SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Fibronectin type III alignments

These alignments are sequences aligned to the 0034836 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                              10    
                                                                                               |    
d1a21a1 ..........................................................................t-GRAYNLTW...KSTNF
d1axib1 .............................epkftkcrsperetfschwtdevhhgtknegpiqlfytrrntqewt---------...-----
d1axib2 ...............................................................pdppialnwtll-----NVSL...TGIHA
d1bp3b1 .......................................................................lppg--KPEIFKC...RSPNK
d1bp3b2 ......................................................vqpdpplelavevkqpedrkp---------...-----
d1bpva_ ........................................................................spi-DPPGKPVPl..NITRH
d1bqua2 .......................................................................ykvkPNPPHNLSVi..NSEEL
d1cd9b2 ....................................................kleppmlqaldigpdvvshqpgc---------...-----
d1cfba1 ..............................................................ivqdvpnapkltg--------I...TCQAD
d1cfba2 ....................................................................pdvpfkn---PDNVVGq..GTEPN
d1eerb1 ....................................dpkfeskaallaargpeellcfterledlvcfweeaasa---------...-----
d1eerb2 .......................................................evvlldapvglvarladesg---------...-----
d1egja_ .......................................................................iqma---PPSLNV...TKDGD
d1f42a2 ................................giwstdilkdqkepknktflrceaknysgrftcwwlttistdl---------...-----
d1f42a3 ..........................................................................kPDPPKNLQLkp.LKNSR
d1fnfa1 ..........................................................................pLSPPTNLHL...EANPD
d1fnfa2 ...........................................................................VPPPTDLRFt..NIGPD
d1fnfa3 ..........................................................................l-DSPTGIDFs..DITAN
d1fnha1 ...........................................................................-PAPTDLKFt..QVTPT
d1fnha2 ..........................................................................nVSPPRRARVt..DATET
d1fyhb1 ...........................................................................VPTPTNVTI...ESYNM
d1fyhb2 ...............................igppkldirkeekqimidifhpsvfvngdeqevdydpettcyir---------...-----
d1gh7a1 ..........................eetiplqtlrcyndytshitcrwadtqdaqrlvnvtlirrvnedllepv---------...-----
d1gh7a2 ......................................................................tqhvqPPEPRDLQI...STDQD
d1gh7a3 eaqpqnlecffdgaavlscswevrkevassvsfglfykpspdagsavllreeecspvlreglgslhtrhhcqipv---------...-----
d1i1ra1 ...................................lldpcgyispespvvqlhsnftavcvlkekcmdyfhvnan---------...-----
d1iarb1 ........................................................fkvlqeptcvsdymsistc---------...-----
d1iarb2 ..........................................................................kPRAPGNLTVh..TNVSD
d1j7vr1 .......................................................................gtel-PSPPSVWF...EAEFF
d1j7vr2 ................evtltvgsvnleihngfilgkiqlprpkmapaqdtyesifshfreyeiairkvpgqftf---------...-----
d1j8ka_ .........................................................................ni-DRPKGLAFt..DVDVD
d1k85a_ .......................................................................hmap-TAPTNLASt..AQTTS
d1lwra_ ................................................agpsapklegqmgedgnsikvnlikqd---------...-----
d1n26a2 ..............ppeepqlscfrksplsnvvcewgprstpslttkavllvrkfqnspaedfqepcqysqesqk---------...-----
d1n26a3 ..........................................................................qPDPPANITVtavARNPR
d1n6va1 ..................................................................sydspdytd--ESCTFKI...SLRNF
d1n6va2 ................pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnfty---------...-----
d1owwa_ ...............................................................sgpvevfitetp---------...-SQPN
d1qg3a1 .........................................................................dl-GAPQNPNAk..AAGSR
