SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Fibronectin type III alignments

These alignments are sequences aligned to the 0034836 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                              10    
                                                                                               |    
d1a21a1 ..........................................................................t-GRAYNLTW...KSTNF
d1axib1 .............................epkftkcrsperetfschwtdevhhgtknegpiqlfytrrntqewt---------...-----
d1axib2 ...............................................................pdppialnwtll-----NVSL...TGIHA
d1bp3b1 .......................................................................lppg--KPEIFKC...RSPNK
d1bp3b2 ......................................................vqpdpplelavevkqpedrkp---------...-----
d1bpva_ ........................................................................spi-DPPGKPVPl..NITRH
d1bqua2 .......................................................................ykvkPNPPHNLSVi..NSEEL
d1cd9b2 ....................................................kleppmlqaldigpdvvshqpgc---------...-----
d1cfba1 ..............................................................ivqdvpnapkltg--------I...TCQAD
d1cfba2 ....................................................................pdvpfkn---PDNVVGq..GTEPN
d1eerb1 ....................................dpkfeskaallaargpeellcfterledlvcfweeaasa---------...-----
d1eerb2 .......................................................evvlldapvglvarladesg---------...-----
d1egja_ .......................................................................iqma---PPSLNV...TKDGD
d1f42a2 ................................giwstdilkdqkepknktflrceaknysgrftcwwlttistdl---------...-----
d1f42a3 ..........................................................................kPDPPKNLQLkp.LKNSR
d1fnfa1 ..........................................................................pLSPPTNLHL...EANPD
d1fnfa2 ...........................................................................VPPPTDLRFt..NIGPD
d1fnfa3 ..........................................................................l-DSPTGIDFs..DITAN
d1fnha1 ...........................................................................-PAPTDLKFt..QVTPT
d1fnha2 ..........................................................................nVSPPRRARVt..DATET
d1fyhb1 ...........................................................................VPTPTNVTI...ESYNM
d1fyhb2 ...............................igppkldirkeekqimidifhpsvfvngdeqevdydpettcyir---------...-----
d1gh7a1 ..........................eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepv---------...-----
d1gh7a2 ......................................................................tqhvqPPEPRDLQI...STDQD
d1gh7a3 eaqpqnlecffdgaavlscswevrkevassvsfglfykpspdagsavllreeecspvlreglgslhtrhhcqipv---------...-----
d1i1ra1 ...................................lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnan---------...-----
d1iarb1 ........................................................fkvlqeptcvsdymsistc---------...-----
d1iarb2 ..........................................................................kPRAPGNLTVh..TNVSD
d1j7vr1 .......................................................................gtel-PSPPSVWF...EAEFF
d1j7vr2 ................evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftf---------...-----
d1j8ka_ .........................................................................ni-DRPKGLAFt..DVDVD
d1k85a_ .......................................................................hmap-TAPTNLASt..AQTTS
d1lwra_ ................................................agpsapklegqmgedgnsikvnlikqd---------...-----
d1n26a2 ..............ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqk---------...-----
d1n26a3 ..........................................................................qPDPPANITVtavARNPR
d1n6va1 ..................................................................sydspdytd--ESCTFKI...SLRNF
d1n6va2 ................pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnfty---------...-----
d1owwa_ ...............................................................sgpvevfitetp---------...-SQPN
d1qg3a1 .........................................................................dl-GAPQNPNAk..AAGSR
d1qg3a2 .........................................................................evPSEPGRLAFn..VVSST
d1qr4a1 ..........................................................................d--NPKDLEVs..DPTET
d1tdqa1 ......................................................................ipvid--GPTQILVr..DVSDT
d1tdqa2 ..........................................................................i-DAPKNLRVg..SRTAT
d1tdqa3 ..........................................................................l-DSPRDLMVt..ASSET
d1uc6a_ ....................................................................gplgsvkPDPPENVVArpvPSNPR
d1uena_ ...........................................................gssgssghsgedlpmv--APGNVRVn..VVNST
d1ueya_ ...........................................................gssgssgptpapvydvPNPPFDLELt..DQLDK
d1ujta_ ................................................gssgssgrqvqkelgdvlvrlhnpvvl---------...--TPT
d1v5ja_ ...................................................................gssgssgl-SPPRGLVA...VRTPR
d1va9a1 ..................................................................isteeaapd-GPPMDVTLq..PVTSQ
d1wf5a1 .....................................................rsahlrvrqlphapehpvatls---------...TVERR
d1wfna1 ................................................................pqlvrthedvp-GPVGHLSFs..EILDT
d1wfoa1 .......................................................rigdgspshppilertlddvPGPPMGILFp..EVRTT
d1wfta_ ....................................................................gssgssgPGAPSTVRI...SKNVD
d1wfua_ ...........................................................gssgssgmephkvvpl-SKPHPPVVg..KVTHH
d1wisa1 .................................................................tissgvppelPGPPTNLGIs..NIGPR
d1wj3a_ .......................................................gssgssgtvnvttkktppsq--PPGNVVW...NATDT
d1wk0a_ .................................................gssgssgdeetkafeallsnivkpva--------S...DIQAR
d1x3da1 .................................................................aeifttlscePDIPNPPRIa..NRTKN
d1x4xa1 .............................................................pdqckppqvtcrsa---------...----T
d1x4ya1 ................................................................pvagpyitftd---------...AVNET
d1x4za1 .................................................................sqpdhgrlspPEAPDRPTIs..TASET
d1x5aa1 .......................................................aeslsglslklvkkeprqle---------...-----
d1x5fa1 .................................................................ehapattgplPSAPRDVVAs..LVSTR
d1x5ga1 .................................................................rvetqpevqlPGPAPNLRAy..AASPT
d1x5ha1 ..............................................................dvavrtlsdvpsa--APQNLSL...EVRNS
d1x5ia1 ......................................................patdwlsaetfesdldetrvp-EVPSSLHV...RPLVT
