879  .................AKALYDN.........................GDARK........AKMWLLKVR.HL........V..
FBpp0076961  .................SKFKRSV.........................ALTQD........ALEDSLRAM.EV........Rq.
FBpp0075717  .................-------.........................-----........---------.--........-..
FBpp0080267  .................SLVLFDC.........................GLYAE........SYDDCLCAL.DL........G..
FBpp0070908  .................R------.........................-----........---------.--........-..
FBpp0085033  .................-------.........................-----........---------.--........-..
FBpp0082507  .................-------.........................-----........---------.--........-..
FBpp0292775  .................NKLLQSI.........................GHLDE........AVELAEAED.RI........-..
FBpp0085676  .................CQSKRKA.........................AQMLG........ALDDSRAAA.KLarskd...G..
FBpp0087091  .................-------.........................-----........---------.--........-..
FBpp0082624  .................AQAKCAT.........................GYYKE........AEELLMQIS.DM........D..
FBpp0070431  .................--AAIEV.........................GKWSD........ALDYGQRLL.PGfrkyhgpwN..
FBpp0075442  .................-------.........................-----........---------.--........-..
FBpp0070906  .................-------.........................-----........---------.--........-..
FBpp0089265  .................-------.........................-DYYN........ALSALHRAL.DR........S..
FBpp0078634  .................-------.........................-----........---------.--........-..
FBpp0075754  .................-------.........................-----........---------.--........-..
FBpp0087625  .................GIALQEY.........................GYYRE........AYDDCSNAL.EC........G..
FBpp0071288  .................IKF-SRK.........................SNPVE........VAGIYEKML.LY........H..
FBpp0110159  .................-------.........................-----........---------.-R........G..
FBpp0072679  .................-------.........................-----........---------.--........-..
FBpp0082624  .................AFCNFHL.........................GDYQQ........ALAQYKAIQ.QG........Ss.
FBpp0084254  .................-------.........................-----........---------.--........-..
FBpp0085032  .................-------.........................-----........---------.--........-..


                              240             250        260             270                        
                                |               |          |               |                        
d1w3ba_        .P........N.HAV.VH....GN.LACVYYE.Q.GLIDLAIDTYRRAIEL......QPHF...PDA..................
FBpp0112455  .D........I.DPTlVY....VQ.YMKFARR.A.EGIKSARSIFK-----......----...---..................
FBpp0070351  .P........G.FIR.VR....YN.VGVCCMN.L.KAYKEAVEHLLTALTM......QAHT...NAArelp..............
FBpp0070402  .Y........I.EER.LF....IA.FARFEEG.Q.KEHDRARIIYKYALDH......LPKD...RTQ..................
FBpp0080138  .-........-.---.--....--.-------.-.-----VAKYYLEAFKL......NPAI...GMA..................
FBpp0074609  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0084171  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0085420  .P........T.FAD.AY....SN.MGNTLKE.L.QDVSGALQCYTRAIQI......NPAF...ADA..................
FBpp0085420  .P........D.LYC.VR....SD.LGNLLKA.L.GRLEEAKACYLKAIET......CPGF...AVA..................
FBpp0077790  .Resradfk.L.IAK.SF....AR.IGNTYRK.L.ENYKQAKVYYEKAM--......----...---..................
FBpp0082545  .P........N.DVS.IL....FI.RANVLGK.L.KHYTEAEAIYKRVIEL......EPHN...TLY..................
FBpp0084691  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0072096  .E........S.---.--....--.-------.-.KHPDMALRFYQHALEVimiedsVRQA...AEY..................
FBpp0071560  .P........S.HVK.GL....IL.LGDIYINhM.KDLDEAEKCYRSILHY......DPHN...TQG..................
FBpp0077790  .E........K.FIK.GY....IR.KGKILQG.M.QQQSKAQAAYQKALEL......DPNN...AEA..................
FBpp0076600  .P........R.HYN.AW....YG.IGTIYSK.Q.EKYELAEIHYVKALKI......NPQN...SVI..................
FBpp0271716  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0077790  .P........T.WPK.GY....SR.KGAAAAG.L.NDFMKAFEAYNEGLKY......DPTN...AIL..................
FBpp0290896  .P........L.EPS.SH....HH.YADFLEQ.Q.ERHHEALGLRLRAAAL......APQD...YTL..................
FBpp0081673  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0077614  .-........-.---.--....--.-GAAVRD.R.TAHDQA----------......---R...SSA..................
FBpp0084691  .D........K.LWD.AY....IR.W------.-.----------------......----...---..................
FBpp0296980  .P........Q.WPK.AY....FR.QGVALQC.L.GRYGEALAAFASGLAQ......EPSN...KQL..................
FBpp0080535  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0296980  .A........G.EAC.AL....LN.LGNCLSG.R.QEYEEAVPHYESYLMLaqelgdVAAE...GKA..................
FBpp0072164  .K........L.CVK.AY....YR.RMQANES.L.GNNMEALKDCTTVLAI......EPKN...IEA..................
FBpp0084016  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0296980  .V........E.EAR.AY....SN.LGSAHHQ.R.RQFTQAAACHEQVLRIaqalgdRSME...AAA..................
FBpp0296980  .A........L.QAR.AL....SN.LGSVHES.L.GQQAEALKCYERQLEL......----...---..................
FBpp0080894  .P........Y.DSR.ML....VA.LGETYEK.L.DKCENAVKCYWKAIDV......GDIE...GIA..................
FBpp0081606  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0084559  .E........V.EAQ.SC....YS.LGNTYTL.L.HEFNTAIEYHNRHLAI......AQEL...GD-..................
FBpp0075683  .E........S.---.--....--.-------.-.------------KLGPd.....DPNV...AKT..................
FBpp0081284  .-........-.-AG.SY....KD.KGNEAFK.A.SRWEEAVEHYGKAIKAgsk...HKEL...AVF..................
FBpp0079468  .K........N.NVK.AL....YR.RGQCNLT.I.NELEDALEDFQKVIQL......EPGN...KAA..................
FBpp0087297  .P........L.NYN.AL....YN.LSLIYIA.S.EQYASAFHTLAAAINL......RKDN...AEC..................
FBpp0074835  .E........H.DPH.VL....LA.VSKLFWS.E.HKFSKCRDWFNRTVKI......DPDL...GDA..................
FBpp0079893  .P........K.CEL.AY....ET.LGTVEVQ.R.AQLTRAVELFEKAL--......----...---..................
FBpp0082765  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0079617  .G........N.LLK.GH....FF.LGQGLME.I.DNFDEAIKHLQRAYDL......S---...---..................
FBpp0084440  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0080424  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0085344  .P........L.SHQ.IM....FM.RGQVHVY.L.EQWFDAKQCFLNAVAA......NPNH...TEA..................
FBpp0081552  .P........N.---.--....--.NGLVLEH.Y.SRLAPAQE--------......----...---..................
FBpp0087646  .S........R.CIS.YW....ES.LGDAYAG.R.GSYNSAIRVFQKILEL......SPEN...NYA..................
FBpp0083769  .-........-.---.--....-E.-------.-.--------------EI......SSRW...EPL..................
FBpp0070572  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0070575  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0074835  .P........T.---.--....--.-------.-.----------------......----...PRV..................
FBpp0080424  .S........Q.YLK.AL....LL.RARCYND.L.EKFEESVADYETALQL......E---...---..................
FBpp0076113  .P........E.NKQ.IL....NE.LNSTKQL.L.AQYN------------......----...---..................
FBpp0072561  .A........D.FCD.VW....LN.IAHVYVE.Q.KQYISAIQMYENCMKKfy....KHNN...VEV..................
FBpp0072561  .-........-.---.--....--.-------.-.--NKLGVQMLSKAYTI......DNAN...PMV..................
FBpp0085923  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0079893  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0075683  .G........K.---.--....--.-------.-.---------------Tlgen..HPAV...AAT..................
FBpp0077614  .-........-.--H.AH....TN.LGAILHL.L.GRTNHAAASYKAALRL......QPGD...AIT..................
FBpp0086749  .P........N.VYD.IW....NS.-------.-.--------YLTKFLER......YGGT...---..................
FBpp0073411  .P........R.NVK.AL....FR.RAKAHAG.A.WNPAQARRDFLDALAL......D---...---..................
FBpp0070908  .H........I.YTP.AV....NL.IADICQV.E.GPTKAIIKLLEKHVII......FPKV...NL-..................
FBpp0085842  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0077718  .A........Q.SPE.LY....CN.IALCCLY.G.GQIDLVLPCFQRALATatq...PGQK...SDI..................
FBpp0296980  .Qelgdls..G.ECR.AH....GH.LGAVHMA.L.CSWTNAVKCYQEQLER......AQEQ...RDA..................
FBpp0076600  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0086749  .K........R.KIA.YY....DD.TETVQA-.-.----------------......----...---..................
FBpp0085479  .P........D.YTK.AR....WR.SAQCAYE.L.ERFDLCTQMCEELLEV......DVD-...---..................
FBpp0112016  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0079665  .E........G.NAD.TW....CS.IGVLYQQ.Q.NQPTDALQAYICAVQL......DKDH...KAA..................
FBpp0084076  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0111406  .E........K.NLR.AW....MY.RAMAYKG.L.ND--------------......----...---..................