d1qg3a2 .........................................................................evPSEPGRLAFn..VVSST
d1qr4a1 ..........................................................................d--NPKDLEVs..DPTET
d1tdqa1 ......................................................................ipvid--GPTQILVr..DVSDT
d1tdqa2 ..........................................................................i-DAPKNLRVg..SRTAT
d1tdqa3 ..........................................................................l-DSPRDLMVt..ASSET
d1uc6a_ ....................................................................gplgsvkPDPPENVVArpvPSNPR
d1uena_ ...........................................................gssgssghsgedlpmv--APGNVRVn..VVNST
d1ueya_ ...........................................................gssgssgptpapvydvPNPPFDLELt..DQLDK
d1ujta_ ................................................gssgssgrqvqkelgdvlvrlhnpvvl---------...--TPT
d1v5ja_ ...................................................................gssgssgl-SPPRGLVA...VRTPR
d1va9a1 ..................................................................isteeaapd-GPPMDVTLq..PVTSQ
d1wf5a1 .....................................................rsahlrvrqlphapehpvatls---------...TVERR
d1wfna1 ................................................................pqlvrthedvp-GPVGHLSFs..EILDT
d1wfoa1 .......................................................rigdgspshppilertlddvPGPPMGILFp..EVRTT
d1wfta_ ....................................................................gssgssgPGAPSTVRI...SKNVD
d1wfua_ ...........................................................gssgssgmephkvvpl-SKPHPPVVg..KVTHH
d1wisa1 .................................................................tissgvppelPGPPTNLGIs..NIGPR
d1wj3a_ .......................................................gssgssgtvnvttkktppsq--PPGNVVW...NATDT
d1wk0a_ .................................................gssgssgdeetkafeallsnivkpva--------S...DIQAR
d1x3da1 .................................................................aeifttlscePDIPNPPRIa..NRTKN
d1x4xa1 .............................................................pdqckppqvtcrsa---------...----T
d1x4ya1 ................................................................pvagpyitftd---------...AVNET
d1x4za1 .................................................................sqpdhgrlspPEAPDRPTIs..TASET
d1x5aa1 .......................................................aeslsglslklvkkeprqle---------...-----
d1x5fa1 .................................................................ehapattgplPSAPRDVVAs..LVSTR
d1x5ga1 .................................................................rvetqpevqlPGPAPNLRAy..AASPT
d1x5ha1 ..............................................................dvavrtlsdvpsa--APQNLSL...EVRNS
d1x5ia1 ......................................................patdwlsaetfesdldetrvp-EVPSSLHV...RPLVT
d1x5ja1 ........................................................................pmm--PPVGVQAs..ILSHD
d1x5ka1 ...............................................................tahgttfelvpt-SPPKDVTVvskEGKPK
d1x5la1 ............................................................qaapsqvvvirqera---------...--GQT
d1x5xa1 .............................................................psmpaspvltkagi---------...----T
d1x5ya1 .........................................................................pt-SAPQHLTVe..DVTDT
d1x5za1 .................................................................diqvitqtgvPGQPLNFKAe..PESET
d2b5ib1 .................................sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqt---------...-----
d2b5ib2 .......................................................................lrlm--APISLQVv..HVETH
d2b5ic1 .......................................................................vipw--APENLTLh..KLSES
d2b5ic2 ..................................................................plpevqcfv---------...-----
d2crma1 ................................................................vvefttcpdkp-GIPVKPSVkg.KIHSH
d2crza1 ..........................................................ppgpclpprlqgrpkak---------...-----
d2cspa1 .................................................................vefstlpagpPAPPQDVTVqa.GVTPA
d2cuha1 ..........................................................................p-DGPTQLRAl..NLTEG
d2cuia1 .................................................................sgsrprlsql-------SVt..DVTTS