d1x5ja1 ........................................................................pmm--PPVGVQAs..ILSHD
d1x5ka1 ...............................................................tahgttfelvpt-SPPKDVTVvskEGKPK
d1x5la1 ............................................................qaapsqvvvirqera---------...--GQT
d1x5xa1 .............................................................psmpaspvltkagi---------...----T
d1x5ya1 .........................................................................pt-SAPQHLTVe..DVTDT
d1x5za1 .................................................................diqvitqtgvPGQPLNFKAe..PESET
d2b5ib1 .................................sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqt---------...-----
d2b5ib2 .......................................................................lrlm--APISLQVv..HVETH
d2b5ic1 .......................................................................vipw--APENLTLh..KLSES
d2b5ic2 ..................................................................plpevqcfv---------...-----
d2crma1 ................................................................vvefttcpdkp-GIPVKPSVkg.KIHSH
d2crza1 ..........................................................ppgpclpprlqgrpkak---------...-----
d2cspa1 .................................................................vefstlpagpPAPPQDVTVqa.GVTPA
d2cuha1 ..........................................................................p-DGPTQLRAl..NLTEG
d2cuia1 .................................................................sgsrprlsql-------SVt..DVTTS
d2d9qb3 ......................................................................gyppa--IPHNLSClm.NLTTS
d2db8a1 ............................................................pvpatpilqleecct---------...--HNN
d2dbja1 ..............................................................wilasttegapsv--APLNVTVfl.NESSD
d2dlha1 ...............................................................pvltqtseqaps-SAPRDVQAr..MLSST
d2dmka1 .......................................................egldyltapnppsireelct---------...-ASHD
d2dn7a1 ..............................................................pgrptmmisttam---------...----N
d2doca1 .................................................................qeyilaladvPSSPYGVKIi..ELSQT
d2dtge1 ............................................................eakaddivgpvthei---------...-FENN
d2dtge2 ..................................................................tnpsvpldp-------ISv..SNSSS
d2dtge3 ...........................................................cenellkfsyirtsfd---------...-----
d2e7ha1 ..........................................................................p-PAVSDIRVt..RSSPS
d2ed7a1 .................................................................kpaipsssvlPSAPRDVVPv..LVSSR
d2ed9a1 .....................................................nrygpgvstdditvvtlsdvps-APPQNVSLe..VVNSR
d2edea1 .......................................................................ptsa---PKDLTVitrEGKPR
d2edxa1 ..............................................................tieartaqstpsa--PPQKVMCv..SMGST
d2edya1 .........................................................................ps-GFPQNLHVt..GLTTS
d2ee2a1 ..............................................................vavinsaqdapse--APTEVGVk..VLSSS
d2ee3a1 ..........................................................................l-APPRHLGFs..DVSHD
d2fnba_ .................................................................mrgsevpqlt-----DLSFv..DITDS
d2haza1 ..........................................................dtpsspsidqvepysst---------...-----
d2hfta1 ...................................................................sgttntva---AYNLTW...KSTNF
d2hfta2 ................................nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgk---------...-----
d2ibga1 ....................................................................gaaldpm-PVPELLEIe..EYSET
d2ic2a1 ..........................................................................y--PPTPPNVt..RLSDE
d2mfna2 ..........................................................................d--IPRDLEVi..ASTPT
d2rbla_ ..........................................................................l-DAPSQIEVk..DVTDT
d2yrza1 .................................................................shdsrltagvPDTPTRLVFs..ALGPT
d2yuxa1 .................................................................asidiqiidrPGPPQIVKIe..DVWGE
d3d1md_ ................................................................pitgphiayte---------...AVSDT
d3lpwa1 .........................................................................dtPGPPQDLKVk..EVTKT
d3lpwb2 .........................................................................pl--PPGKITLm..DVTRN
d3wihb_ ..........................................................................a--PPQGVTVsknDGNGT
d4eq2a1 ..........................................................................aVPSPTGTSV...KSKNF
d4eq3a2 ..................................igppklnlsrhgaeiivdvyhpefpsvevrpwmreiysels---------...-----
d4lpxa1 ..........................................................................mLPAPKNLVVs..EVTED
d4n68a1 .......................................................................epsa--APTDVKAt..SVSVS
d5dfta_ ........................................................................qmq--------Vt..DVQDN
d5mtjb_ .........................................................................vs-SVPTKLEVv..AATPT


               20                         30                      40                             50 
                |                          |                       |                              | 
d1a21a1 KTI.L..EWEPK.....SI.DH...........VYTVQIS..........TRL....ENWK.........SKCFL............TAETE
d1axib1 ---.-..-----.....--.--...........-------..........---....QEW-.........-----............-----
d1axib2 DIQ.V..RWEAPr....NA.DIqkgwmvl....EYELQYK..........EVN....ETKW.........KMMDP............ILTTS
d1bp3b1 ETF.T..CWWRP.....GT.DGglpt.......NYSLTYH..........REG....ETLMhec......PDYIT............GGPNS
d1bp3b2 YLW.I..KWSPPt....LI.DLktgwftl....LYEIRLK..........PEKa...AEWE.........IHFA-............GQQTE
d1bpva_ TVT.L..KWAKP.....EY.TGgfkit......SYIVEKR..........DLPn...GRWLk........ANFSN............ILENE
d1bqua2 SSI.LklTWTNP.....SI.KSviil.......KYNIQYR..........TKDa...STWSqip......PEDTA............STRSS
d1cd9b2 -LW.L..SWKPW.....KP.SEymeqecel...RYQPQLK..........GA-....-NWTl........VFHLP............SSKDQ
d1cfba1 KAE.I..HWEQQ.....GD.NRspil.......HYTIQFN..........TSFtp..ASWDaa.......YEKVP............NTDSS
d1cfba2 NLV.I..SWTPMpei..E-.-Hnapnf......HYYVSWKr.........DIPa...AAWEn........NNIFD............WRQNN
d1eerb1 ---.-..-----.....--.-Gvgpg.......QYSFSYQ..........LED....EPWKlcrlhqa..PTARG............AVRFW
d1eerb2 HVV.L..RWLPP.....PE.TPmtshi......RYEVDVS..........AGQga..GSVQ.........RVEIL............EGRTE
d1egja_ SYS.L..RWETM.....KM.RYehidh......TFEIQYR..........KDT....ATWKds.......KTETL............QNAHS
d1f42a2 ---.-..-----.....--.--...........-------..........---....----.........-----............-----
d1f42a3 QVE.V..SWEYPdtwstPH.SYfsl........TFCVQVQ..........GKSk...REKK.........-DRVF............TDKTS
d1fnfa1 TGV.LtvSWERS.....TT.PDit.........GYRITTT..........PTN....GQQGnsl......EEVVH............ADQSS