FBpp0074918  .Q........H.Y--.--....--.-------.-.----------------......----...---..................
FBpp0082818  .E........T.NAA.PR....KR.KIAILKA.R.GRRLEAIKELNEYLKK......FMSD...QEA..................
FBpp0074480  .V........D.KLA.VR....ET.MGDLYIK.L.QQQEKAVPIFESLIRR......NPEN...VLYyeqyiaarqvtdssavvs
FBpp0082819  .E........T.NAA.PR....KR.KIAILKA.R.GRRLEAIKELNEYLKK......FMSD...QEA..................
FBpp0085279  .D........I.DSR.LF....EK.VGSLYEQ.I.QDHQEANQYYNEAYRI......NMSD...IGI..................
FBpp0081805  .P........R.NVE.AL....VA.RGALYAN.R.GSFLKGLQDFEKALHL......NKYH...VNArkymget...........
FBpp0100023  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0071879  .-........-.---.-W....IA.EGNFRAA.R.KQQEKALQCFGKILDC......NPKN...LWA..................
FBpp0084559  .-........-.--A.IY....SQ.LGNAYFY.L.GDYNKAMQYHKHDLTL......AKSM...NDRlgeaks............
FBpp0075591  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0076526  .-........-.---.--....--.DSSASGS.M.EQLKLAEKNFLRSLLL......IKDL...SGQiskleqldmqarc.....
FBpp0079851  .L........L.FKL.SF....LR.LGQLALQ.R.KQYELAEKAFNICLPA......RRKN...FIA..................
FBpp0072146  .-........-.---.--....--.-------.-.----------------......----...--Andeeerkqtellttl...
FBpp0296980  .-........-.---.AL....SN.LGSVHES.L.GQQAEALKCYERQLELstd...RLAK...AMA..................
FBpp0083238  .P........N.LLC.AR....AL.KGLSLLR.L.GRYDESHGCLQTVAEE......KPTD...DST..................
FBpp0111383  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0071560  .T........D.DIG.AH....IN.VGRTFNN.L.KRYAEAEQAYVQAKAL......----...---..................
FBpp0080424  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0071879  .P........QgMAD.VW....VG.IGHCFWK.M.GELEKAQLSFQIALEH......NGQC...LNA..................
FBpp0292775  .-........-.-VH.IL....VQ.LGEFLQQ.Q.GDYHSATKKFTQ----......----...---..................
FBpp0077934  .-........-.---.--....-D.KGLIAVA.K.NDFPEAYVIFQKALHL......DTGN...TMI..................
FBpp0087646  .-........-.---.--....--.-------.N.ENLPLAQHCFIQAVVL......EKKC...YTA..................
FBpp0079665  .E........N.NYW.TNhafiYG.IGVAYFK.L.RCFKWAIKSFQELLYL......SPNFtcaNEV..................
FBpp0086749  .Pit......Q.HGR.IW....PL.YLQFVRR.F.EMPETALRVYRRYLKL......FPED...TEE..................
FBpp0082652  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0077619  .L........L.SIV.AN....YM.IGKSYYK.L.DLLDLALESFANATHM......DTHV...PNV..................
FBpp0086164  .E........C.PAF.VW....LR.QAECLRQ.L.NRTNEAIQSYEKVVQL......APFC...YDA..................
FBpp0087232  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0072561  .P........-.---.--....--.-------.-.----------------......----...AEI..................
FBpp0088148  .Eeldspn..M.RAE.TY....LN.LSRAHAS.L.GGLERSLSYARHSLYNecgt..KCRS...GLV..................
FBpp0075787  .-........-.---.--....--.DGNVLYR.K.NRFQEAAHRYQYALRK......ISGL...EQLlernaifaqlrtnl....
FBpp0083319  .P........L.PPN.LK....EL.RTQVLYR.L.ERYDECLDSYRDIIKN......TSDE...YEE..................
FBpp0076499  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0290580  .G........F.NPL.VA....YN.VALAHFQ.K.KQ--------------......----...---..................
FBpp0080720  .D........A.SVT.IL....NN.ISVAYVN.L.EKYAEARETLLEAMEL......TKEL...KDAtqegil............
FBpp0086164  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0080741  .K........L.NIK.YY....LI.QGQCSEI.F.EHVEKATSCYKRALRLsrly..T---...---..................
FBpp0087297  .P........R.NIE.TY....KE.IGRTLYI.M.GRFSQALGVFREAEQRs.....SRQD...HEI..................
FBpp0070720  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0086683  .N........P.SAL.AL....CQ.HGRALSD.L.GKYHPSRLCYIKALKK......RPRD...Q--..................
FBpp0289328  .-........-.---.--....--.-------.V.SNPINAFSLLRRTHED......LPKW...HEYfkeaigegnqsilvdlvk
FBpp0070667  .P........N.VAE.NH....VV.LASALAM.K.HDFNRSLQHFDEAERL......DPST...---..................
FBpp0082624  .K........E.YQA.IN....VY.LALCFYK.L.DYYDMSQEVLDVYLSQ......HGDS...TIAinlkacnrfrlfngrvae
FBpp0081552  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0086749  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0087646  .-........-.---.-L....SF.QGFLYAR.K.NLYRQAIEAFTRACKLcep...GADR...DKL..................
FBpp0071879  .-........-.---.-Y....LS.QGHQI--.-.----------------......---P...IEW..................
FBpp0080894  .S........K.SIY.LI....AQ.MALVYHN.K.RDVDKAIELYQALLES......DPYR...LDN..................
FBpp0070906  .-........-.---.--....--.-------.-.---------------V......NVQT...AKH..................
FBpp0087646  .D........A.---.--....--.----YAL.C.LSHEKGVSKLREAVTIlqt...LENS...EGN..................
FBpp0082112  .-........-.---.IA....NN.MGVIHLR.V.RHYAIAAKFFQNALNF......DQQL...ARNlrqstlqtmssarscei.
FBpp0293629  gT........Q.EAF.FY....LS.LGETMQR.L.SMKSEALEVYGK----......----...---..................
FBpp0076526  .Elnqesgk.S.LVP.IY....VS.LYQTYRD.N.GQFDKALEYLWKEFEL......NQ--...---..................
FBpp0085279  .K........N.NAP.GL....IN.AGIVELG.S.HNLILASERFEGALQL......QPMN...FEA..................
FBpp0074835  .-........-.---.-S....VE.LWLALAR.L.ETYENARKVLNKAREN......IPTD...RQI..................
FBpp0078887  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0290580  .-........-.---.TL....ND.EGCLLFQ.A.DQHEAAVQRFQAALQV......GGFN...PLV..................
FBpp0085047  .P........K.LAD.LC....RI.LGQVQMK.Q.RNHEGALQAYQVALKL......SPHD...PEI..................
FBpp0296980  .A........G.ECR.AH....GN.LGSAYFS.Q.GAHKEALTA-------......----...---..................
FBpp0086380  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0083435  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0078891  .K........P.TPA.LL....NG.QAVVHLG.L.ERYEEADSVLRESLLK......KHND...YDT..................
FBpp0082419  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0086749  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0078027  .R........Y.DAP.IN....LE.VCDALYE.L.NQLENAKAEL------......----...---..................
FBpp0088148  .-........-.---.--....--.-------.-.----------------......----...-AA..................
FBpp0290863  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0080720  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0083319  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0071288  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0081398  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0085016  .-........-.---.--....-E.IGVQLFD.L.GEYQRSLEWLQVAFIL......LRNS...PREekdadhylsdi.......
FBpp0293235  .-........-.---.--....--.---LYMK.V.QEYPKAIEYLNGYLRV......RDDA...VGH..................
FBpp0290580  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0085012  .-........-.---.--....--.-------.-.--------SFTK----......----...ADI..................
FBpp0086380  .-........-.---.--....--.-------.-.----------------......HQEN...GSC..................
FBpp0071879  .P........H.DPF.VI....FN.LGLAIKK.E.TE--------------......----...---..................
FBpp0076961  .A........W.DAN.VS....ME.LGDALYD.L.NRFEENKSLLHDNVRR......----...--Hagtalksfenrlvvvden
FBpp0075717  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0080267  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0070908  .-........C.NEH.LM....MA.LGKCLYY.N.GDYFQAEDIFSSTLCA......NPDN...VEA..................
FBpp0085033  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0082507  .-........V.EAR.TH....LQ.MGQILMA.YtKNIDLARQHLEKAWSIsep...LPNF...DVKfdt...............
FBpp0292775  .-........H.LKH.TY....YQ.KAQELRE.R.GDIKGALEYFEK----......----...---..................
FBpp0085676  .E........E.KAI.IN....LD.ICDVLYE.L.NQFENS----------......----...---..................
FBpp0087091  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0082624  .I........K.NQH.TY....CMiLAKCHIH.C.GHP-------------......----...---..................
FBpp0070431  .P........L.LGL.LH....MK.LGKIQLY.E.GHSKEALHHLEEA---......----...---..................
FBpp0075442  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0070906  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0089265  .PvrlmsqekG.YQY.FC....VN.LAVLHAT.F.GHRDEALAALRESIMLa.....QEHG...DKR..................