d2d9qb3 ......................................................................gyppa--IPHNLSClm.NLTTS
d2dlha1 ...............................................................pvltqtseqaps-SAPRDVQAr..MLSST
d2dn7a1 ..............................................................pgrptmmisttam---------...----N
d2dtge1 ............................................................eakaddivgpvthei---------...-FENN
d2dtge2 ..................................................................tnpsvpldp-------ISv..SNSSS
d2dtge3 ...........................................................cenellkfsyirtsfd---------...-----
d2fnba_ .................................................................mrgsevpqlt-----DLSFv..DITDS
d2haza1 ..........................................................dtpsspsidqvepysst---------...-----
d2hfta1 ...................................................................sgttntva---AYNLTW...KSTNF
d2hfta2 ................................nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgk---------...-----
d2ibga1 ....................................................................gaaldpm-PVPELLEIe..EYSET
d2ic2a1 ..........................................................................y--PPTPPNVt..RLSDE
d2mfna2 ..........................................................................d--IPRDLEVi..ASTPT
d2rbla_ ..........................................................................l-DAPSQIEVk..DVTDT
d2yrza1 .................................................................shdsrltagvPDTPTRLVFs..ALGPT
d3d1md_ ................................................................pitgphiayte---------...AVSDT


               20                         30                40                             50       
                |                          |                 |                              |       
d1a21a1 KTI.L..EWEPK.....SI.DH...........VYTVQIS....TRL....ENWK.........SKCFL............TAETECDLTDE
d1axib1 ---.-..-----.....--.--...........-------....---....QEW-.........-----............-----------
d1axib2 DIQ.V..RWEAPr....NA.DIqkgwmvl....EYELQYK....EVN....ETKW.........KMMDP............ILTTSVPVYSL
d1bp3b1 ETF.T..CWWRP.....GT.DGglpt.......NYSLTYH....REG....ETLMhec......PDYIT............GGPNSCHFGKQ
d1bp3b2 YLW.I..KWSPPt....LI.DLktgwftl....LYEIRLK....PEKa...AEWE.........IHFA-............GQQTEFKILSL
d1bpva_ TVT.L..KWAKP.....EY.TGgfkit......SYIVEKR....DLPn...GRWLk........ANFSN............ILENEFTVSGL
d1bqua2 SSI.LklTWTNP.....SI.KSviil.......KYNIQYR....TKDa...STWSqip......PEDTA............STRSSFTVQDL
d1cd9b2 -LW.L..SWKPW.....KP.SEymeqecel...RYQPQLK....GA-....-NWTl........VFHLP............SSKDQFELCGL
d1cfba1 KAE.I..HWEQQ.....GD.NRspil.......HYTIQFN....TSFtp..ASWDaa.......YEKVP............NTDSSFVVQMS
d1cfba2 NLV.I..SWTPMpei..E-.-Hnapnf......HYYVSWKr...DIPa...AAWEn........NNIFD............WRQNNIVIADQ
d1eerb1 ---.-..-----.....--.-Gvgpg.......QYSFSYQ....LED....EPWKlcrlhqa..PTARG............AVRFWCSLPTA
d1eerb2 HVV.L..RWLPP.....PE.TPmtshi......RYEVDVS....AGQga..GSVQ.........RVEIL............EGRTECVLSNL
d1egja_ SYS.L..RWETM.....KM.RYehidh......TFEIQYR....KDT....ATWKds.......KTETL............QNAHSMALPAL
d1f42a2 ---.-..-----.....--.--...........-------....---....----.........-----............--------T--
d1f42a3 QVE.V..SWEYPdtwstPH.SYfsl........TFCVQVQ....GKSk...REKK.........-DRVF............TDKTSATVICR
d1fnfa1 TGV.LtvSWERS.....TT.PDit.........GYRITTT....PTN....GQQGnsl......EEVVH............ADQSSCTFDNL
d1fnfa2 TMR.V..TWAPPp....SI.DLt..........NFLVRYS....PVKn...EEDVa........ELSIS............PSDNAVVLTNL
d1fnfa3 SFT.V..HWIAP.....RA.TIt..........GYRIRHH....PEHfs..GRPR.........EDRVP............HSRNSITLTNL
d1fnha1 SLS.A..QWTPP.....NV.QLt..........GYRVRVT....PKEkt..GPMK.........EINLA............PDSSSVVVSGL
d1fnha2 TIT.I..SWRTK.....TE.TIt..........GFQVDAV....PAN....GQTPi........QRTIK............PDVRSYTITGL
d1fyhb1 NPI.V..YWEYQ.....IM.PQvp.........VFTVEVK....NYGvkn.SEWI.........DACIN............ISHHYCNISDH
d1fyhb2 ---.-..-----.....--.--...........VYNVYVR....---....----.........-----............-----------
d1gh7a1 ---.-..-----.....--.--...........-------....---....----.........-----............----SCDLSDD
d1gh7a2 HFL.L..TWSVA.....LG.SPqshwlspgdl.EFEVVYK....RLQ....DSWEd........AAILL............SNTSQATLGPE