d1fnfa2 TMR.V..TWAPPp....SI.DLt..........NFLVRYS..........PVKn...EEDVa........ELSIS............PSDNA
d1fnfa3 SFT.V..HWIAP.....RA.TIt..........GYRIRHH..........PEHfs..GRPR.........EDRVP............HSRNS
d1fnha1 SLS.A..QWTPP.....NV.QLt..........GYRVRVT..........PKEkt..GPMK.........EINLA............PDSSS
d1fnha2 TIT.I..SWRTK.....TE.TIt..........GFQVDAV..........PAN....GQTPi........QRTIK............PDVRS
d1fyhb1 NPI.V..YWEYQ.....IM.PQvp.........VFTVEVK..........NYGvkn.SEWI.........DACIN............ISHHY
d1fyhb2 ---.-..-----.....--.--...........VYNVYVR..........---....----.........-----............-----
d1gh7a1 ---.-..-----.....--.--...........-------..........---....----.........-----............----S
d1gh7a2 HFL.L..TWSVA.....LG.SPqshwlspgdl.EFEVVYK..........RLQ....DSWEd........AAILL............SNTSQ
d1gh7a3 ---.-..-----.....--.--...........-------..........---....----.........-----............-----
d1i1ra1 --Y.I..VWKTN.....HF.TIpke........QYTIINR..........TASs...VTFT.........D----............-----
d1iarb1 ---.-..-----.....--.--...........-------..........---....-EWKmngp.....TNCST............-----
d1iarb2 TLL.L..TWSNPyp...PD.NYlynhl......TYAVNIW..........SENdp..ADFR.........IYNVT............YLEPS
d1j7vr1 HHI.L..HWTPI.....PQ.QSest........CYEVALL..........RYGi...ESWN.........SISQC............SQTLS
d1j7vr2 ---.-..-----.....--.--...........-------..........---....----.........-T---............-----
d1j8ka_ SIK.I..AWESP.....QG.QVs..........RYRVTYS..........SPE....DGIHel.......FPAPD............GEEDT
d1k85a_ SIT.L..SWTAS.....TD.NVgvt........GYDV---..........---....YNGT.........ALATT............VTGTT
d1lwra_ ---.-..-----.....--.DGgspir......HYLVKYR..........ALA....SEWK.........PEIRL............PSGSD
d1n26a2 ---.-..-----.....--.--...........-------..........---....----.........-----............---FS
d1n26a3 WLS.V..TWQDP.....HS.WNssfyrl.....RFELRYR..........AER....SKTFt........TWMVK............DLQHH
d1n6va1 RSI.L..SWELK.....NH.SIvpthytl....LYTIMSK..........PED....LKVV.........KNCAN............TTRSF
d1n6va2 ---.-..-----.....--.--...........--I----..........---....----.........-----............-----
d1owwa_ SHP.I..QWNAP.....QP.SHis.........KYILRWR..........PKNsv..GRWK.........EATIP............GHLNS
d1qg3a1 KIH.F..NWLPP.....SG.KPm..........GYRVKYW..........IQGd...SESE.........AHLLD............SKVPS
d1qg3a2 VTQ.L..SWAEPa....ET.NGeit........AYEVCYG..........LVNd...DN-Rpigpmkk..VLVDN............PKNRM
d1qr4a1 TLS.L..RWRRP.....VA.KFd..........RYRLTYV..........SPS....GKKN.........EMEIP............VDSTS
d1tdqa1 VAF.V..EWTPP.....RA.KV...........DFILLKYglvg......GEG....GKTT.........FRLQP............-PLSQ
d1tdqa2 SLD.L..EWDNS.....EA.EAq..........EYKVVYS..........TLAg...EQYH.........EVLVPkgi.........GPTTK
d1tdqa3 SIS.L..IWTKA.....SG.PId..........HYRITFT..........PSS....GISS.........EVTVP............RDRTS
d1uc6a_ RLE.V..TWQTP.....ST.WPdpesfpl....KFFLRYR..........PLI....LDQW.........QHVEL............SNGTA
d1uena_ LAE.V..HWDPV.....PL.KSirghlq.....GYRIYYW..........KTQ....SSSKrnrrhiekkILTFQ............GSKTH
d1ueya_ SVQ.L..SWTPG.....DD.NNspit.......KFIIEYE..........DAMhkp.GLWHh........QTEVS............GTQTT
d1ujta_ TVQ.V..TWTVD.....RQ.PQfiq........GYRVMYR..........QTSg...LQAT.........SSWQNldakv.......PTERS
d1v5ja_ GVL.L..HWDPP.....EL.VPkrld.......GYVLEGR..........QGSqg..WEVL.........DPAVA............GTETE
d1va9a1 SIQ.V..TWKAPkke..LQ.NGvir........GYQIGYR..........ENSpg..SNGQysiv.....EMKAT............GDSEV
d1wf5a1 AIN.L..TWTKP.....FD.GNspli.......RYILEMS..........ENN....APWTvl.......LASVD............PKATS
d1wfna1 SLK.V..SWQEP.....GE.KNgilt.......GYRISWE..........EYNr...TNTRv........THYLP............NVTLE
d1wfoa1 SVR.L..IWQPP.....AA.PNgiil.......AYQITHR..........LNTtta.N--Tat.......VEVLA............PSARQ
d1wfta_ GIH.L..SWEPP.....TS.PSgnileysaylaIRTAQMQ..........DNP....SQLVf........MRIYC............GLKTS
d1wfua_ SIE.L..YWDLEqke..K-.-Rqgpqeqwl...RFSIEEE..........DPK....MHSY.........GVIYT............GYATR
d1wisa1 SVT.L..QFRPG.....YD.GKtsis.......RWLVEAQvgvv......GEG....EEWLlih......QLSNE............PDARS
d1wj3a_ KVL.L..NWEQVkam..E-.-Nesevt......GYKVFYR..........TSSq...NNVQ.........VLNTN............KTS--
d1wk0a_ TVV.L..TWSPPss...LI.NGetdessvpelyGYEVLIS..........STG....KDGKy........KSVYV............GEETN
d1x3da1 SLT.L..QWKAP.....SD.NGskiq.......NFVLEWD..........EGK....GNGEf........CQCYM............GSQKQ
d1x4xa1 CAQ.V..NWEVP.....LS.NGtdvt.......EYRLEWG..........GVE....GSM-.........QICYC............GPGLS
d1x4ya1 TIM.L..KWMYI.....PA.SNnntpih.....GFYIYYR..........PTDsdndSDYK.........KDMVE............GDRYW
d1x4za1 SVY.V..TWIPR.....GN.GGfpiq.......SFRVEYK..........KLKkv..GDWIla.......TSAIP............PSRLS
d1x5aa1 ---.L..TWAGSrpr..N-.-Pggnl.......SYELHVL..........NQD....EEWH.........QMV--............-LEPR
d1x5fa1 FIK.L..TWRTP.....AS.DPhgdnl......TYSVFYT..........KEGia..RERV.........ENTSH............PGEMQ
d1x5ga1 SIT.V..TWETP.....VS.GNgeiq.......NYKLYYM..........EKGt...DKEQ.........--DVD............VSSHS
d1x5ha1 KSImI..HWQPPapa..TQ.NGqit........GYKIRYR..........KASrk..SDVT.........ETLVS............GTQLS
d1x5ia1 SIV.V..SWTPP.....EN.QNivvr.......GYAIGYG..........IGS....PHAQ.........TIKVD............YKQRY
d1x5ja1 TIR.I..TWADN.....SL.PKhqkitdsr...YYTVRWK..........TNIp...ANTK.........YKNAN............ATTLS
d1x5ka1 TII.V..NWQPPs....EA.NGkit........GYIIYYStdv.......NAEi...HDWV.........IEPVV............GNRLT
d1x5la1 SVS.L..LWQEP.....EQ.PNgiil.......EYEIKYY..........EKD....KEMQs........YSTLK............AVTTR
d1x5xa1 WLS.L..QWSKP.....SG.TPsdegi......SYILEME..........EETs...GYGF.........KPKYD............GEDLA
d1x5ya1 TTT.L..KWRPPdri..GA.GGid.........GYLVEYC..........LEGs...EEWVp........ANKEP............VERCG
d1x5za1 SIL.L..SWTPP.....RS.DTia.........NYELVYK..........DGEh...GEEQr........ITI--............EPGTS
d2b5ib1 ---.-..-----.....--.--...........-------..........---....----.........--C--............-----
d2b5ib2 RCN.I..SWEIS.....QA.SHyferhl.....EFEARTL..........SPG....HTWE.........EAPLL............TLKQK
d2b5ic1 QLE.L..NWNNR.....FL.NHcl.........EHLVQYR..........TDWd...HSWT.........EQSVD............YRH-K
d2b5ic2 ---.-..-----.....--.--...........-FNVEYM..........NCT....WQSSse.......PQPTN............-----
d2crma1 SFK.I..TWDPP.....KD.NGgatin......KYVVEMA..........EGSng..NKWEm........IYSGA............TREHL
d2crza1 EIQ.L..RWGPP.....LV.DGgspis......CYSVEMS..........PIE....KDEP.........REVYQ............GSEVE
d2cspa1 TIR.V..SWRPP.....VL.TPtglsnganvt.GYGVYAK..........GQRv...AEVI.........-----............-----
d2cuha1 FAV.L..HWKPP.....QN.PVd..........TYDIQVT..........APG....APPL.........QAETP............GSAVD
d2cuia1 SLR.L..NWEAP.....PG.AFd..........S------..........---....----.........-----............-----
d2d9qb3 SLI.C..QWEPG.....PE.THlpt........SFTLKSF..........KSR....GNCQtqgdsi...LDCVPk...........DGQSH
d2db8a1 SAT.L..SWKQP.....PL.STvpad.......GYILELD..........DGNg...GQFR.........EV-YV............GKETM
d2dbja1 NVD.I..RWMKP.....PT.KQqdgelv.....GYRISHV..........WQSagi.SKEL.........LEEVG............QNGSR
d2dlha1 TIL.V..QWKEP.....EE.PNgqiq.......GYRVYYT..........MDP....TQHVnn.......WMKHN............VADSQ
d2dmka1 TIT.V..HWISDd....EF.SIs..........SYELQYTiftgqanfisLYNs...VDSW.........MIVPN............IKQNH