FBpp0078634  .-........-.---.--....--.-------.-.----------------......----...--Sglkplaiqdvfnppeegq
FBpp0075754  .-........C.QIS.TS....YY.VGFAYMM.M.RRYADAIRTFSDILLY......IQRT...KQ-..................
FBpp0087625  .Y........P.E--.--....--.-------.-.----------------......----...---..................
FBpp0071288  .G........D.SPD.LW....VD.AALWLYE.F.NRL-------------......----...---..................
FBpp0110159  .P........T.KAE.LF....RT.LGKVRFE.R.RNEEGALKAYQAALKH......SPHD...LEI..................
FBpp0072679  .-........-.---.--....--.-------.-.----------------......----...---..................
FBpp0082624  .T........P.DGK.LD....LN.LAVCMFY.L.GLYEEAQQLMANA---......----...---..................
FBpp0084254  .-........-.--R.LH....LL.QGVLLFH.Q.NRRDEAY---------......----...---..................
FBpp0085032  .-........-.---.--....--.-------.-.----------------......----...---..................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  iyrvfqeqypralcprrlplniangdefrvvtdeylrrglrkgipplfvnvrtlhqiperaavieelalqyfenltrsghfsred
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  mvpndvdmlsamhgiqriekiydlkiddlaqgvlqgvqynvqltyrd......................................
FBpp0070667  .....................................................................................
FBpp0082624  qeikniadngtfgadllrhnlvvfrngegalrvlpgllniipea.........................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  lkdctgfslanffmehsaqlpgfyahqqeelrradrrplwkilkerkecdvqsridrkevmlsplererrrrktkifyqnylgrs
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  qsheagpkeleslytlv....................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  adagipvepasalvwt.....................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  wtdffflktlrrhpnclldnhfgssadrtkyleyafqrlktftrmlqarrpmykeyfhrnpqiearmrdanlfriqyqtrrnmvs
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  .....................................................................................
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  ilrtikvlrgrndikrlrkfveevmgsyvviktnrlmpwkaefmnevynnlalslcegyrlpptrvtpydksamcqllnipvakp
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                       280          290             
                                                                         |            |             
d1w3ba_        ....................................................YCNLANALKE...KGSVAEA..........EDC
FBpp0112455  ....................................................----------...-------..........---
FBpp0070351  ....................................................NAAMAATFRG...QNQMSES..........I--
FBpp0070402  ....................................................ELFKAYTKHE...KKYGDRAgiedvivskrKYQ
FBpp0080138  ....................................................QNQLGTLHYG...QNHDLDS..........TYH
FBpp0074609  ....................................................----------...-------..........---
FBpp0084171  ....................................................-------HVK...ATDYMEA..........ARY
FBpp0085420  ....................................................HSNLASIHKD...SGNIPEA..........IQS
FBpp0085420  ....................................................WSNLGCVFNA...QGEIWLA..........IHH
FBpp0077790  ....................................................----------...-------..........---
FBpp0082545  ....................................................HTNLGVLYHR...WDKTQEA..........IEA
FBpp0084691  ....................................................----------...-------..........---
FBpp0072096  ....................................................ASKVSRILVK...LRRYDEA..........TNA
FBpp0071560  ....................................................LHNLCVVFVE...RKRLAKA..........AAC
FBpp0077790  ....................................................----------...-------..........---
FBpp0076600  ....................................................LVHIGAMQFY...MKKKDLS..........LQT
FBpp0271716  ....................................................----------...-------..........---
FBpp0077790  ....................................................----------...-------..........---
FBpp0290896  ....................................................QSCVADALRL...LNRLAEA..........ELW
FBpp0081673  ....................................................----------...-------..........---
FBpp0077614  ....................................................YLQLGALYVE...QGKLQRA..........LAI
FBpp0084691  ....................................................-------ENE...SKRYHRV..........VQI
FBpp0296980  ....................................................MAGL------...-------..........---
FBpp0080535  ....................................................----------...-------..........---
FBpp0296980  ....................................................CHLLGYAHFS...LGNYRAA..........VRY
FBpp0072164  ....................................................KRSLARI---...-------..........---
FBpp0084016  ....................................................----------...-------..........---
FBpp0296980  ....................................................YAGLGHAARC...AGDASAS..........KRF
FBpp0296980  ....................................................----------...-------..........---
FBpp0080894  ....................................................MYKLANLHEK...LGDHETA..........VHC
FBpp0081606  ....................................................----------...-------..........---
FBpp0084559  ....................................................----------...-------..........---
FBpp0075683  ....................................................KNNLAGCYLK...QGRYTEA..........EIL
FBpp0081284  ....................................................YKNRAAAYLK...LGKYENA..........VED
FBpp0079468  ....................................................ANQVIICKQK...LK-----..........---
FBpp0087297  ....................................................YMLLGLCLRK...LDDMENA..........FVA
FBpp0074835  ....................................................WAYFYKFELL...HGTEAQQ..........QEV
FBpp0079893  ....................................................----------...-------..........---
FBpp0082765  ....................................................----------...-------..........---
FBpp0079617  ....................................................----------...-------..........---
FBpp0084440  ....................................................----------...-------..........---
FBpp0080424  ....................................................----------...-------..........---
FBpp0085344  ....................................................LRALGEAHLV...LGEPRLA..........EKM
FBpp0081552  ....................................................QWVLVQQLIQ...YSDHQNA..........IPM
FBpp0087646  ....................................................LLQIASVKTT...IRMYTES..........IED
FBpp0083769  ....................................................FINLGHSLRK...VHKYEEA..........LYN
FBpp0070572  ....................................................----------...-------..........---
FBpp0070575  ....................................................----------...-------..........---
FBpp0074835  ....................................................MMKSARLEWA...LEKFDEA..........LRL
FBpp0080424  ....................................................----------...-------..........---
FBpp0076113  ....................................................----------...-------..........---
FBpp0072561  ....................................................MQYLARAYLR...ANKLVDA..........KAV
FBpp0072561  ....................................................LNHLANHFFF...KKDYQKV..........HHL
FBpp0085923  ....................................................----------...-------..........---
FBpp0079893  ....................................................----GNNCYR...NGKYDEA..........IKF
FBpp0075683  ....................................................LNNLAVLYGK...RGKYKDA..........EPL
FBpp0077614  ....................................................LGNL------...-------..........---
FBpp0086749  ....................................................----------...--KLERA..........RDL
FBpp0073411  ....................................................----------...-------..........---
FBpp0070908  ....................................................LNHLGDIMRK...QKEPVKA..........MEY
FBpp0085842  ....................................................----------...-------..........---
FBpp0077718  ....................................................WYNLSFVAVT...SGDFNLA..........KRC
FBpp0296980  ....................................................----------...-------..........---
FBpp0076600  ....................................................----------...-------..........---
FBpp0086749  ....................................................----------...-------..........---
FBpp0085479  ....................................................----------...-------..........---
FBpp0112016  ....................................................----------...-------..........---
FBpp0079665  ....................................................WTNLGILYES...CGQLRDA..........YAC
FBpp0084076  ....................................................----------...-------..........---
FBpp0111406  ....................................................----------...-------..........---
FBpp0074918  ....................................................----------...-------..........---
FBpp0082818  ....................................................WHELCNMYLA...EGEFGKA..........AFC
FBpp0074480  ....................................................ALFLAQHYDY...MRDTDRA..........LEY
FBpp0082819  ....................................................WHELCNMYLA...EGEFGKA..........AFC
FBpp0085279  ....................................................ASSIGSYYIK...LQATERA..........LFY
FBpp0081805  ....................................................LVALGRSYEE...ENRIAEA..........VKA
FBpp0100023  ....................................................-LMLGLMYLF...LKDYNQS..........ENW
FBpp0071879  ....................................................ANGIGAVLSS...CNNLSAG..........GAI
FBpp0084559  ....................................................SGNLGNTLKV...MGRFDEA..........AIC
FBpp0075591  ....................................................----------...-------..........---
FBpp0076526  ....................................................YLNIGVVKEH...MEAFQES..........IEY
FBpp0079851  ....................................................NYGMGLTLYH...LNRLEEA..........IPY
FBpp0072146  ....................................................NQNLMIVYNK...MNKPKRA..........CIM
FBpp0296980  ....................................................CLALGRVHHQ...LEQHNQA..........VDY
FBpp0083238  ....................................................LQVLSFCYRE...MEQLDKI..........VEL
FBpp0111383  ....................................................----------...-------..........---
FBpp0071560  ....................................................----------...-------..........---
FBpp0080424  ....................................................----------...-------..........---
FBpp0071879  ....................................................ALALALVKFEhndEQSYQDG..........KML
FBpp0292775  ....................................................----------...-------..........---
FBpp0077934  ....................................................LNNMGVCLLY...AGKLKDA..........INL
FBpp0087646  ....................................................WTNLGVLYIK...LNEVRLA..........NEA
FBpp0079665  ....................................................HLRLGLMLKH...CGEFHIA..........LKH
FBpp0086749  ....................................................YV---DYLQE...ADRLD--..........---
FBpp0082652  ....................................................----------...-------..........---
FBpp0077619  ....................................................WGFLALINLR...LGENYKA..........IEC
FBpp0086164  ....................................................RFTLSALLKQ...QGRHEEA..........VQA
FBpp0087232  ....................................................----------...-------..........---
FBpp0072561  ....................................................QNNVASLHYR...LGNLKMA..........KLT
FBpp0088148  ....................................................HLTVARVYLE...MGGFSRA..........LEG
FBpp0075787  ....................................................LLNLSRCKRK...LNELDAS..........IDL
FBpp0083319  ....................................................----------...-------..........---
FBpp0076499  ....................................................----------...-------..........---
FBpp0290580  ....................................................----------...-------..........---
FBpp0080720  ....................................................QANLGLVYLR...EGLMSQA..........ENA
FBpp0086164  ....................................................----------...-------..........---
FBpp0080741  ....................................................----------...-------..........---
FBpp0087297  ....................................................YHYLGELLYR...AATTQSQ..........KDV
FBpp0070720  ....................................................----------...-------..........---
FBpp0086683  ....................................................----------...-------..........---
FBpp0289328  ....................................................LIAMGNSMYQ...QSDYQTA..........AKW
FBpp0070667  ....................................................----------...-------..........---
FBpp0082624  ....................................................RLNLAIYYLK...QGDVQEA..........HAL
FBpp0081552  ....................................................----------...-------..........---
FBpp0086749  ....................................................----------...-------..........---