d1gh7a3 ---.-..-----.....--.--...........-------....---....----.........-----............----------P
d1i1ra1 --Y.I..VWKTN.....HF.TIpke........QYTIINR....TASs...VTFT.........D----............-----------
d1iarb1 ---.-..-----.....--.--...........-------....---....-EWKmngp.....TNCST............-----------
d1iarb2 TLL.L..TWSNPyp...PD.NYlynhl......TYAVNIW....SENdp..ADFR.........IYNVT............YLEPSLRIAAS
d1j7vr1 HHI.L..HWTPI.....PQ.QSest........CYEVALL....RYGi...ESWN.........SISQC............SQTLSYDLTAV
d1j7vr2 ---.-..-----.....--.--...........-------....---....----.........-T---............-----------
d1j8ka_ SIK.I..AWESP.....QG.QVs..........RYRVTYS....SPE....DGIHel.......FPAPD............GEEDTAELQGL
d1k85a_ SIT.L..SWTAS.....TD.NVgvt........GYDV---....---....YNGT.........ALATT............VTGTTATISGL
d1lwra_ ---.-..-----.....--.DGgspir......HYLVKYR....ALA....SEWK.........PEIRL............PSGSDHVMLKS
d1n26a2 ---.-..-----.....--.--...........-------....---....----.........-----............---FSCQLA--
d1n26a3 WLS.V..TWQDP.....HS.WNssfyrl.....RFELRYR....AER....SKTFt........TWMVK............DLQHHCVIHDA
d1n6va1 RSI.L..SWELK.....NH.SIvpthytl....LYTIMSK....PED....LKVV.........KNCAN............TTRSFCDLTDE
d1n6va2 ---.-..-----.....--.--...........--I----....---....----.........-----............-----------
d1owwa_ SHP.I..QWNAP.....QP.SHis.........KYILRWR....PKNsv..GRWK.........EATIP............GHLNSYTIKGL
d1qg3a1 KIH.F..NWLPP.....SG.KPm..........GYRVKYW....IQGd...SESE.........AHLLD............SKVPSVELTNL
d1qg3a2 VTQ.L..SWAEPa....ET.NGeit........AYEVCYG....LVNd...DN-Rpigpmkk..VLVDN............PKNRMLLIENL
d1qr4a1 TLS.L..RWRRP.....VA.KFd..........RYRLTYV....SPS....GKKN.........EMEIP............VDSTSFILRGL
d1tdqa1 VAF.V..EWTPP.....RA.KV...........DFILLKYglvgGEG....GKTT.........FRLQP............-PLSQYSVQAL
d1tdqa2 SLD.L..EWDNS.....EA.EAq..........EYKVVYS....TLAg...EQYH.........EVLVPkgi.........GPTTKTTLTDL
d1tdqa3 SIS.L..IWTKA.....SG.PId..........HYRITFT....PSS....GISS.........EVTVP............RDRTSYTLTDL
d1uc6a_ RLE.V..TWQTP.....ST.WPdpesfpl....KFFLRYR....PLI....LDQW.........QHVEL............SNGTAHTITDA
d1uena_ LAE.V..HWDPV.....PL.KSirghlq.....GYRIYYW....KTQ....SSSKrnrrhiekkILTFQ............GSKTHGMLPGL
d1ueya_ SVQ.L..SWTPG.....DD.NNspit.......KFIIEYE....DAMhkp.GLWHh........QTEVS............GTQTTAQL-NL
d1ujta_ TVQ.V..TWTVD.....RQ.PQfiq........GYRVMYR....QTSg...LQAT.........SSWQNldakv.......PTERSAVLVNL
d1v5ja_ GVL.L..HWDPP.....EL.VPkrld.......GYVLEGR....QGSqg..WEVL.........DPAVA............GTETELLVPGL
d1va9a1 SIQ.V..TWKAPkke..LQ.NGvir........GYQIGYR....ENSpg..SNGQysiv.....EMKAT............GDSEVYTLDNL
d1wf5a1 AIN.L..TWTKP.....FD.GNspli.......RYILEMS....ENN....APWTvl.......LASVD............PKATSVTVKGL
d1wfna1 SLK.V..SWQEP.....GE.KNgilt.......GYRISWE....EYNr...TNTRv........THYLP............NVTLEYRVTGL
d1wfoa1 SVR.L..IWQPP.....AA.PNgiil.......AYQITHR....LNTtta.N--Tat.......VEVLA............PSARQYTATGL
d1wfta_ GIH.L..SWEPP.....TS.PSgnileysaylaIRTAQMQ....DNP....SQLVf........MRIYC............GLKTSCTVTAG
d1wfua_ SIE.L..YWDLEqke..K-.-Rqgpqeqwl...RFSIEEE....DPK....MHSY.........GVIYT............GYATRHVVEGL
d1wisa1 SVT.L..QFRPG.....YD.GKtsis.......RWLVEAQvgvvGEG....EEWLlih......QLSNE............PDARSMEVPDL
d1wj3a_ KVL.L..NWEQVkam..E-.-Nesevt......GYKVFYR....TSSq...NNVQ.........VLNTN............KTS--AELV--
d1wk0a_ TVV.L..TWSPPss...LI.NGetdessvpelyGYEVLIS....STG....KDGKy........KSVYV............GEETNITLNDL
d1x3da1 SLT.L..QWKAP.....SD.NGskiq.......NFVLEWD....EGK....GNGEf........CQCYM............GSQKQFKITKL
d1x4xa1 CAQ.V..NWEVP.....LS.NGtdvt.......EYRLEWG....GVE....GSM-.........QICYC............GPGLSYEIKGL
d1x4ya1 TIM.L..KWMYI.....PA.SNnntpih.....GFYIYYR....PTDsdndSDYK.........KDMVE............GDRYWHSISHL
d1x4za1 SVY.V..TWIPR.....GN.GGfpiq.......SFRVEYK....KLKkv..GDWIla.......TSAIP............PSRLSVEITGL
d1x5aa1 ---.L..TWAGSrpr..N-.-Pggnl.......SYELHVL....NQD....EEWH.........QMV--............-LEPRVLLTKL
d1x5fa1 FIK.L..TWRTP.....AS.DPhgdnl......TYSVFYT....KEGia..RERV.........ENTSH............PGEMQVTIQNL
d1x5ga1 SIT.V..TWETP.....VS.GNgeiq.......NYKLYYM....EKGt...DKEQ.........--DVD............VSSHSYTINGL
d1x5ha1 KSImI..HWQPPapa..TQ.NGqit........GYKIRYR....KASrk..SDVT.........ETLVS............GTQLSQLIEGL
d1x5ia1 SIV.V..SWTPP.....EN.QNivvr.......GYAIGYG....IGS....PHAQ.........TIKVD............YKQRYYTIENL