d2dn7a1 TAL.L..QWHPP.....KElPGell........GYRLQYC..........RADe...ARPN.........TIDFG............KDDQH
d2doca1 TAK.V..SFNKP.....DS.HGgvpih......HYQVDVK..........EVAs...EIWK.........IVRSH............GVQTM
d2dtge1 VVH.L..MWQEP.....KE.PNgliv.......LYEVSYR..........RYGd...EELHlcd......TRKHF............ALERG
d2dtge2 QII.L..KWKPP.....SD.PNgnit.......HYLVFW-..........---....----.........-----............-----
d2dtge3 KIL.L..RWEPYw....PP.DFrdll.......GFMLFYK..........EAP....----.........-----............-----
d2e7ha1 SLS.L..AWAVP.....RA.PSgavl.......DYEVKYH..........EKG....AEGPss.......VRFLK............TSENR
d2ed7a1 FVR.L..SWRPP.....AE.AKgniq.......TFTVFFS..........REGd...N-REra.......LNTTQ............PGSLQ
d2ed9a1 SIK.V..SWLPP.....PS.GTqngfit.....GYKIRHR..........KTT....RRGE.........METLE............PNNLW
d2edea1 AVI.V..SWQPPl....EA.NGkitayil....FYTLDKN..........IPI....DDWI.........METIS............GDRLT
d2edxa1 TVR.V..SWVPP.....PA.DSrngvit.....QYSVAYE..........AVD....GEDRgrhv.....VDGIS............REHSS
d2edya1 TTE.L..AWDPPvla..ER.NGrii........SYTVVFR..........DIN....SQQEl........QNI--............TTDTR
d2ee2a1 EIS.V..HWEHV.....LE.KIve.........SYQIRYW..........AAH....DKEEaan......RVQVT............SQEYS
d2ee3a1 AAR.V..FWEGA.....PR.PVr..........LVRVTYV..........SSEg...GHSG.........QTEAP............GNATS
d2fnba_ SIG.L..RWTPL.....NS.STii.........GYRITVV..........AAGe...GIPIf........EDFVD............SSVGY
d2haza1 -AQ.V..QFDEP.....EA.TGgvpil......KYKAEWR..........AVGe...EVWHskwy.....DAKEA............SMEGI
d2hfta1 KTI.L..EWEPK.....PV.NQ...........VYTVQIS..........TKS....GDWK.........SKCFY............TTDTE
d2hfta2 ---.-..-----.....--.DL...........IYTLYYW..........KSS....SQEKgefrsgkk.TAKTN............TNEF-
d2ibga1 AVV.L..HWSLA.....SD.ADehlit......GYYAYYR..........PSSsa..GEYFk........ATIEG............AHARS
d2ic2a1 SVM.L..RWMVP.....RN.DGlpiv.......IFKVQYR..........MVGkr..KNWQ.........TTNDNipygkpkwnselGKSFT
d2mfna2 SLL.I..SWEPP.....AV.SVr..........YYRITYG..........ETGg...NSPVq........EFTVP............GSKST
d2rbla_ TAL.I..TWSMQ.....LS.QLegiel......TYGIKDV..........PGD....RTTI.........DL--T............EDENQ
d2yrza1 SLR.V..SWQEP.....RC.ERplq........GYSVEYQ..........LLNg...GELHr........LNIPN............PAQTS
d2yuxa1 NVA.L..TWTPP.....KD.DGnaait......GYTIQKA..........DKKs...MEWF.........TVIEH............YHRTS
d3d1md_ QIM.L..KWTYI.....PS.SNnntpiq.....GFYIYYR..........PTDsdndSDYK.........RDVVE............GSKQW
d3lpwa1 SVT.L..TWDPP.....LL.DGgskik......NYIVEKR..........EST....RKAYs........TVATN............CHKTS
d3lpwb2 SVS.L..SWEKP.....EH.DGgsril......GYIVEMQ..........TKG....SDKW.........ATCAT............VKVTE
d3wihb_ AIL.V..SWQPP.....PE.DTqngmvq.....EYKVWCL..........GNE....TRYHi........NKTVD............GSTFS
d4eq2a1 RTV.L..YWQYP.....SM.SEtp.........HFVVEVK..........PYLs...GKYQtv.......STCVN............ISATS
d4eq3a2 ---.-..-----.....--.--...........-YSVIFR..........NSE....----.........-----............-----
d4lpxa1 SLR.L..SWTAP.....DA.AFd..........SFLIQYQ..........ESEkv..GEAI.........NLTVP............GSERS
d4n68a1 EIL.V..AWKHI.....KE.SLgrpq.......GFEVGYW..........KDMe...QEDTae.......TVKTR............GNESF
d5dfta_ SIS.V..KWLPS.....SS.PVt..........GYRVTTT..........PKNgp..GPTK.........TKTAG............PDQTE
d5mtjb_ SLL.I..SWDAP.....AV.TVd..........YYFITYG..........ETGg...NSPVq........EFTVP............GSKST


               60               70              80        90       100                              
                |                |               |         |         |                              
d1a21a1 CDLTDEVVK.DVGQTY......MARVLSYP.....ARNG.NTTGFPEEPPFRNSPEFTPY-----ldtnl......................
d1axib1 ---------.------......--------.....----.-------------------------kecpdyvsagenscyfnssftsiaipy
d1axib2 VPVYSLKV-.--DKEY......EVRVRSKQ.....RN--.-------------------------sgnygefsevlyvtlpqm.........
d1bp3b1 CHFGKQY-T.SMWRTY......IMMVNATN.....QMGS.SFS----------------------delyvdvtyi.................
d1bp3b2 FKILSLHP-.--GQKY......LVQVRCKP.....DHGYwSAWSP--------------------atfiqips...................
d1bpva_ FTVSGLTE-.--DAAY......EFRVIAKNa....AGAI.SPPSEPSDAITCRD-----------dvea.......................
d1bqua2 FTVQDLKP-.--FTEY......VFRIRCMK.....EDGK.GYWSDWSE-----------------easgityedrpskepsf..........
d1cd9b2 FELCGLHQA.PVYTLQ......MRCIRSSL.....PGFW.SPWS---------------------pglqlrptm..................
d1cfba1 FVVQMS---.-PWANY......TFRVIAFN.....KIGA.SPPSAHS------------------dscttq.....................
d1cfba2 IVIADQPT-.--FVKY......LIKVVAIN.....DRGE.SNVAAEE------------------vvgysgedr..................
d1eerb1 CSLPTAD-T.SSFVPL......ELRVTAAS.....GA--.-------------------------pryhrvihin.................
d1eerb2 CVLSNLRG-.--RTRY......TFAVRARMae...PSFG.GFWSEWSEP----------------vsllt......................
d1egja_ MALPALEP-.--STRY......WARVRVRTsrtgyNGIW.SEWSE--------------------arswdtes...................
d1f42a2 ---T-----.------......--------.....----.-------------------------fsvkssrgssdpqgvtcgaatlsaerv
d1f42a3 ATVICRKN-.-----A......SISVRAQD.....RYYS.SSWSEW-------------------asvpcs.....................
d1fnfa1 CTFDNLSP-.--GLEY......NVSVYTVK.....DDKE.SVPI---------------------sdtiipa....................
d1fnfa2 VVLTNLLP-.--GTEY......VVSVSSVY.....EQHE.STPL---------------------rgrqktg....................
d1fnfa3 ITLTNLTP-.--GTEY......VVSIVALN.....GREE.SPL----------------------ligqqst....................
d1fnha1 VVVSGLMV-.--ATKY......EVSVYALK.....DTLT.SRPA---------------------qgvvttle...................
d1fnha2 YTITGLQP-.--GTDY......KIYLYTLN.....DNAR.SSPVVID------------------asta.......................
d1fyhb1 CNISDHV-G.DPSNSL......WVRVKARV.....GQKE.SAYAKSEEFAVCRDG----------k..........................
d1fyhb2 ---------.------......--------.....----.-------------------------mngseiqykiltqkeddcdeiqcqlai
d1gh7a1 CDLSDD---.------......--------.....----.-------------------------mpwsacphprcvprrcvipcqsfvvtd
d1gh7a2 ATLGPEH-L.MPSSTY......VARVRTRL.....APGS.-------------------------rlsgrpskwspevcwdsqpgd......
d1gh7a3 -----P---.------......--------.....----.-------------------------dpathgqyivsvqprraekhiks....
d1i1ra1 ---------.------......--------.....----.-------------------------iaslniqltcniltfgqleqnvygiti
d1iarb1 ---------.------......--------.....----.-------------------------elrllyqlvfllseahtcipennggag
d1iarb2 LRIAASTL-.KSGISY......RARVRAWA.....QAYN.TTWSEWSP-----------------stkwh......................
d1j7vr1 YDLTAVTLDlYHSNGY......RARVRAVD.....GSRH.SQWTVTN------------------trfsvd.....................
d1j7vr2 ---------.------......--------.....----.-------------------------hkkvkheqfslltsgevgefcvqvkps
d1j8ka_ AELQGLRP-.--GSEY......TVSVVALH.....DDME.SQPLI--------------------gtqstaipa..................
d1k85a_ ATISGLAA-.--DTSY......TFTVKAKD.....AAG-.-------------------------nvsaasnavsvkt..............
d1lwra_ HVMLKSLD-.-WNAEY......EVYVVAEN.....QQGK.SKAA---------------------hfvfrtsaq..................
d1n26a2 CQLA-----.------......--------.....----.-------------------------vpegdssfyivsmcvassvgskfsktq
d1n26a3 CVIHDAWS-.--GLRH......VVQLRAQE.....EFGQ.GEWSEWSP-----------------eamgtpwtes.................
d1n6va1 CDLTDEWR-.-STHEA......YVTVLEGF.....SGNT.TLFSCSHNFWLAIDMSFEP------...........................