FBpp0087646  ....................................................YTNLGYLYLK...IDQPEQA..........AHA
FBpp0071879  ....................................................LNNLASSQLM...AKMPEKA..........LNT
FBpp0080894  ....................................................VDTYSNLLFV...KEMKTEM..........AQL
FBpp0070906  ....................................................YGNLGRLYQT...MNRFEEA..........ERM
FBpp0087646  ....................................................IKSLARCYFK...LG-----..........---
FBpp0082112  ....................................................LYNLGVAMLH...LRRPKEA..........FQC
FBpp0293629  ....................................................----------...-------..........---
FBpp0076526  ....................................................----------...-------..........---
FBpp0085279  ....................................................RYNLGLVALA...QNDYELA..........E--
FBpp0074835  ....................................................WTTAAKLEEA...NGNIHMV..........EKI
FBpp0078887  ....................................................------DLYL...AGKDDKA..........ARL
FBpp0290580  ....................................................AYNVALAHFQ...KKQRAQA..........LDY
FBpp0085047  ....................................................Y---------...-------..........---
FBpp0296980  ....................................................----------...-------..........---
FBpp0086380  ....................................................----------...-------..........---
FBpp0083435  ....................................................----------...-------..........---
FBpp0078891  ....................................................LINLMVHAHL...TGKPTEA..........IT-
FBpp0082419  ....................................................----------...-------..........---
FBpp0086749  ....................................................----------...-------..........---
FBpp0078027  ....................................................----------...-------..........---
FBpp0088148  ....................................................LLRMAVSLRK...QGELGDA..........QDY
FBpp0290863  ....................................................----------...-------..........---
FBpp0080720  ....................................................----------...-------..........---
FBpp0083319  ....................................................----------...-------..........---
FBpp0071288  ....................................................----------...-------..........---
FBpp0081398  ....................................................----------...-------..........---
FBpp0085016  ....................................................REYASMANFE...LGNPKKA..........ARL
FBpp0293235  ....................................................-NMIATCYSR...LN-----..........---
FBpp0290580  ....................................................----------...-------..........---
FBpp0085012  ....................................................LEYLAFSTYK...EGNIESA..........LTM
FBpp0086380  ....................................................LRMLARLSYL...LGDAQDA..........LAI
FBpp0071879  ....................................................----------...-------..........---
FBpp0076961  lehtelifgdrstysyagadkqstdrladqnqieylekrllfarlpiersylLHELADRHMQ...KNHFVQS..........LSY
FBpp0075717  ....................................................----------...-------..........---
FBpp0080267  ....................................................----------...-------..........---
FBpp0070908  ....................................................IG--------...-------..........---
FBpp0085033  ....................................................----------...-------..........---
FBpp0082507  ....................................................ASLLAQLHLQ...TD-----..........---
FBpp0292775  ....................................................----------...-------..........---
FBpp0085676  ....................................................----------...-------..........---
FBpp0087091  ....................................................----------...-------..........---
FBpp0082624  ....................................................----------...-------..........---
FBpp0070431  ....................................................----------...-------..........---
FBpp0075442  ....................................................----------...-------..........---
FBpp0070906  ....................................................----------...-------..........---
FBpp0089265  ....................................................SLNLANTW--...-------..........---
FBpp0078634  ....................................................SFYMAQMYGH...LGEPEKS..........AKC
FBpp0075754  ....................................................----------...-------..........---
FBpp0087625  ....................................................----------...-------..........---
FBpp0071288  ....................................................----------...-------..........---
FBpp0110159  ....................................................----------...-------..........---
FBpp0072679  ....................................................----------...-------..........---
FBpp0082624  ....................................................----------...-------..........---
FBpp0084254  ....................................................----------...-------..........---
FBpp0085032  ....................................................----------...-------..........---


                     300                      310                 320       330                340  
                       |                        |                   |         |                  |  
d1w3ba_        YN..TALRL......CPTH.AD........SLNNLANIK......R.EQG...NIEEAVRLYRKALEV.FPEF........AAAH
FBpp0112455  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070351  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070402  YE..QEVAA......NPTN.YD........AWFDYLRLI......E.AEG...DRDQIRETYERAISNvPPAN........EKNF
FBpp0080138  Y-..-----......----.--........---------......-.---...---------------.----........----
FBpp0074609  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0084171  YQ..RAQEL......VPGN.GA........PFNQLAVIS......I.YHH...KRFDAVYYYVRSL--.----........----
FBpp0085420  YR..TALKL......KPDF.PD........AYCNLAHCL......Q.IVC...DWTDYDIRMKKLV--.----........----
FBpp0085420  FE..KAVTL......DPNF.LD........AYINLGNVL......K.EAR...IFDRAVAAYLRALNL.SPNN........AVVH
FBpp0077790  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082545  YR..TAISI......SAAR.ATt.......ARENLSKLL......K.RLE...---------------.----........----
FBpp0084691  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0072096  LK..KEISL......NQQ-.--........---------......-.---...---------------.----........----
FBpp0071560  LQ..YAQRL......APA-.--........---------......-.---...---------------.----........----
FBpp0077790  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0076600  LN..TAATL......DPKN.PL........TRFHRGSIY......F.SLG...KYQEALRELEELKEV.VPKE........SVVF
FBpp0271716  --..-----......----.--........---------......-.-TN...DVRKGIMILEELART.HPDG........RRDY
FBpp0077790  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0290896  YR..KAVTL......QPMA.AH........AHANLGAIL......Q.MRG...LRKEAVACYHKALEL.QPGH........AISR
FBpp0081673  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0077614  YR..EALSS......LPGL.PQqrei....LYQRIGDVL......G.RLQ...QWDEAERHHRAALEL.QPNQ........VAAH
FBpp0084691  YD..RLLAI......----.--........---------......-.---...---------------.----........----
FBpp0296980  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080535  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0296980  YD..QDLALakdaqhRPNM.GR........AYCNLGLAH......L.ALG...HTAAALE--------.----........----
FBpp0072164  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0084016  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0296980  HE..RQLAMalaardKLG-.-Egr......ACSNLGIVY......Q.MLG...SHDAALKLHQ-----.----........----
FBpp0296980  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080894  Y-..-----......----.--........---------......-.---...---------------.----........----
FBpp0081606  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0084559  --..-----......RIGE.AR........ACWSLGNAH......S.AIG...GHERALKYAEQHLQL.AK--........----
FBpp0075683  YK..QVLT-......----.--........---------......-.---...---------------.----........----
FBpp0081284  CT..ESLKA......APGD.PK........ALFRRAQAY......E.ALE...KFEEAYKDATALFKA.DPGN........KTV-
FBpp0079468  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0087297  LE..RA---......----.--........---------......-.---...---------------.----........----
FBpp0074835  LD..RCISA......EPTH.GE........SWC------......-.---...---------------.----........----
FBpp0079893  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082765  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0079617  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0084440  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080424  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085344  LK..DAAKL......DPSC.PK........IWFALGKVM......E.ILG...DFHASADCFATSLQL.EPSC........----
FBpp0081552  IT..QLLEI......SPWA.VP........FRQARSDAY......I.AIN...DPLLAIADLRQVNRL.TQDS........TEGH
FBpp0087646  YD..TLLQR......NPTY.--........---------......-.---...---------------.----........----
FBpp0083769  FQ..YALLL......KPQS.PT........TYTSIGFIH......A.LLG...NLDPAIEAFHKSLAL.NR--........----
FBpp0070572  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070575  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0074835  LE..EAVEV......FPDF.PK........L--------......-.---...---------------.----........----
FBpp0080424  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0076113  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0072561  LL..KARRV......APQD.TV........LLFNIAVVL......-.---...---------------.----........----
FBpp0072561  AL..HAFHNten...EAMR.AE........SCYQLARSF......H.AQS...DYDQAFQYYYQSTQI.APANf.......VLPH
FBpp0085923  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0079893  YD..KAIDK......CPKE.HRtdmai...FYQNRAASY......E.MLK...KWSNVKEDCTASLEF.NPRY........AKAY
FBpp0075683  CK..RALEI......----.--........---------......-.---...---------------.----........----
FBpp0077614  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086749  FE..QCLDQc.....PPEH.AKy.......FYLLYAKLE......E.EHG...LARHAMSVYDRATSA.----........----
FBpp0073411  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070908  YY..KALRQ......DPK-.--........---------......-.---...---------------.----........----
FBpp0085842  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0077718  LQ..LCLTS......DAQN.GA........ALNNLAVLA......A.QSG...DILGAKSYLNAAKDV.MPDA........AEV-
FBpp0296980  --..-----......-AVE.AQ........AHGNLGIAR......L.NMA...HYEAAIGCL------.----........----
FBpp0076600  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086749  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085479  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0112016  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0079665  YL..N----......----.--........---------......-.---...---------------.----........----
FBpp0084076  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0111406  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0074918  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082818  ME..EVLLH......NPHS.HL........IHQRLAEIR......Y.TMGgveNMESARTYYSQALKL.NPHN........LRAL
FBpp0074480  IN..VAIDH......TPTL.IE........LLITKGRIF......K.HAG...DPVEAYVWLEEAQSM.DTAD........----
FBpp0082819  ME..EVLLH......NPHS.HL........IHQRLAEIR......Y.TMGgveNMESARTYYSQALKL.NPHN........LRAL
FBpp0085279  YE..RAVLA......DPND.PN........LMLRIASCF......-.---...---------------.----........----
FBpp0081805  YS..DCLNL......LPLH.EE........ARQSL----......-.---...---------------.----........----
FBpp0100023  LE..LALYHyddnv.SPEV.LKiklwnypnLLESLVEAN......K.GLG...HYFEAKKYANELLSI.NPNH........TYM-
FBpp0071879  FK..QIIEC......GNKC.IP........AIINSAHIA......L.VSG...QYRLAIQTYERCL--.----........----
FBpp0084559  CE..RHLTL......ARQL.GDrlsegr..ALYNLGNVY......H.AK-...---------------.----........----
FBpp0075591  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0076526  ID..KAIKIs.....KTHE.LW........DLTHLCYISmsllyiC.KKN...DATAALRFCNMALEV.A---........----
FBpp0079851  LS..RCTEV......DIFI.PD........VWGYLATIN......L.RLS...RNKTALEC-------.----........----
FBpp0072146  MKalRHLTM......GNPS.CK........ALFQEGRAL......A.ALG...EYNLARNAYLQAQAK.QPAN........KEIS
FBpp0296980  LR..QGLASaqttgkSEEE.AK........IRHQLGLAL......R.SSG...DAEGAHIQLETAAQL.LESV........----
FBpp0083238  YQ..HAVKQ......NPGN.EE........LLAHLFISH......V.RVE...DYKAQQAVALQLYKA.QPKN........AYY-
FBpp0111383  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0071560  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080424  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0071879  LT..AAYKE......NNKN.PD........LLSILAGMY......Y.ADG...NHKLVWSFAGNAIKF.TANKhie.....SRNY
FBpp0292775  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0077934  YE..RAINL......NPQK.SLnes.....LLVNLSTLY......E.LES...NNSKA----------.----........----
FBpp0087646  FT..RAQQS......SPVY.AN........AWIGQAMVA......E.LIG...DREEAFDLFRHCQQF.D---........----
FBpp0079665  LQ..LALLYt.....YPST.FSelq.....VKFQIAHLY......E.VQN...KHK------------.----........----
FBpp0086749  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082652  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0077619  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086164  LE..Q----......----.--........---------......-.---...---------------.----........----