d1x5ja1 TIR.I..TWADN.....SL.PKhqkitdsr...YYTVRWK....TNIp...ANTK.........YKNAN............ATTLSYLVTGL
d1x5ka1 TII.V..NWQPPs....EA.NGkit........GYIIYYStdv.NAEi...HDWV.........IEPVV............GNRLTHQIQEL
d1x5la1 SVS.L..LWQEP.....EQ.PNgiil.......EYEIKYY....EKD....KEMQs........YSTLK............AVTTRATVSGL
d1x5xa1 WLS.L..QWSKP.....SG.TPsdegi......SYILEME....EETs...GYGF.........KPKYD............GEDLAYTVKNL
d1x5ya1 TTT.L..KWRPPdri..GA.GGid.........GYLVEYC....LEGs...EEWVp........ANKEP............VERCGFTVKDL
d1x5za1 SIL.L..SWTPP.....RS.DTia.........NYELVYK....DGEh...GEEQr........ITI--............EPGTSYRLQGL
d2b5ib1 ---.-..-----.....--.--...........-------....---....----.........--C--............-----------
d2b5ib2 RCN.I..SWEIS.....QA.SHyferhl.....EFEARTL....SPG....HTWE.........EAPLL............TLKQKQEWICL
d2b5ic1 QLE.L..NWNNR.....FL.NHcl.........EHLVQYR....TDWd...HSWT.........EQSVD............YRH-KFSLPSV
d2b5ic2 ---.-..-----.....--.--...........-FNVEYM....NCT....WQSSse.......PQPTN............-----------
d2crma1 SFK.I..TWDPP.....KD.NGgatin......KYVVEMA....EGSng..NKWEm........IYSGA............TREHLCDR---
d2crza1 EIQ.L..RWGPP.....LV.DGgspis......CYSVEMS....PIE....KDEP.........REVYQ............GSEVECTVSSL
d2cspa1 TIR.V..SWRPP.....VL.TPtglsnganvt.GYGVYAK....GQRv...AEVI.........-----............-----------
d2cuha1 FAV.L..HWKPP.....QN.PVd..........TYDIQVT....APG....APPL.........QAETP............GSAVDYPLHDL
d2cuia1 SLR.L..NWEAP.....PG.AFd..........S------....---....----.........-----............-----------
d2d9qb3 SLI.C..QWEPG.....PE.THlpt........SFTLKSF....KSR....GNCQtqgdsi...LDCVPk...........DGQSHCSIPRK
d2dlha1 TIL.V..QWKEP.....EE.PNgqiq.......GYRVYYT....MDP....TQHVnn.......WMKHN............VADSQITTIGN
d2dn7a1 TAL.L..QWHPP.....KElPGell........GYRLQYC....RADe...ARPN.........TIDFG............KDDQHFTVTGL
d2dtge1 VVH.L..MWQEP.....KE.PNgliv.......LYEVSYR....RYGd...EELHlcd......TRKHF............ALERGCRLRGL
d2dtge2 QII.L..KWKPP.....SD.PNgnit.......HYLVFW-....---....----.........-----............-----------
d2dtge3 KIL.L..RWEPYw....PP.DFrdll.......GFMLFYK....EAP....----.........-----............-----------
d2fnba_ SIG.L..RWTPL.....NS.STii.........GYRITVV....AAGe...GIPIf........EDFVD............SSVGYYTVTGL
d2haza1 -AQ.V..QFDEP.....EA.TGgvpil......KYKAEWR....AVGe...EVWHskwy.....DAKEA............SMEGIVTIVGL
d2hfta1 KTI.L..EWEPK.....PV.NQ...........VYTVQIS....TKS....GDWK.........SKCFY............TTDTECDLTDE
d2hfta2 ---.-..-----.....--.DL...........IYTLYYW....KSS....SQEKgefrsgkk.TAKTN............TNEF---LIDV
d2ibga1 AVV.L..HWSLA.....SD.ADehlit......GYYAYYR....PSSsa..GEYFk........ATIEG............AHARSFKIAPL
d2ic2a1 SVM.L..RWMVP.....RN.DGlpiv.......IFKVQYR....MVGkr..KNWQ.........TTNDNipygkpkwnselGKSFTASVTDL
d2mfna2 SLL.I..SWEPP.....AV.SVr..........YYRITYG....ETGg...NSPVq........EFTVP............GSKSTATINNI
d2rbla_ TAL.I..TWSMQ.....LS.QLegiel......TYGIKDV....PGD....RTTI.........DL--T............EDENQYSIGNL
d2yrza1 SLR.V..SWQEP.....RC.ERplq........GYSVEYQ....LLNg...GELHr........LNIPN............PAQTSVVVEDL
d3d1md_ QIM.L..KWTYI.....PS.SNnntpiq.....GFYIYYR....PTDsdndSDYK.........RDVVE............GSKQWHMIGHL


         60               70              80        90       100                                    
          |                |               |         |         |                                    
d1a21a1 VVK.DVGQTY......MARVLSYP.....ARNG.NTTGFPEEPPFRNSPEFTPY-----ldtnl............................
d1axib1 ---.------......--------.....----.-------------------------kecpdyvsagenscyfnssftsiaipyciklts
d1axib2 KV-.--DKEY......EVRVRSKQ.....RN--.-------------------------sgnygefsevlyvtlpqm...............
d1bp3b1 Y-T.SMWRTY......IMMVNATN.....QMGS.SFS----------------------delyvdvtyi.......................
d1bp3b2 HP-.--GQKY......LVQVRCKP.....DHGYwSAWSP--------------------atfiqips.........................
d1bpva_ TE-.--DAAY......EFRVIAKNa....AGAI.SPPSEPSDAITCRD-----------dvea.............................
d1bqua2 KP-.--FTEY......VFRIRCMK.....EDGK.GYWSDWSE-----------------easgityedrpskepsf................
d1cd9b2 HQA.PVYTLQ......MRCIRSSL.....PGFW.SPWS---------------------pglqlrptm........................
d1cfba1 ---.-PWANY......TFRVIAFN.....KIGA.SPPSAHS------------------dscttq...........................