d1n6va2 ---------.------......--------.....----.-------------------------idklipntnycvsvylehsdeqaviks
d1owwa_ YTIKGLKP-.--GVVY......EGQLISIQ.....QYGH.QEVTRFD------------------fttts......................
d1qg3a1 VELTNLYP-.--YCDY......EMKVCAYG.....AQGE.GPYSS--------------------lvscrthq...................
d1qg3a2 LLIENLRE-.--SQPY......RYTVKARN.....GAGW.GPE----------------------reaiinlatqp................
d1qr4a1 FILRGLDA-.--GTEY......TISLVAEK.....GRHK.SKPTTIK------------------gstv.......................
d1tdqa1 YSVQALRP-.--GSRY......EVSISAVR.....GTNE.SDASSTQ------------------ftte.......................
d1tdqa2 TTLTDLVP-.--GTEY......GVGISAVM.....NSKQ.SIPATMN------------------arte.......................
d1tdqa3 YTLTDLEP-.--GAEY......IISITAER.....GRQQ.SLESTVD------------------af.........................
d1uc6a_ HTITDAYA-.--GKEY......IIQVAAKDne...IGTW.SDWSVAAHATPW-------------tee........................
d1uena_ GMLPGLEP-.--FSHY......TLNVRVVN.....GKGE.GPASPDR------------------vfntpegsgpssg..............
d1ueya_ AQL-NLSP-.--YVNY......SFRVMAVN.....SIGK.SLPSEASEQYL--------------tkasepdknptsgpssg..........
d1ujta_ AVLVNLKK-.--GVTY......EIKVRPYF.....NEFQ.GMDSESKT-----------------vrtteesgpssg...............
d1v5ja_ LLVPGLIK-.--DVLY......EFRLVAFA.....GSFV.SDPSNTA------------------nvstsglsgpssg..............
d1va9a1 YTLDNLKK-.--FAQY......GVVVQAFN.....RAGT.GPSS---------------------seinattle..................
d1wf5a1 VTVKGLVP-.--ARSY......QFRLCAVN.....DVGK.GQFSKDTE-----------------rvslpe.....................
d1wfna1 YRVTGLTA-.--LTTY......TIEVAAMT.....SKGQ.GQVSAST------------------issgvpp....................
d1wfoa1 YTATGLKP-.--ESVY......LFRITAQT.....RKGW.GEAAEA-------------------lvvttekr...................
d1wfta_ CTVTAGQLA.NAHIDYtsrpaiVFRISAKN.....EKGY.GPAT---------------------qirwlqgnsksgpssg...........
d1wfua_ HVVEGLEP-.--RTLY......KFRLKVTS.....PSGE.YEYSP--------------------vvsvattresgpssg............
d1wisa1 MEVPDLNP-.--FTCY......SFRMRQVN.....IVGT.SPPSQPSRKI---------------qtlq.......................
d1wj3a_ AELV----L.PIKEDY......IIEVKATT.....DGGD.GTSS---------------------eqiripritssgpssg...........
d1wk0a_ ITLNDLKP-.--AMDY......HAKVQAEY.....NSIK.GTPSEAEIFTTL-------------scepdipnpprisgpssg.........
d1x3da1 FKITKLSP-.--AMGC......KFRLSARN.....DYGT.SGFSE--------------------evlyytsgc..................
d1x4xa1 YEIKGLSP-.--ATTY......YCRVQALS.....VVGA.GPFSEV-------------------vacvtpps...................
d1x4ya1 HSISHLQP-.--ETSY......DIKMQCFN.....EGGE.SEFSNV-------------------micetkar...................
d1x4za1 VEITGLEK-.--GISY......KFRVRALN.....MLGE.SEPSAPSRPYVV-------------sg.........................
d1x5aa1 VLLTKLQP-.--DTTY......IVRVRTLT.....PLGP.GPFSPDHEF----------------rtspp......................
d1x5fa1 VTIQNLMP-.--ATVY......IFRVMAQN.....KHGS.GESSA--------------------plrvetqpe..................
d1x5ga1 YTINGLKK-.--YTEY......SFRVVAYN.....KHGP.G------------------------vstpdvavrtlsd..............
d1x5ha1 QLIEGLDR-.--GTEY......NFRVAALT.....INGT.GPAT---------------------dwlsaetfesdldetrvpev.......
d1x5ia1 YTIENLDP-.--SSHY......VITLKAFN.....NVGE.GIPLYES------------------avtrpht....................
d1x5ja1 YLVTGLKP-.--NTLY......EFSVMVTK.....GRRS.STWSMTA------------------hgttfel....................
d1x5ka1 HQIQELTL-.--DTPY......YFKIQARN.....SKGM.GPMSEAVQF----------------rtpka......................
d1x5la1 ATVSGLKP-.--GTRY......VFQVRART.....SAGC.GRFSQ--------------------amevetgkp..................
d1x5xa1 YTVKNLRR-.--STKY......KFKVIAYN.....SEGK.SNPSEVVEFTTCPD-----------...........................
d1x5ya1 FTVKDLPT-.--GARI......LFRVVGVN.....IAGR.SEPATLLQPVTIR------------e..........................
d1x5za1 YRLQGLKP-.--NSLY......YFRLAARS.....PQGL.GA-----------------------staeisartmqs...............
d2b5ib1 ---------.------......--------.....----.-------------------------ellpvsqaswacnlilgapdsqklttv
d2b5ib2 QEWICLETL.TPDTQY......EFQVRVKP.....LQGE.-------------------------fttwspwsqplafrtkp..........
d2b5ic1 FSLPSVDG-.--QKRY......TFRVRSRF.....NPLC.GSAQHWSEW----------------shpihw.....................
d2b5ic2 ---------.------......--------.....----.-------------------------ltlhywyknsdndkvqkcshylfseei
d2crma1 CDR-----L.NPGCFY......RLRVYCIS.....DGGQ.SAVSES-------------------llvqtpav...................
d2crza1 CTVSSLLP-.--GKTY......SFRLRAAN.....KMGF.GPFSEK-------------------cdittapg...................
d2cspa1 ---------.------......--------.....----.-------------------------fptadstavelvrlrsleakgvtvrtl
d2cuha1 YPLHDLVL-.--HTNY......TATVRGLR.....GPNL.TSPASIT------------------fttgleaprdleakevtp.........
d2cuia1 ---------.------......--------.....----.-------------------------fllrfgvpspstlephprpllqrelmv
d2d9qb3 CSIPRKHL-.LLYQNM......GIWVQAEN.....ALGT.SM-----------------------spqlcldpmdvvk..............
d2db8a1 CTVDGLHF-.--NSTY......NARVKAFN.....KTGV.SPYSKT-------------------lvlqtseg...................
d2dbja1 ARISVQVH-.--NATC......TVRIAAVT.....RGGV.GPFSD--------------------pvkifipah..................
d2dlha1 ITTIGNLV-.-PQKTY......SVKVLAFT.....SIGD.GPLS---------------------sdiqvitqtg.................
d2dmka1 YTVHGLQS-.--GTRY......IFIVKAIN.....QAGS.R------------------------nseptrlktnsqpfk............
d2dn7a1 FTVTGLHK-.--GTTY......IFRLAAKN.....RAGL.GEEFEKE------------------irtpedl....................
d2doca1 VVLNNLEP-.--NTTY......EIRVAAVN.....GKGQ.GDYSKIEIFQT--------------lpv........................
d2dtge1 CRLRGLS--.--PGNY......SVRIRATS.....LAGN.GSWTEPTYFYV--------------tdyl.......................
d2dtge2 ---------.------......--------.....----.-------------------------erqaedselfeldyclkglklpsrtws
d2dtge3 ---------.------......--------.....----.-------------------------yqnvtefdgqdacgsnswtvvdidppl
d2e7ha1 AELRGLKR-.--GASY......LVQVRARS.....EAGY.GPFGQ--------------------ehhsqtqld..................
d2ed7a1 LTVGNLKP-.--EAMY......TFRVVAYN.....EWGP.GESS---------------------qpikvatqpe.................
d2ed9a1 YLFTGLEK-.--GSQY......SFQVSAMT.....VNGT.GPPSNW-------------------ytaetpen...................