FBpp0087232  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0072561  LE..SALKH......A---.--........---------......-.---...---------------.----........----
FBpp0088148  LQ..GAYKIataig.DPSLeLQ........VYVALSELF......G.RLQ...DNDKSATYAS-----.----........----
FBpp0075787  AT..QAIAQ......KPHS.YE........GYYARAKAR......M.ELG...ALNEALVDANEAMQ-.----........----
FBpp0083319  --..-----......----.-E........RRTNLSAVA......A.---...--NLAVDQTKEVPEV.PEDT........YEQY
FBpp0076499  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0290580  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080720  CR..LAWKL......----.--........---------......-.---...---------------.----........----
FBpp0086164  --..-----......----.--........---------......-.---...-HSLAL---------.----........----
FBpp0080741  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0087297  --..-----......----.--........---------......-.ASQ...QQDEARTYFELA---.----........----
FBpp0070720  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086683  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0289328  YR..IACKR......ELEN.PE........QL-------......-.---...---------------.----........----
FBpp0070667  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082624  MK..ELQPT......SP--.--........---------......-.---...---------------.----........----
FBpp0081552  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086749  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0087646  LN..TVAH-......--AT.FK........PIIGLAQAY......Y.LAG...QLQESYSIYNS----.----........----
FBpp0071879  LD..DAL--......----.--........---------......-.---...---------------.----........----
FBpp0080894  AH..KAVSI......NKYR.PE........TCCVIGNYY......S.IRC...DHQVAISYFQRALKL.NPKY........LAA-
FBpp0070906  HK..KAIKI......KSEL.LGhfdyevglSIGHLASLY......NyQMK...KYRDAEQLYMRSIDI.SLRLfgnsysglEYDY
FBpp0087646  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082112  FL..VPVKQ......FHSN.PR........LWL------......-.---...---------------.----........----
FBpp0293629  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0076526  --..-----......----.--........---------......-.--D...APSEAFTTLCTIAEI.CEQQ........SHPF
FBpp0085279  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0074835  ID..R----......----.--........---------......-.---...---------------.----........----
FBpp0078887  FE..HALAL......APRH.PE........VLLRYGEFLe.....H.NQR...NIVLADQYYFQALTI.SPSN........SEA-
FBpp0290580  TS..EIVE-......----.--........---------......-.---...---------------.----........----
FBpp0085047  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0296980  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086380  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0083435  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0078891  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082419  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0086749  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0078027  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0088148  CK..EATKLslisgdQATY.TR........SIRVMGDIY......R.NKM...DMDRAFRQYEQAMGT.----........----
FBpp0290863  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080720  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0083319  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0071288  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0081398  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085016  LS..QILES......QPTH.--........---------......-.---...---------------.----........----
FBpp0293235  --..-----......----.--........---------......-.-PP...DVTEALQHYQRSIQI.DPRQ........SEV-
FBpp0290580  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085012  TN..ELLQL......LPHH.ER........---------......-.---...---------------.----........----
FBpp0086380  QQ..RAVI-......----.--........---------......-.---...---------------.----........----
FBpp0071879  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0076961  AQ..KAIE-......----.--........---------......-.---...---------------.----........----
FBpp0075717  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0080267  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070908  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085033  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082507  --..-----......----.--........---------......-.--R...NSHQAKAMLRRAVEL.SQNN........VYWH
FBpp0292775  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085676  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0087091  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082624  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070431  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0075442  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0070906  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0089265  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0078634  CH..RTLHR......----.--........---------......-.---...---------------.----........----
FBpp0075754  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0087625  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0071288  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0110159  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0072679  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0082624  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0084254  --..-----......----.--........---------......-.---...---------------.----........----
FBpp0085032  --..-----......----.--........---------......-.---...---------------.----........----


                                                                                                    
                                                                                                    
d1w3ba_        .SNL................................................................................A
FBpp0112455  .---................................................................................-
FBpp0070351  .---................................................................................-
FBpp0070402  .WRRyiylwinyalyeeleaedaertrqiyktcleliphkqftfsklwllyaqfeirckelqrarkalglaigmcprdklfrgyI
FBpp0080138  .---................................................................................-
FBpp0074609  .---................................................................................-
FBpp0084171  .---................................................................................-
FBpp0085420  .---................................................................................-
FBpp0085420  .GNL................................................................................A
FBpp0077790  .---................................................................................-
FBpp0082545  .---................................................................................-
FBpp0084691  .---................................................................................-
FBpp0072096  .---................................................................................-
FBpp0071560  .---................................................................................-
FBpp0077790  .---................................................................................-
FBpp0076600  .YLI................................................................................G
FBpp0271716  iYYL................................................................................A
FBpp0077790  .---................................................................................-
FBpp0290896  .ANL................................................................................-
FBpp0081673  .---................................................................................-
FBpp0077614  .---................................................................................-
FBpp0084691  .---................................................................................-
FBpp0296980  .---................................................................................-
FBpp0080535  .---................................................................................-
FBpp0296980  .---................................................................................-
FBpp0072164  .---................................................................................-
FBpp0084016  .---................................................................................-
FBpp0296980  .---................................................................................-
FBpp0296980  .---................................................................................-
FBpp0080894  .---................................................................................-
FBpp0081606  .---................................................................................-
FBpp0084559  .---................................................................................-
FBpp0075683  .---................................................................................-
FBpp0081284  .---................................................................................-
FBpp0079468  .---................................................................................-
FBpp0087297  .---................................................................................-
FBpp0074835  .---................................................................................-
FBpp0079893  .---................................................................................-
FBpp0082765  .---................................................................................-
FBpp0079617  .---................................................................................-
FBpp0084440  .---................................................................................-
FBpp0080424  .---................................................................................-
FBpp0085344  .---................................................................................-
FBpp0081552  .YKI................................................................................A
FBpp0087646  .---................................................................................-
FBpp0083769  .---................................................................................-
FBpp0070572  .---................................................................................-
FBpp0070575  .---................................................................................-
FBpp0074835  .---................................................................................-
FBpp0080424  .---................................................................................-
FBpp0076113  .---................................................................................-
FBpp0072561  .---................................................................................-
FBpp0072561  .YGL................................................................................G
FBpp0085923  .---................................................................................-
FBpp0079893  .YRR................................................................................A
FBpp0075683  .---................................................................................-
FBpp0077614  .---................................................................................-
FBpp0086749  .---................................................................................-
FBpp0073411  .---................................................................................-
FBpp0070908  .---................................................................................-
FBpp0085842  .---................................................................................-
FBpp0077718  .---................................................................................-
FBpp0296980  .---................................................................................-
FBpp0076600  .---................................................................................-
FBpp0086749  .---................................................................................-
FBpp0085479  .---................................................................................-
FBpp0112016  .---................................................................................-
FBpp0079665  .---................................................................................-
FBpp0084076  .---................................................................................-
FBpp0111406  .---................................................................................-
FBpp0074918  .---................................................................................-
FBpp0082818  .YGI................................................................................-
FBpp0074480  .---................................................................................-
FBpp0082819  .Y--................................................................................-
FBpp0085279  .---................................................................................-
FBpp0081805  .---................................................................................-
FBpp0100023  .---................................................................................-
FBpp0071879  .---................................................................................-
FBpp0084559  .---................................................................................-
FBpp0075591  .---................................................................................-