d1cfba2 PT-.--FVKY......LIKVVAIN.....DRGE.SNVAAEE------------------vvgysgedr........................
d1eerb1 D-T.SSFVPL......ELRVTAAS.....GA--.-------------------------pryhrvihin.......................
d1eerb2 RG-.--RTRY......TFAVRARMae...PSFG.GFWSEWSEP----------------vsllt............................
d1egja_ EP-.--STRY......WARVRVRTsrtgyNGIW.SEWSE--------------------arswdtes.........................
d1f42a2 ---.------......--------.....----.-------------------------fsvkssrgssdpqgvtcgaatlsaervrgdnke
d1f42a3 KN-.-----A......SISVRAQD.....RYYS.SSWSEW-------------------asvpcs...........................
d1fnfa1 SP-.--GLEY......NVSVYTVK.....DDKE.SVPI---------------------sdtiipa..........................
d1fnfa2 LP-.--GTEY......VVSVSSVY.....EQHE.STPL---------------------rgrqktg..........................
d1fnfa3 TP-.--GTEY......VVSIVALN.....GREE.SPL----------------------ligqqst..........................
d1fnha1 MV-.--ATKY......EVSVYALK.....DTLT.SRPA---------------------qgvvttle.........................
d1fnha2 QP-.--GTDY......KIYLYTLN.....DNAR.SSPVVID------------------asta.............................
d1fyhb1 V-G.DPSNSL......WVRVKARV.....GQKE.SAYAKSEEFAVCRDG----------k................................
d1fyhb2 ---.------......--------.....----.-------------------------mngseiqykiltqkeddcdeiqcqlaipvssln
d1gh7a1 ---.------......--------.....----.-------------------------mpwsacphprcvprrcvipcqsfvvtdvdyfsf
d1gh7a2 H-L.MPSSTY......VARVRTRL.....APGS.-------------------------rlsgrpskwspevcwdsqpgd............
d1gh7a3 ---.------......--------.....----.-------------------------dpathgqyivsvqprraekhiks..........
d1i1ra1 ---.------......--------.....----.-------------------------iaslniqltcniltfgqleqnvygitiisg...
d1iarb1 ---.------......--------.....----.-------------------------elrllyqlvfllseahtcipennggagcvchll
d1iarb2 TL-.KSGISY......RARVRAWA.....QAYN.TTWSEWSP-----------------stkwh............................
d1j7vr1 TLDlYHSNGY......RARVRAVD.....GSRH.SQWTVTN------------------trfsvd...........................
d1j7vr2 ---.------......--------.....----.-------------------------hkkvkheqfslltsgevgefcvqvkpsvasrsn
d1j8ka_ RP-.--GSEY......TVSVVALH.....DDME.SQPLI--------------------gtqstaipa........................
d1k85a_ AA-.--DTSY......TFTVKAKD.....AAG-.-------------------------nvsaasnavsvkt....................
d1lwra_ LD-.-WNAEY......EVYVVAEN.....QQGK.SKAA---------------------hfvfrtsaq........................
d1n26a2 ---.------......--------.....----.-------------------------vpegdssfyivsmcvassvgskfsktqtfqgcg
d1n26a3 WS-.--GLRH......VVQLRAQE.....EFGQ.GEWSEWSP-----------------eamgtpwtes.......................
d1n6va1 WR-.-STHEA......YVTVLEGF.....SGNT.TLFSCSHNFWLAIDMSFEP------.................................
d1n6va2 ---.------......--------.....----.-------------------------idklipntnycvsvylehsdeqaviksplkctl
d1owwa_ KP-.--GVVY......EGQLISIQ.....QYGH.QEVTRFD------------------fttts............................
d1qg3a1 YP-.--YCDY......EMKVCAYG.....AQGE.GPYSS--------------------lvscrthq.........................
d1qg3a2 RE-.--SQPY......RYTVKARN.....GAGW.GPE----------------------reaiinlatqp......................
d1qr4a1 DA-.--GTEY......TISLVAEK.....GRHK.SKPTTIK------------------gstv.............................
d1tdqa1 RP-.--GSRY......EVSISAVR.....GTNE.SDASSTQ------------------ftte.............................
d1tdqa2 VP-.--GTEY......GVGISAVM.....NSKQ.SIPATMN------------------arte.............................
d1tdqa3 EP-.--GAEY......IISITAER.....GRQQ.SLESTVD------------------af...............................
d1uc6a_ YA-.--GKEY......IIQVAAKDne...IGTW.SDWSVAAHATPW-------------tee..............................
d1uena_ EP-.--FSHY......TLNVRVVN.....GKGE.GPASPDR------------------vfntpegsgpssg....................
d1ueya_ SP-.--YVNY......SFRVMAVN.....SIGK.SLPSEASEQYL--------------tkasepdknptsgpssg................
d1ujta_ KK-.--GVTY......EIKVRPYF.....NEFQ.GMDSESKT-----------------vrtteesgpssg.....................
d1v5ja_ IK-.--DVLY......EFRLVAFA.....GSFV.SDPSNTA------------------nvstsglsgpssg....................
d1va9a1 KK-.--FAQY......GVVVQAFN.....RAGT.GPSS---------------------seinattle........................