d2edea1 HQIMDLNL-.--DTMY......YFRIQARN.....SKGV.GPLS---------------------dpilfrtlkv.................
d2edxa1 WDLVGLEK-.--WTEY......RVWVRAHT.....DVGP.GPESSPVLVRTDEDVPSGPP-----rkve.......................
d2edya1 FTLTGLKP-.--DTTY......DIKVRAWT.....SKGS.GPLSP--------------------siqsrtmpv..................
d2ee2a1 ARLENLLP-.--DTQY......FIEVGACN.....SAGC.GPPSDM-------------------ieaftkka...................
d2ee3a1 AMLGPLSS-.--STTY......TVRVTCLY.....PGGG.SSTL---------------------tgrvttkkapsps..............
d2fnba_ YTVTGLEP-.--GIDY......DISVITLI.....NGGE.SAPTTLT------------------qqt........................
d2haza1 VTIVGLKP-.--ETTY......AVRLAALN.....GKGL.GEISAASEFK---------------tqpv.......................
d2hfta1 CDLTDEIVK.DVKQTY......LARVFSYP.....AGNV.ESTGSAGEPLYENSPEFTPY-----let........................
d2hfta2 --LIDVDK-.--GENY......CFSVQAVI.....PSRT.VN-----------------------rkstdspvecmg...............
d2ibga1 FKIAPLET-.--ATMY......EFKLQSFS.....AASA.SEFS---------------------a..........................
d2ic2a1 ASVTDLKP-.--QHTY......RFRILAVY.....SNND.NKESNTSA-----------------kfylqp.....................
d2mfna2 ATINNIKP-.--GADY......TITLYAVT.....GRGD.SPASSKPV-----------------sinykt.....................
d2rbla_ YSIGNLKP-.--DTEY......EVSLISRR.....GDMS.SNPAKET------------------ftt........................
d2yrza1 VVVEDLLP-.--NHSY......VFRVRAQS.....QEGW.G------------------------reregvitiesqv..............
d2yuxa1 ATITELVI-.--GNEY......YFRVFSEN.....MCGL.SEDATMT------------------kesaviardgkiyk.............
d3d1md_ HMIGHLQP-.--ETSY......DIKMQCFN.....EGGE.SEFSN--------------------vmicetk....................
d3lpwa1 WKVDQLQE-.--GCSY......YFRVLAEN.....EYGI.GLPAETAESV---------------kaser......................
d3lpwb2 ATITGLIQ-.--GEEY......SFRVSAQN.....EKGI.SDPRQLSVPVIAKD-----------...........................
d3wihb_ VVIPFLVP-.--GIRY......SVEVAAST.....GAGS.GVKSEPQ------------------fiqld......................
d4eq2a1 CDLSEEI-N.EIFHSY......WFRIKAIV.....GSQQ.SQYVETDEFVLQKH-----------gk.........................
d4eq3a2 ---------.------......--------.....----.-------------------------nesrknftvadcemnecnlsipvpseg
d4lpxa1 YDLTGLKP-.--GTEY......TVSIYGVL.....----.-------------------------ipfpnlsnplsaeftt...........
d4n68a1 VILTGLEG-.--NTLY......HFTVRAYN.....GAGY.GPPSS--------------------evsattkk...................
d5dfta_ MTIEGLQP-.--TVEY......VVSVYAQN.....PSGE.SQPLVQT------------------avttipap...................
d5mtjb_ ATISGLKP-.--GVDY......TITVYAWY.....YYDD.EYYMNESS-----------------pisinyrt...................


                                                                                                    
                                                                                                    
d1a21a1 ............................................................................................
d1axib1 cikltsnggtvdekcfsvdeivq.....................................................................
d1axib2 ............................................................................................
d1bp3b1 ............................................................................................
d1bp3b2 ............................................................................................
d1bpva_ ............................................................................................
d1bqua2 ............................................................................................
d1cd9b2 ............................................................................................
d1cfba1 ............................................................................................
d1cfba2 ............................................................................................
d1eerb1 ............................................................................................
d1eerb2 ............................................................................................
d1egja_ ............................................................................................
d1f42a2 rgdnkeyeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii.......................................
d1f42a3 ............................................................................................
d1fnfa1 ............................................................................................
d1fnfa2 ............................................................................................
d1fnfa3 ............................................................................................
d1fnha1 ............................................................................................
d1fnha2 ............................................................................................
d1fyhb1 ............................................................................................
d1fyhb2 pvsslnsqycvsaegvlhvwgvttekskevcitifn........................................................
d1gh7a1 vdyfsfqpdrplgtrltvtl........................................................................
d1gh7a2 ............................................................................................
d1gh7a3 ............................................................................................
d1i1ra1 isg.........................................................................................
d1iarb1 cvchllmddvvsadnytldlwagqqllwkgsfkpsehv......................................................
d1iarb2 ............................................................................................
d1j7vr1 ............................................................................................
d1j7vr2 vasrsnkgmwskeecislt.........................................................................
d1j8ka_ ............................................................................................
d1k85a_ ............................................................................................
d1lwra_ ............................................................................................
d1n26a2 tfqgcgil....................................................................................
d1n26a3 ............................................................................................
d1n6va1 ............................................................................................
d1n6va2 plkctllppgqesefs............................................................................
d1owwa_ ............................................................................................
d1qg3a1 ............................................................................................
d1qg3a2 ............................................................................................
d1qr4a1 ............................................................................................
d1tdqa1 ............................................................................................
d1tdqa2 ............................................................................................
d1tdqa3 ............................................................................................
d1uc6a_ ............................................................................................
d1uena_ ............................................................................................
d1ueya_ ............................................................................................
d1ujta_ ............................................................................................
d1v5ja_ ............................................................................................
d1va9a1 ............................................................................................
d1wf5a1 ............................................................................................
d1wfna1 ............................................................................................
d1wfoa1 ............................................................................................
d1wfta_ ............................................................................................
d1wfua_ ............................................................................................
d1wisa1 ............................................................................................
d1wj3a_ ............................................................................................
d1wk0a_ ............................................................................................
d1x3da1 ............................................................................................
d1x4xa1 ............................................................................................
d1x4ya1 ............................................................................................
d1x4za1 ............................................................................................
d1x5aa1 ............................................................................................
d1x5fa1 ............................................................................................
d1x5ga1 ............................................................................................
d1x5ha1 ............................................................................................
d1x5ia1 ............................................................................................
d1x5ja1 ............................................................................................
d1x5ka1 ............................................................................................
d1x5la1 ............................................................................................
d1x5xa1 ............................................................................................
d1x5ya1 ............................................................................................
d1x5za1 ............................................................................................
d2b5ib1 divtlrvlcregvrwrvmaiqdfkpfen................................................................
d2b5ib2 ............................................................................................
d2b5ic1 ............................................................................................
d2b5ic2 tsgcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl....................................................
d2crma1 ............................................................................................
d2crza1 ............................................................................................
d2cspa1 saqgesvdsavaavppellvpptphp..................................................................
d2cuha1 ............................................................................................
d2cuia1 pgtrhsavlrdlrsgtlysltlyglrgphkadsiqgtartl...................................................
d2d9qb3 ............................................................................................
d2db8a1 ............................................................................................
d2dbja1 ............................................................................................
d2dlha1 ............................................................................................
d2dmka1 ............................................................................................
d2dn7a1 ............................................................................................
d2doca1 ............................................................................................
d2dtge1 ............................................................................................
d2dtge2 ppfesedsqkhnqseyedsageccscpktdsqilkeleessfrktfedylhnvvfvprpsrkrrslgdvgnagnneehrpfekvvnkeslvi
d2dtge3 rsndpksqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiyvqtda......................................
d2e7ha1 ............................................................................................
d2ed7a1 ............................................................................................
d2ed9a1 ............................................................................................
d2edea1 ............................................................................................
d2edxa1 ............................................................................................
d2edya1 ............................................................................................
d2ee2a1 ............................................................................................
d2ee3a1 ............................................................................................
d2fnba_ ............................................................................................
d2haza1 ............................................................................................
d2hfta1 ............................................................................................
d2hfta2 ............................................................................................
d2ibga1 ............................................................................................
d2ic2a1 ............................................................................................
d2mfna2 ............................................................................................
d2rbla_ ............................................................................................
d2yrza1 ............................................................................................
d2yuxa1 ............................................................................................
d3d1md_ ............................................................................................
d3lpwa1 ............................................................................................
d3lpwb2 ............................................................................................
d3wihb_ ............................................................................................
d4eq2a1 ............................................................................................
d4eq3a2 stycvsakghffddlivgasseesciwvpi..............................................................
d4lpxa1 ............................................................................................
d4n68a1 ............................................................................................
d5dfta_ ............................................................................................
d5mtjb_ ............................................................................................