FBpp0076526  .---................................................................................-
FBpp0079851  .---................................................................................-
FBpp0072146  .DEI................................................................................I
FBpp0296980  .---................................................................................-
FBpp0083238  .---................................................................................-
FBpp0111383  .---................................................................................-
FBpp0071560  .---................................................................................-
FBpp0080424  .---................................................................................-
FBpp0071879  .FQI................................................................................A
FBpp0292775  .---................................................................................-
FBpp0077934  .---................................................................................-
FBpp0087646  .---................................................................................-
FBpp0079665  .---................................................................................-
FBpp0086749  .---................................................................................-
FBpp0082652  .---................................................................................-
FBpp0077619  .---................................................................................-
FBpp0086164  .---................................................................................-
FBpp0087232  .---................................................................................-
FBpp0072561  .---................................................................................-
FBpp0088148  .---................................................................................-
FBpp0075787  .---................................................................................-
FBpp0083319  .FNS................................................................................A
FBpp0076499  .---................................................................................-
FBpp0290580  .---................................................................................-
FBpp0080720  .---................................................................................-
FBpp0086164  .---................................................................................-
FBpp0080741  .---................................................................................-
FBpp0087297  .---................................................................................-
FBpp0070720  .---................................................................................-
FBpp0086683  .---................................................................................-
FBpp0289328  .---................................................................................-
FBpp0070667  .---................................................................................-
FBpp0082624  .---................................................................................-
FBpp0081552  .---................................................................................-
FBpp0086749  .---................................................................................-
FBpp0087646  .---................................................................................-
FBpp0071879  .---................................................................................-
FBpp0080894  .---................................................................................-
FBpp0070906  .LGL................................................................................C
FBpp0087646  .---................................................................................-
FBpp0082112  .---................................................................................-
FBpp0293629  .---................................................................................-
FBpp0076526  .WTV................................................................................H
FBpp0085279  .---................................................................................-
FBpp0074835  .---................................................................................-
FBpp0078887  .---................................................................................-
FBpp0290580  .---................................................................................-
FBpp0085047  .---................................................................................-
FBpp0296980  .---................................................................................-
FBpp0086380  .---................................................................................-
FBpp0083435  .---................................................................................-
FBpp0078891  .---................................................................................-
FBpp0082419  .---................................................................................-
FBpp0086749  .---................................................................................-
FBpp0078027  .---................................................................................-
FBpp0088148  .---................................................................................-
FBpp0290863  .---................................................................................-
FBpp0080720  .---................................................................................-
FBpp0083319  .---................................................................................-
FBpp0071288  .---................................................................................-
FBpp0081398  .---................................................................................-
FBpp0085016  .---................................................................................-
FBpp0293235  .---................................................................................-
FBpp0290580  .---................................................................................-
FBpp0085012  .---................................................................................-
FBpp0086380  .---................................................................................-
FBpp0071879  .---................................................................................-
FBpp0076961  .---................................................................................-
FBpp0075717  .---................................................................................-
FBpp0080267  .---................................................................................-
FBpp0070908  .---................................................................................-
FBpp0085033  .---................................................................................-
FBpp0082507  .CKL................................................................................-
FBpp0292775  .---................................................................................-
FBpp0085676  .---................................................................................-
FBpp0087091  .---................................................................................-
FBpp0082624  .---................................................................................-
FBpp0070431  .---................................................................................-
FBpp0075442  .---................................................................................-
FBpp0070906  .---................................................................................-
FBpp0089265  .---................................................................................-
FBpp0078634  .---................................................................................-
FBpp0075754  .---................................................................................-
FBpp0087625  .---................................................................................-
FBpp0071288  .---................................................................................-
FBpp0110159  .---................................................................................-
FBpp0072679  .---................................................................................-
FBpp0082624  .---................................................................................-
FBpp0084254  .---................................................................................-
FBpp0085032  .---................................................................................-


                350       360       370       380                                                   
                  |         |         |         |                                                   
d1w3ba_        SVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTL-----kemqd......................................
FBpp0112455  ------------------------------------------karedvrsryhifvaaalmeyycskdkeiafrifelglkrfgg
FBpp0070351  ------------------------------------------wstlkmvislmgrsdlqsyvsdrnlaalneafk..........
FBpp0070402  DLEIQLREFERCRMLYEKFLEFGPENCVT-------------wmkfaelenllgdtdraraifelavqqprldm...........
FBpp0080138  ------------------------------------------lyslvciipfelsennlnklfakhteylermdpekldfniedf
FBpp0074609  ------------------------------------------ssllkysakeyffraalchlsvdllnaqhaiekyaqqypafqd
FBpp0084171  ------------------------------------------ltsnsiqsakeslldlfdeirrkyeetemkqspmhyaagsknq
FBpp0085420  ------------------------------------------si.........................................
FBpp0085420  CVYYEQGLIDLAIDTYRRAIELQPN-----------------...........................................
FBpp0077790  ------------------------------------------sehrtpeiktslseveakike......................
FBpp0082545  ------------------------------------------reaqvm.....................................
FBpp0084691  ------------------------------------------maradiepdqkvlfaqrkvefledfgstarglqdaqralqqal
FBpp0072096  ------------------------------------------tesygqigrlvvalvmvqlargdsveaektfrewgnccepeev
FBpp0071560  ------------------------------------------edyigrhlqivlarlqki.........................
FBpp0077790  ------------------------------------------iegyrqcs...................................
FBpp0076600  KIHKTLGNMDLALMHFSWATDLDP------------------kg.........................................
FBpp0271716  FGNARIKEYTSGLKYCRAFLDIE-------------------sndqvrsleeyikkeidkevakgmvvaggaalvlggilglgia
FBpp0077790  ------------------------------------------lqgrmet....................................
FBpp0290896  ------------------------------------------arm........................................
FBpp0081673  ------------------------------------------slnlqtksygqvgrlvvalilvqltledyvdakktfkkwgnrc
FBpp0077614  ------------------------------------------lsygitla...................................
FBpp0084691  ------------------------------------------ptqgynghfdnfqdlinqhdvtitlaneevirlrkdfherqq.
FBpp0296980  ------------------------------------------vea........................................
FBpp0080535  ------------------------------------------eaarnarnqpp................................
FBpp0296980  ------------------------------------------cqqlfla....................................
FBpp0072164  ------------------------------------------ndrlrki....................................
FBpp0084016  ------------------------------------------kmqviykkylqleenhgtdatvakvkqqaeqwvknyak.....
FBpp0296980  ------------------------------------------ahlgiarsl..................................
FBpp0296980  ------------------------------------------st.........................................
FBpp0080894  ------------------------------------------imy........................................
FBpp0081606  ------------------------------------------dkdaklkftecn...............................
FBpp0084559  ------------------------------------------elhdpvgestar...............................
FBpp0075683  ------------------------------------------raherefgaidsknkpiwqvaeereehkfdnrentpygeyggw
FBpp0081284  ------------------------------------------qpmlqrlhv..................................
FBpp0079468  ------------------------------------------esknkekklyanmftk...........................
FBpp0087297  ------------------------------------------...........................................
FBpp0074835  ------------------------------------------rv.........................................
FBpp0079893  ------------------------------------------...........................................
FBpp0082765  ------------------------------------------reaqirlppiinerneklk........................
FBpp0079617  ------------------------------------------keqk.......................................
FBpp0084440  ------------------------------------------kkavekltsmlgeva............................
FBpp0080424  ------------------------------------------iigteqavkmvn...............................
FBpp0085344  ------------------------------------------pvl........................................
FBpp0081552  QLLYTIGHATNALKEIRECLKFDPE-----------------h..........................................
FBpp0087646  ------------------------------------------lp.........................................
FBpp0083769  ------------------------------------------dci........................................