d1wf5a1 VP-.--ARSY......QFRLCAVN.....DVGK.GQFSKDTE-----------------rvslpe...........................
d1wfna1 TA-.--LTTY......TIEVAAMT.....SKGQ.GQVSAST------------------issgvpp..........................
d1wfoa1 KP-.--ESVY......LFRITAQT.....RKGW.GEAAEA-------------------lvvttekr.........................
d1wfta_ QLA.NAHIDYtsrpaiVFRISAKN.....EKGY.GPAT---------------------qirwlqgnsksgpssg.................
d1wfua_ EP-.--RTLY......KFRLKVTS.....PSGE.YEYSP--------------------vvsvattresgpssg..................
d1wisa1 NP-.--FTCY......SFRMRQVN.....IVGT.SPPSQPSRKI---------------qtlq.............................
d1wj3a_ --L.PIKEDY......IIEVKATT.....DGGD.GTSS---------------------eqiripritssgpssg.................
d1wk0a_ KP-.--AMDY......HAKVQAEY.....NSIK.GTPSEAEIFTTL-------------scepdipnpprisgpssg...............
d1x3da1 SP-.--AMGC......KFRLSARN.....DYGT.SGFSE--------------------evlyytsgc........................
d1x4xa1 SP-.--ATTY......YCRVQALS.....VVGA.GPFSEV-------------------vacvtpps.........................
d1x4ya1 QP-.--ETSY......DIKMQCFN.....EGGE.SEFSNV-------------------micetkar.........................
d1x4za1 EK-.--GISY......KFRVRALN.....MLGE.SEPSAPSRPYVV-------------sg...............................
d1x5aa1 QP-.--DTTY......IVRVRTLT.....PLGP.GPFSPDHEF----------------rtspp............................
d1x5fa1 MP-.--ATVY......IFRVMAQN.....KHGS.GESSA--------------------plrvetqpe........................
d1x5ga1 KK-.--YTEY......SFRVVAYN.....KHGP.G------------------------vstpdvavrtlsd....................
d1x5ha1 DR-.--GTEY......NFRVAALT.....INGT.GPAT---------------------dwlsaetfesdldetrvpev.............
d1x5ia1 DP-.--SSHY......VITLKAFN.....NVGE.GIPLYES------------------avtrpht..........................
d1x5ja1 KP-.--NTLY......EFSVMVTK.....GRRS.STWSMTA------------------hgttfel..........................
d1x5ka1 TL-.--DTPY......YFKIQARN.....SKGM.GPMSEAVQF----------------rtpka............................
d1x5la1 KP-.--GTRY......VFQVRART.....SAGC.GRFSQ--------------------amevetgkp........................
d1x5xa1 RR-.--STKY......KFKVIAYN.....SEGK.SNPSEVVEFTTCPD-----------.................................
d1x5ya1 PT-.--GARI......LFRVVGVN.....IAGR.SEPATLLQPVTIR------------e................................
d1x5za1 KP-.--NSLY......YFRLAARS.....PQGL.GA-----------------------staeisartmqs.....................
d2b5ib1 ---.------......--------.....----.-------------------------ellpvsqaswacnlilgapdsqklttvdivtlr
d2b5ib2 ETL.TPDTQY......EFQVRVKP.....LQGE.-------------------------fttwspwsqplafrtkp................
d2b5ic1 DG-.--QKRY......TFRVRSRF.....NPLC.GSAQHWSEW----------------shpihw...........................
d2b5ic2 ---.------......--------.....----.-------------------------ltlhywyknsdndkvqkcshylfseeitsgcql
d2crma1 --L.NPGCFY......RLRVYCIS.....DGGQ.SAVSES-------------------llvqtpav.........................
d2crza1 LP-.--GKTY......SFRLRAAN.....KMGF.GPFSEK-------------------cdittapg.........................
d2cspa1 ---.------......--------.....----.-------------------------fptadstavelvrlrsleakgvtvrtlsaqges
d2cuha1 VL-.--HTNY......TATVRGLR.....GPNL.TSPASIT------------------fttgleaprdleakevtp...............
d2cuia1 ---.------......--------.....----.-------------------------fllrfgvpspstlephprpllqrelmvpgtrhs
d2d9qb3 HL-.LLYQNM......GIWVQAEN.....ALGT.SM-----------------------spqlcldpmdvvk....................
d2dlha1 LV-.-PQKTY......SVKVLAFT.....SIGD.GPLS---------------------sdiqvitqtg.......................
d2dn7a1 HK-.--GTTY......IFRLAAKN.....RAGL.GEEFEKE------------------irtpedl..........................
d2dtge1 S--.--PGNY......SVRIRATS.....LAGN.GSWTEPTYFYV--------------tdyl.............................
d2dtge2 ---.------......--------.....----.-------------------------erqaedselfeldyclkglklpsrtwsppfese
d2dtge3 ---.------......--------.....----.-------------------------yqnvtefdgqdacgsnswtvvdidpplrsndpk
d2fnba_ EP-.--GIDY......DISVITLI.....NGGE.SAPTTLT------------------qqt..............................