                                             
                                             
d1a21a1 .....................................
d1axib1 .....................................
d1axib2 .....................................
d1bp3b1 .....................................
d1bp3b2 .....................................
d1bpva_ .....................................
d1bqua2 .....................................
d1cd9b2 .....................................
d1cfba1 .....................................
d1cfba2 .....................................
d1eerb1 .....................................
d1eerb2 .....................................
d1egja_ .....................................
d1f42a2 .....................................
d1f42a3 .....................................
d1fnfa1 .....................................
d1fnfa2 .....................................
d1fnfa3 .....................................
d1fnha1 .....................................
d1fnha2 .....................................
d1fyhb1 .....................................
d1fyhb2 .....................................
d1gh7a1 .....................................
d1gh7a2 .....................................
d1gh7a3 .....................................
d1i1ra1 .....................................
d1iarb1 .....................................
d1iarb2 .....................................
d1j7vr1 .....................................
d1j7vr2 .....................................
d1j8ka_ .....................................
d1k85a_ .....................................
d1lwra_ .....................................
d1n26a2 .....................................
d1n26a3 .....................................
d1n6va1 .....................................
d1n6va2 .....................................
d1owwa_ .....................................
d1qg3a1 .....................................
d1qg3a2 .....................................
d1qr4a1 .....................................
d1tdqa1 .....................................
d1tdqa2 .....................................
d1tdqa3 .....................................
d1uc6a_ .....................................
d1uena_ .....................................
d1ueya_ .....................................
d1ujta_ .....................................
d1v5ja_ .....................................
d1va9a1 .....................................
d1wf5a1 .....................................
d1wfna1 .....................................
d1wfoa1 .....................................
d1wfta_ .....................................
d1wfua_ .....................................
d1wisa1 .....................................
d1wj3a_ .....................................
d1wk0a_ .....................................
d1x3da1 .....................................
d1x4xa1 .....................................
d1x4ya1 .....................................
d1x4za1 .....................................
d1x5aa1 .....................................
d1x5fa1 .....................................
d1x5ga1 .....................................
d1x5ha1 .....................................
d1x5ia1 .....................................
d1x5ja1 .....................................
d1x5ka1 .....................................
d1x5la1 .....................................
d1x5xa1 .....................................
d1x5ya1 .....................................
d1x5za1 .....................................
d2b5ib1 .....................................
d2b5ib2 .....................................
d2b5ic1 .....................................
d2b5ic2 .....................................
d2crma1 .....................................
d2crza1 .....................................
d2cspa1 .....................................
d2cuha1 .....................................
d2cuia1 .....................................
d2d9qb3 .....................................
d2db8a1 .....................................
d2dbja1 .....................................
d2dlha1 .....................................
d2dmka1 .....................................
d2dn7a1 .....................................
d2doca1 .....................................
d2dtge1 .....................................
d2dtge2 sglrhftgyrielqacnqdtpeercsvaayvsartmp
d2dtge3 .....................................
d2e7ha1 .....................................
d2ed7a1 .....................................
d2ed9a1 .....................................
d2edea1 .....................................
d2edxa1 .....................................
d2edya1 .....................................
d2ee2a1 .....................................
d2ee3a1 .....................................
d2fnba_ .....................................
d2haza1 .....................................
d2hfta1 .....................................
d2hfta2 .....................................
d2ibga1 .....................................
d2ic2a1 .....................................
d2mfna2 .....................................
d2rbla_ .....................................
d2yrza1 .....................................
d2yuxa1 .....................................
d3d1md_ .....................................
d3lpwa1 .....................................
d3lpwb2 .....................................
d3wihb_ .....................................
d4eq2a1 .....................................
d4eq3a2 .....................................
d4lpxa1 .....................................
d4n68a1 .....................................
d5dfta_ .....................................
d5mtjb_ .....................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0034836 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7524
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Nocardia farcinica IFM 10152
NoYes   Mycobacterium marinum M
NoYes   Corynebacterium jeikeium K411
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Micrococcus luteus NCTC 2665
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Meiothermus ruber DSM 1279
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Enterococcus hirae ATCC 9790
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus acidophilus 30SC
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Isosphaera pallida ATCC 43644
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Deferribacter desulfuricans SSM1
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Neisseria meningitidis alpha14
NoYes   Thiomonas arsenitoxydans
NoYes   Leptothrix cholodnii SP-6
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Collimonas fungivorans Ter331
NoYes   Achromobacter xylosoxidans
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Roseobacter denitrificans OCh 114
NoYes   Paracoccus denitrificans PD1222
NoYes   Azospirillum brasilense Sp245
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas mediterranea MMB-1
NoYes   Halomonas elongata DSM 2581
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Escherichia blattae DSM 4481
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella boydii CDC 3083-94
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter arcticus 273-4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Cycloclasticus sp. P1
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanosaeta concilii GP6
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanocorpusculum labreanum Z
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Pyrococcus furiosus COM1
NoYes   Picrophilus torridus DSM 9790
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Cyanothece sp. PCC 7822
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Mycoplasma hyorhinis SK76
NoYes   Mycoplasma hyorhinis MCLD
NoYes   Mycoplasma hyorhinis HUB-1
NoYes   Mycoplasma hyorhinis DBS 1050
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Bifidobacterium longum NCC2705
NoYes   Bifidobacterium longum DJO10A
NoYes   Bifidobacterium longum subsp. infantis 157F
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. longum KACC 91563
NoYes   Bifidobacterium longum subsp. longum BBMN68
NoYes   Bifidobacterium longum subsp. longum F8
NoYes   Bifidobacterium longum subsp. longum JCM 1217
NoYes   Bifidobacterium thermophilum RBL67
NoYes   Bifidobacterium animalis subsp. animalis ATCC 25527
NoYes   Bifidobacterium animalis subsp. lactis Bl12
NoYes   Bifidobacterium animalis subsp. lactis B420
NoYes   Bifidobacterium animalis subsp. lactis ATCC 27673
NoYes   Bifidobacterium animalis subsp. lactis BLC1
NoYes   Bifidobacterium animalis subsp. lactis CNCM I-2494
NoYes   Bifidobacterium animalis subsp. lactis Bi-07
NoYes   Bifidobacterium animalis subsp. lactis V9
NoYes   Bifidobacterium animalis subsp. lactis DSM 10140