FBpp0070572  ------------------------------------------dfd........................................
FBpp0070575  ------------------------------------------dfd........................................
FBpp0074835  ------------------------------------------wm.........................................
FBpp0080424  ------------------------------------------ktpeikrmlreakfalkks........................
FBpp0076113  ------------------------------------------rqq........................................
FBpp0072561  ------------------------------------------sr.........................................
FBpp0072561  QMYIYRGDTENAAQCFEKVLKIQPGNYETMKILG--------sly........................................
FBpp0085923  ------------------------------------------nnhg.......................................
FBpp0079893  RAHEATKDMNECL-----------------------------ddv........................................
FBpp0075683  ------------------------------------------re.........................................
FBpp0077614  ------------------------------------------ak.........................................
FBpp0086749  ------------------------------------------vkedemfdmynifikk...........................
FBpp0073411  ------------------------------------------as.........................................
FBpp0070908  ------------------------------------------s..........................................
FBpp0085842  ------------------------------------------hnekemyqkm.................................
FBpp0077718  ------------------------------------------ttnl.......................................
FBpp0296980  ------------------------------------------eaqlgtlervs................................
FBpp0076600  ------------------------------------------ifetihktep.................................
FBpp0086749  ------------------------------------------rlhrslkvw..................................
FBpp0085479  ------------------------------------------nevaia.....................................
FBpp0112016  ------------------------------------------lfrlgvqktqea...............................
FBpp0079665  ------------------------------------------a..........................................
FBpp0084076  ------------------------------------------ayidky.....................................
FBpp0111406  ------------------------------------------esnfencvkyarkfnskq.........................
FBpp0074918  ------------------------------------------ldq........................................
FBpp0082818  ------------------------------------------ylccnhldn..................................
FBpp0074480  ------------------------------------------ryi........................................
FBpp0082819  ------------------------------------------...........................................
FBpp0085279  ------------------------------------------rn.........................................
FBpp0081805  ------------------------------------------dal........................................
FBpp0100023  ------------------------------------------ltqlp......................................
FBpp0071879  ------------------------------------------k..........................................
FBpp0084559  ------------------------------------------gk.........................................
FBpp0075591  ------------------------------------------ar.........................................
FBpp0076526  ------------------------------------------krfpnkvkk..................................
FBpp0079851  ------------------------------------------wkva.......................................
FBpp0072146  SMNKRISKYEEAS-----------------------------rdi........................................
FBpp0296980  ------------------------------------------rheqrspetrqalydlqttcyqllqvllvalnrnedal.....
FBpp0083238  ------------------------------------------f..........................................
FBpp0111383  ------------------------------------------depnfeysvdrarrfnrsdadf.....................
FBpp0071560  ------------------------------------------fpqa.......................................
FBpp0080424  ------------------------------------------kqmrskckql.................................
FBpp0071879  KSYHATGQFESAKKYY--------------------------llsaksap...................................
FBpp0292775  ------------------------------------------a..........................................
FBpp0077934  ------------------------------------------kky........................................
FBpp0087646  ------------------------------------------yh.........................................
FBpp0079665  ------------------------------------------aakdg......................................
FBpp0086749  ------------------------------------------eaaqqlahiv.................................
FBpp0082652  ------------------------------------------feiaianarllnr..............................
FBpp0077619  ------------------------------------------w..........................................
FBpp0086164  ------------------------------------------pgeaegqpliarllyercvmlqqigriee..............
FBpp0087232  ------------------------------------------mddstlasdkraklnldamtmikmlqndprtakqeakqqkqki
FBpp0072561  ------------------------------------------tsemd......................................
FBpp0088148  ------------------------------------------kaydlsrslql................................
FBpp0075787  ------------------------------------------q..........................................
FBpp0083319  CIQANRQKYAEA------------------------------erklrtsek..................................
FBpp0076499  ------------------------------------------ngflaicldkkt...............................
FBpp0290580  ------------------------------------------r..........................................
FBpp0080720  ------------------------------------------gkqhqnpdaveqaeycl..........................
FBpp0086164  ------------------------------------------eamegaysvcgarftlediniylellilnkqyakvlrclrert
FBpp0080741  ------------------------------------------hrdleaeillhlgkifakdtqmtsiakkcyehakriyvdfndl
FBpp0087297  ------------------------------------------vqs........................................
FBpp0070720  ------------------------------------------krlgkgflrnteldlanrgvrshpsvqlnhrfldlmersdfel
FBpp0086683  ------------------------------------------gikdkitriskriteledtn.......................
FBpp0289328  ------------------------------------------fiqilgdpsehlhrqyikslfkygsttsepsksieeafimvqa
FBpp0070667  ------------------------------------------l..........................................
FBpp0082624  ------------------------------------------heyilkgvvhaalgqqlgskehiktaqq...............
FBpp0081552  ------------------------------------------kegiqrakklqkqse............................
FBpp0086749  ------------------------------------------dpritadfwqtwkefevrhgnedtmremlr.............
FBpp0087646  ------------------------------------------vlgnvvdhgddkaatilvamasmiydfqgea............
FBpp0071879  ------------------------------------------skcrv......................................
FBpp0080894  ------------------------------------------wtlmghefmel................................
FBpp0070906  HVYETLHNF---------------------------------ek.........................................
FBpp0087646  ------------------------------------------e..........................................
FBpp0082112  ------------------------------------------rmaeacimeh.................................
FBpp0293629  ------------------------------------------gvakg......................................
FBpp0076526  DVYQK-------------------------------------alrqadkag..................................
FBpp0085279  ------------------------------------------erf........................................
FBpp0074835  ------------------------------------------sltsltvng..................................
FBpp0078887  ------------------------------------------lanrqrtad..................................
FBpp0290580  ------------------------------------------rgmrnhpelgigaqmdipdggarsvgnpitmaisgitqalnlk
FBpp0085047  ------------------------------------------eeyrilekrdltlsdiepieqdk....................
FBpp0296980  ------------------------------------------hry........................................
FBpp0086380  ------------------------------------------dkdmhvalsyhlmartqscmgdfrsalnnekety.........
FBpp0083435  ------------------------------------------tierm......................................
FBpp0078891  ------------------------------------------rn.........................................
FBpp0082419  ----MLKDYKKALKYCKLILQYEPDNATAKEFY---------plildkl....................................
FBpp0086749  ------------------------------------------ylrtrrk....................................
FBpp0078027  ------------------------------------------hdntrlftgnktkmfeqrlvvvdeniedacgpsmtqyisdkek
FBpp0088148  ------------------------------------------saslgdrmaqmeamdgaarcletlrlqnkicncrplefntrll
FBpp0290863  ------------------------------------------csraedl....................................
FBpp0080720  ------------------------------------------ea.........................................
FBpp0083319  ------------------------------------------tkv........................................
FBpp0071288  ------------------------------------------slalhrqmvqlessaaacdqaslkywrmcydfmacyfgktqpr
FBpp0081398  ------------------------------------------rnrralaelhykigltylmqqlnkegatalrq...........
FBpp0085016  ------------------------------------------saqqtqk....................................
FBpp0293235  ------------------------------------------vidacellvkenn..............................
FBpp0290580  ------------------------------------------v..........................................
FBpp0085012  ------------------------------------------angnkrfyekeiaq.............................
FBpp0086380  ------------------------------------------mservngmdhpstileythlslysfanghvgmslkllyra...
FBpp0071879  ------------------------------------------qalal......................................
FBpp0076961  ------------------------------------------earvcnsliweflstmlmakshavlhkyerqtevlnsayelaa
FBpp0075717  ------------------------------------------lkiaekm....................................
FBpp0080267  ------------------------------------------ypeeylpliklrqaacalklrnfalceehlhellhielnq...
FBpp0070908  ------------------------------------------lmavlcgqeg.................................
FBpp0085033  ------------------------------------------vlrlwkkt...................................
FBpp0082507  ------------------------------------------llqlaqihasdreyslasellavgaesadeasatylkvlflls
FBpp0292775  ------------------------------------------tqn........................................
FBpp0085676  ------------------------------------------kaemhn.....................................
FBpp0087091  ------------------------------------------rqan.......................................
FBpp0082624  ------------------------------------------elawnv.....................................
FBpp0070431  ------------------------------------------qriltvthgrdhrllteqlymlvlqar................
FBpp0075442  ------------------------------------------wlvhalfkmhkygdaeiflskwine..................
FBpp0070906  ------------------------------------------rrgifgnmnfhvaiahedlsyayyvheystgdfscaqdhvdka
FBpp0089265  ------------------------------------------ycl........................................
FBpp0078634  ------------------------------------------qlesktydpidfalntatlsqfyigekrfeearhhlaaatlim
FBpp0075754  ------------------------------------------lystrsyqndqinkqae..........................
FBpp0087625  ------------------------------------------rlrhkvimrqafcawklkkia......................
FBpp0071288  ------------------------------------------nidrvkdillrglqrhpdsealnkcffdimlkeaalasnernl
FBpp0110159  ------------------------------------------fqeyqnl....................................
FBpp0072679  ------------------------------------------ahlrfgdqkaavatcvnlrqw......................
FBpp0082624  ------------------------------------------adnplkqrllfhlahklgneee.....................
FBpp0084254  ------------------------------------------eklevatk...................................