NoYes   Bifidobacterium animalis subsp. lactis BB-12
NoYes   Bifidobacterium animalis subsp. lactis AD011
NoYes   Bifidobacterium breve UCC2003
NoYes   Bifidobacterium asteroides PRL2011
NoYes   Bifidobacterium bifidum PRL2010
NoYes   Bifidobacterium bifidum BGN4
NoYes   Actinomyces graevenitzii C83
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. VS
NoYes   Dehalococcoides sp. CBDB1
NoYes   Chthonomonas calidirosea T49
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus thermophilus JL-18
NoYes   Eubacterium siraeum V10Sc8a
NoYes   Clostridium thermocellum DSM 1313
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Ruminococcus champanellensis 18P13
NoYes   Clostridium acidurici 9a
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Roseburia intestinalis XB6B4
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium sp. SY8519
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Thermoanaerobacter sp. X513
NoYes   Halobacteroides halobius DSM 5150
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus LOCK900
NoYes   Lactobacillus rhamnosus ATCC 8530
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus johnsonii N6.2
NoYes   Lactobacillus johnsonii DPC 6026
NoYes   Lactobacillus johnsonii NCC 533
NoYes   Lactobacillus amylovorus GRL 1112
NoYes   Lactobacillus helveticus R0052
NoYes   Lactobacillus helveticus H10
NoYes   Lactobacillus helveticus CNRZ32
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus delbrueckii subsp. bulgaricus 2038
NoYes   Lactobacillus acidophilus La-14
NoYes   Lactobacillus acidophilus NCFM
NoYes   Lactococcus garvieae Lg2
NoYes   Lactococcus lactis subsp. lactis IO-1
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Lactococcus lactis subsp. cremoris SK11
NoYes   Streptococcus intermedius B196
NoYes   Streptococcus intermedius C270
NoYes   Streptococcus anginosus C238
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
NoYes   Streptococcus thermophilus JIM 8232
NoYes   Streptococcus salivarius JIM8777
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Alistipes shahii WAL 8301
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Brachyspira pilosicoli WesB
NoYes   Helicobacter cinaedi ATCC BAA-847
NoYes   Brachyspira pilosicoli B2904
NoYes   Brachyspira pilosicoli P43/6/78
NoYes   Borrelia garinii NMJW1
NoYes   Borrelia garinii BgVir
NoYes   Borrelia afzelii HLJ01
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi CA382
NoYes   Borrelia burgdorferi JD1
NoYes   Borrelia burgdorferi N40
NoYes   Borrelia burgdorferi ZS7
NoYes   Borrelia miyamotoi LB-2001
NoYes   Treponema pedis str. T A4
NoYes   Treponema pallidum str. Fribourg-Blanc
NoYes   Treponema pallidum subsp. pertenue str. Gauthier
NoYes   Treponema pallidum subsp. pertenue str. CDC2
NoYes   Treponema pallidum subsp. pertenue str. SamoaD
NoYes   Treponema pallidum subsp. pallidum str. Mexico A
NoYes   Treponema pallidum subsp. pallidum str. Chicago
NoYes   Treponema pallidum subsp. pallidum DAL-1
NoYes   Treponema pallidum subsp. pallidum str. Nichols
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Arcobacter butzleri 7h1h
NoYes   Arcobacter butzleri ED-1
NoYes   Campylobacter jejuni Waterborne C.jejuni Outbreak
NoYes   Campylobacter jejuni RM1221
NoYes   Campylobacter jejuni subsp. jejuni 00-2544
NoYes   Campylobacter jejuni subsp. jejuni 00-2538
NoYes   Campylobacter jejuni subsp. jejuni 00-2426
NoYes   Campylobacter jejuni subsp. jejuni 00-2425
NoYes   Campylobacter jejuni subsp. jejuni PT14
NoYes   Campylobacter jejuni subsp. jejuni ICDCCJ07001
NoYes   Campylobacter jejuni subsp. jejuni S3
NoYes   Campylobacter jejuni subsp. jejuni M1
NoYes   Campylobacter jejuni subsp. jejuni IA3902
NoYes   Campylobacter jejuni subsp. jejuni 81116
NoYes   Campylobacter jejuni subsp. jejuni 81-176
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
NoYes   Campylobacter coli 76339
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Helicobacter cetorum MIT 99-5656
NoYes   Helicobacter pylori BM012S
NoYes   Helicobacter pylori BM012A
NoYes   Helicobacter pylori SouthAfrica20
NoYes   Helicobacter pylori UM298
NoYes   Helicobacter pylori UM066
NoYes   Helicobacter pylori UM037
NoYes   Helicobacter pylori UM299
NoYes   Helicobacter pylori UM032
NoYes   Helicobacter pylori OK310
NoYes   Helicobacter pylori OK113
NoYes   Helicobacter pylori Rif2
NoYes   Helicobacter pylori Rif1
NoYes   Helicobacter pylori HUP-B14
NoYes   Helicobacter pylori PeCan18
NoYes   Helicobacter pylori Shi169
NoYes   Helicobacter pylori Shi112
NoYes   Helicobacter pylori Shi417
NoYes   Helicobacter pylori XZ274
NoYes   Helicobacter pylori Aklavik86
NoYes   Helicobacter pylori Aklavik117
NoYes   Helicobacter pylori SNT49
NoYes   Helicobacter pylori Puno135
NoYes   Helicobacter pylori Puno120
NoYes   Helicobacter pylori ELS37
NoYes   Helicobacter pylori Gambia94/24
NoYes   Helicobacter pylori SouthAfrica7
NoYes   Helicobacter pylori India7
NoYes   Helicobacter pylori Lithuania75
NoYes   Helicobacter pylori 2017
NoYes   Helicobacter pylori 2018
NoYes   Helicobacter pylori 908
NoYes   Helicobacter pylori F57
NoYes   Helicobacter pylori F30
NoYes   Helicobacter pylori F16
NoYes   Helicobacter pylori Sat464
NoYes   Helicobacter pylori Cuz20
NoYes   Helicobacter pylori PeCan4
NoYes   Helicobacter pylori SJM180
NoYes   Helicobacter pylori B8
NoYes   Helicobacter pylori 52
NoYes   Helicobacter pylori v225d
NoYes   Helicobacter pylori 83
NoYes   Helicobacter pylori 35A
NoYes   Helicobacter pylori P12
NoYes   Helicobacter pylori G27
NoYes   Helicobacter pylori Shi470
NoYes   Helicobacter pylori HPAG1
NoYes   Helicobacter pylori 51
NoYes   Helicobacter pylori F32
NoYes   Helicobacter pylori J99
NoYes   Helicobacter pylori 26695
NoYes   Helicobacter pylori 26695
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Neisseria meningitidis G2136
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cepacia GG4
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Caulobacter crescentus CB15
NoYes   Octadecabacter arcticus 238
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Sinorhizobium meliloti SM11
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Actinobacillus pleuropneumoniae serovar 7 str. AP76
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio sp. EJY3
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Idiomarina loihiensis GSL 199
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Thioflavicoccus mobilis 8321
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis AJ13355
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter baumannii ZW85-1
NoYes   Acinetobacter baumannii MDR-TJ
NoYes   Acinetobacter baumannii ATCC 19606
NoYes   Acinetobacter baumannii AB307-0294
NoYes   Acinetobacter baumannii AB0057
NoYes   Cycloclasticus zancles 7-ME
NoYes   Francisella tularensis subsp. mediasiatica FSC147
NoYes   Francisella tularensis subsp. holarctica F92
NoYes   Francisella tularensis subsp. holarctica FTNF002-00
NoYes   Francisella tularensis subsp. holarctica OSU18
NoYes   Francisella tularensis subsp. holarctica LVS
NoYes   Francisella tularensis subsp. holarctica FSC200
NoYes   Francisella tularensis subsp. tularensis TIGB03
NoYes   Francisella tularensis subsp. tularensis TI0902
NoYes   Francisella tularensis subsp. tularensis NE061598
NoYes   Francisella tularensis subsp. tularensis FSC198
NoYes   Francisella tularensis subsp. tularensis SCHU S4
NoYes   Francisella cf. novicida Fx1
NoYes   Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1
NoYes   Sulfolobus islandicus LAL14/1
NoYes   Sulfolobus islandicus REY15A
NoYes   Sulfolobus islandicus HVE10/4
NoYes   Sulfolobus islandicus Y.G.57.14
NoYes   Sulfolobus islandicus L.S.2.15
NoYes   Sulfolobus islandicus M.16.27
NoYes   Sulfolobus islandicus M.14.25
NoYes   Sulfolobus islandicus M.16.4
NoYes   Sulfolobus islandicus L.D.8.5
NoYes   Sulfolobus solfataricus 98/2
NoYes   Sulfolobus acidocaldarius Ron12/I
NoYes   Sulfolobus acidocaldarius N8
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Pyrococcus furiosus DSM 3638
NoYes   Ferroplasma acidarmanus fer1
NoYes   Halovivax ruber XH-70
NoYes   Natronobacterium gregoryi SP2
NoYes   Halorhabdus tiamatea SARL4B
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot Spring microbial communities from Yellowstone Obsidian Hot Spring, Sample 10594 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP2 from Nymph Lake 10 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community lean1 (meta-genome)
NoYes   Mouse Gut Community lean2 (meta-genome)
NoYes   Mouse Gut Community lean3 (meta-genome)
NoYes   Mouse Gut Community ob1 (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]