FBpp0085032  ------------------------------------------kks........................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  speyvmcyidylshlnednntrvlfervlssgglsphksvevwnrflefesnigdlssivkverrrsavfenlkeyegketaqlv
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  farfylivdifffdkevpdfnalchcvlidlrkilcsqqlrvpepsifkivsilffclsklkminspkvyslhaflvaacsdlmd
FBpp0074609  srefklikvlcenleeqniegfteavkdydsisrldqwyttillrikkaaded................................
FBpp0084171  kskqmrkevwiypdgirrlhrtddkgnkakgnkatmaevnryeemppeeilprivslylyllgklytgtdvdslypllrklqiqi
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  tkakeaqkks...........................................................................
FBpp0072096  stlqtllqafddedpela...................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  marnkq...............................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  dpqevntlqnllkafddedpelatkm...........................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  hkaakvdsptvtttlknlgalyrrqgmfeaa......................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  aldqakpvklenefvsplvridsnrqegrfarasadvkpgeellverpfvsvllekfakthcencfmrtvvpvacprcadvlycs
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  nfelendqeesleliyfceipddyvpelraklcvslihmrahhllgyliqnvqehitltadrvelymditealmqehkyaeaial
FBpp0080741  hsrkmanylqaklm.......................................................................
FBpp0087297  .....................................................................................
FBpp0070720  aevdeeirlilqrivtdmdmtvelhldylayrirntnasdeqqvaslraafnhaweeltvlygdqadtryevlqlwaqveytqlg
FBpp0086683  .....................................................................................
FBpp0289328  sqeeldnimsdlnepqndvevekdlyqvkrspsncelgcrglyrqktnlvcrykstantflrlaplkleeisldpfmamyhevly
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  aaiefqdgneeaardalldlppraeseldpvtlhnmaltdvegpvaglrklafllelgapscpketfanilliccknelyetaad
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  livhlkevqnkykpdtrplwkilkeqekcdvlsipeieeemlspleiarrsrafdvfnqmfidrswhdviflkhvrknpnlllnq
FBpp0088148  evassigakflvrkircrlaliyralgdedq......................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  vwveylaferdhgeaknislltqralstlepqyvaaf................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  qlkspqlctfielcr......................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  ramilmierktndvlallnsagqiidnn.........................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  vnimqhlvp............................................................................
FBpp0089265  .....................................................................................
FBpp0078634  a....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  aentlseqdiklerveavyrnsmanitq.........................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  drykfldlypctstelksigyae..............................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  acivsieqtilaraqdnerfqaeyeerfqefdtvvrksrneyknwlaavgecerkdkklmprphslkdcssdsrdsqhsgeeakt
FBpp0074609  .....................................................................................
FBpp0084171  gvalrhenllsrskllkivalnlfvvehnkpktsrremryhsfnfansffglmmkktnqllagfvedstnvqclpeedfatvnty
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  eqcreeaskkyhkyecgivpiiwrsgasinnhialriiaskpldyflklkptideeltpeqlislpkddfrrvaqlerhqgerqp
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  spdngreiwrqimgypgssirgllwlnfaqmeseyngghgtrdvlrkalsqpvlenglmvqeffrryercygtyesiaacq....
FBpp0086683  .....................................................................................
FBpp0289328  dseirelkgqsmnmvngyasqrngteirdtvvrydwwsntslvrerinqriidmtgfnflkdeklqianyglgtyfqphfdyssd
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  ilaehtdltykylsqylyelldslitaqtsaelaekklgtlasslagklrslaakvqevratneqqalrdalkdyeqalel....
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  cknsteylqtlstkkydeiksflkilearspmyniryqkftnkklmdkfrqeylfrvqyqtrrnmisalrsirylrktksltklt
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  qeaadgdkigeavstrssdeakesdlktplsckskrrgmrlrrrrrkiaqsddsscydseseldtdfysdeedytdlssnfdtdf
FBpp0074609  .....................................................................................
FBpp0084171  lqfvnvyvrwlsisldvwepvrseehsfidcwaeltilfeyieclmgkhklekneilldedvalrgftplgretlsmdylkrgse
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  snffqhvlmarfltnclraggyfgsepkpdevsiicslvlrslqfiqfnthevaelhkfsssgreksifiggaiyptlalfnhsc
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  gfetpnittlgdrlasilfyasevpqggatvfpeinvtvfpqkgsmlywfnlhddgkpdi.........................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  syveevmgdyvvkktnrimpwkfefinevynilalayvdqytlpknfrfseknallrllrfpmdkskevkhfvfgdrtthqgset
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  sdidaadpgepcgeeryaaanyskkerkagggggggvggvvysdnedvvieeekivypneverrsnsqeadseellrsfevlqln
FBpp0074609  .....................................................................................
FBpp0084171  rlqffervrrigqfqeyyvqhqealqqplessftvehln..............................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0076113  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0072561  .....................................................................................
FBpp0085923  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0073411  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085842  .....................................................................................
FBpp0077718  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0085479  .....................................................................................
FBpp0112016  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0084076  .....................................................................................
FBpp0111406  .....................................................................................
FBpp0074918  .....................................................................................
FBpp0082818  .....................................................................................
FBpp0074480  .....................................................................................
FBpp0082819  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0081805  .....................................................................................
FBpp0100023  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075591  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0079851  .....................................................................................
FBpp0072146  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0083238  .....................................................................................
FBpp0111383  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0077934  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0079665  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0082652  .....................................................................................
FBpp0077619  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0087232  dpgvvryfrgttihinsvrpieaglpinenygpmytqderserqarlkdlywfecscdacidnwpkfddlprdvirfrcdapnnc
FBpp0072561  .....................................................................................
FBpp0088148  .....................................................................................
FBpp0075787  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0076499  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0086164  .....................................................................................
FBpp0080741  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0070720  .....................................................................................
FBpp0086683  .....................................................................................
FBpp0289328  .....................................................................................
FBpp0070667  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0082112  .....................................................................................
FBpp0293629  .....................................................................................
FBpp0076526  .....................................................................................
FBpp0085279  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0078887  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085047  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0083435  .....................................................................................
FBpp0078891  .....................................................................................
FBpp0082419  .....................................................................................
FBpp0086749  .....................................................................................
FBpp0078027  vdpaltksrlmgnrlenrmnfakypieksyllhqmaeihlkshrfdeccfsarksieeakkcnsyiwqflcylliikanaalhkv
FBpp0088148  .....................................................................................
FBpp0290863  .....................................................................................
FBpp0080720  .....................................................................................
FBpp0083319  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0081398  .....................................................................................
FBpp0085016  .....................................................................................
FBpp0293235  .....................................................................................
FBpp0290580  .....................................................................................
FBpp0085012  .....................................................................................
FBpp0086380  .....................................................................................
FBpp0071879  .....................................................................................
FBpp0076961  .....................................................................................
FBpp0075717  .....................................................................................
FBpp0080267  .....................................................................................
FBpp0070908  .....................................................................................
FBpp0085033  .....................................................................................
FBpp0082507  .....................................................................................
FBpp0292775  .....................................................................................
FBpp0085676  .....................................................................................
FBpp0087091  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0070431  .....................................................................................
FBpp0075442  .....................................................................................
FBpp0070906  .....................................................................................
FBpp0089265  .....................................................................................
FBpp0078634  .....................................................................................
FBpp0075754  .....................................................................................
FBpp0087625  .....................................................................................
FBpp0071288  .....................................................................................
FBpp0110159  .....................................................................................
FBpp0072679  .....................................................................................
FBpp0082624  .....................................................................................
FBpp0084254  .....................................................................................
FBpp0085032  .....................................................................................


                                                                                                    
                                                                                                    
d1w3ba_        .....................................................................................
FBpp0112455  .....................................................................................
FBpp0070351  .....................................................................................
FBpp0070402  .....................................................................................
FBpp0080138  fksaedaqskpvapppvsfseppkklvyrnkytkinpnividclhneptiralkmlfdwlrinpeiligcyhsnpefvhkimkll
FBpp0074609  .....................................................................................
FBpp0084171  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0085420  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0082545  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0072096  .....................................................................................
FBpp0071560  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0076600  .....................................................................................
FBpp0271716  .....................................................................................
FBpp0077790  .....................................................................................
FBpp0290896  .....................................................................................
FBpp0081673  .....................................................................................
FBpp0077614  .....................................................................................
FBpp0084691  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080535  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0072164  .....................................................................................
FBpp0084016  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0296980  .....................................................................................
FBpp0080894  .....................................................................................
FBpp0081606  .....................................................................................
FBpp0084559  .....................................................................................
FBpp0075683  .....................................................................................
FBpp0081284  .....................................................................................
FBpp0079468  .....................................................................................
FBpp0087297  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0079893  .....................................................................................
FBpp0082765  .....................................................................................
FBpp0079617  .....................................................................................
FBpp0084440  .....................................................................................
FBpp0080424  .....................................................................................
FBpp0085344  .....................................................................................
FBpp0081552  .....................................................................................
FBpp0087646  .....................................................................................
FBpp0083769  .....................................................................................
FBpp0070572  .....................................................................................
FBpp0070575  .....................................................................................
FBpp0074835  .....................................................................................
FBpp0080424  ..............................................................................