d2haza1 KP-.--ETTY......AVRLAALN.....GKGL.GEISAASEFK---------------tqpv.............................
d2hfta1 IVK.DVKQTY......LARVFSYP.....AGNV.ESTGSAGEPLYENSPEFTPY-----let..............................
d2hfta2 DK-.--GENY......CFSVQAVI.....PSRT.VN-----------------------rkstdspvecmg.....................
d2ibga1 ET-.--ATMY......EFKLQSFS.....AASA.SEFS---------------------a................................
d2ic2a1 KP-.--QHTY......RFRILAVY.....SNND.NKESNTSA-----------------kfylqp...........................
d2mfna2 KP-.--GADY......TITLYAVT.....GRGD.SPASSKPV-----------------sinykt...........................
d2rbla_ KP-.--DTEY......EVSLISRR.....GDMS.SNPAKET------------------ftt..............................
d2yrza1 LP-.--NHSY......VFRVRAQS.....QEGW.G------------------------reregvitiesqv....................
d3d1md_ QP-.--ETSY......DIKMQCFN.....EGGE.SEFSN--------------------vmicetk..........................


                                                                                                    
                                                                                                    
d1a21a1 ............................................................................................
d1axib1 nggtvdekcfsvdeivq...........................................................................
d1axib2 ............................................................................................
d1bp3b1 ............................................................................................
d1bp3b2 ............................................................................................
d1bpva_ ............................................................................................
d1bqua2 ............................................................................................
d1cd9b2 ............................................................................................
d1cfba1 ............................................................................................
d1cfba2 ............................................................................................
d1eerb1 ............................................................................................
d1eerb2 ............................................................................................
d1egja_ ............................................................................................
d1f42a2 yeysvecqedsacpaaeeslpievmvdavhklkyenytssffirdii.............................................
d1f42a3 ............................................................................................
d1fnfa1 ............................................................................................
d1fnfa2 ............................................................................................
d1fnfa3 ............................................................................................
d1fnha1 ............................................................................................
d1fnha2 ............................................................................................
d1fyhb1 ............................................................................................
d1fyhb2 sqycvsaegvlhvwgvttekskevcitifn..............................................................
d1gh7a1 qpdrplgtrltvtl..............................................................................
d1gh7a2 ............................................................................................
d1gh7a3 ............................................................................................
d1i1ra1 ............................................................................................
d1iarb1 mddvvsadnytldlwagqqllwkgsfkpsehv............................................................
d1iarb2 ............................................................................................
d1j7vr1 ............................................................................................
d1j7vr2 kgmwskeecislt...............................................................................
d1j8ka_ ............................................................................................
d1k85a_ ............................................................................................
d1lwra_ ............................................................................................
d1n26a2 il..........................................................................................
d1n26a3 ............................................................................................
d1n6va1 ............................................................................................
d1n6va2 lppgqesefs..................................................................................
d1owwa_ ............................................................................................
d1qg3a1 ............................................................................................
d1qg3a2 ............................................................................................
d1qr4a1 ............................................................................................
d1tdqa1 ............................................................................................
d1tdqa2 ............................................................................................
d1tdqa3 ............................................................................................
d1uc6a_ ............................................................................................
d1uena_ ............................................................................................
d1ueya_ ............................................................................................
d1ujta_ ............................................................................................
d1v5ja_ ............................................................................................
d1va9a1 ............................................................................................
d1wf5a1 ............................................................................................
d1wfna1 ............................................................................................
d1wfoa1 ............................................................................................
d1wfta_ ............................................................................................
d1wfua_ ............................................................................................
d1wisa1 ............................................................................................
d1wj3a_ ............................................................................................
d1wk0a_ ............................................................................................
d1x3da1 ............................................................................................
d1x4xa1 ............................................................................................
d1x4ya1 ............................................................................................
d1x4za1 ............................................................................................
d1x5aa1 ............................................................................................
d1x5fa1 ............................................................................................
d1x5ga1 ............................................................................................
d1x5ha1 ............................................................................................
d1x5ia1 ............................................................................................
d1x5ja1 ............................................................................................
d1x5ka1 ............................................................................................
d1x5la1 ............................................................................................
d1x5xa1 ............................................................................................
d1x5ya1 ............................................................................................
d1x5za1 ............................................................................................
d2b5ib1 vlcregvrwrvmaiqdfkpfen......................................................................
d2b5ib2 ............................................................................................
d2b5ic1 ............................................................................................
d2b5ic2 qkkeihlyqtfvvqlqdpreprrqatqmlklqnl..........................................................
d2crma1 ............................................................................................
d2crza1 ............................................................................................
d2cspa1 vdsavaavppellvpptphp........................................................................
d2cuha1 ............................................................................................
d2cuia1 avlrdlrsgtlysltlyglrgphkadsiqgtartl.........................................................
d2d9qb3 ............................................................................................
d2dlha1 ............................................................................................
d2dn7a1 ............................................................................................
d2dtge1 ............................................................................................
d2dtge2 dsqkhnqseyedsageccscpktdsqilkeleessfrktfedylhnvvfvprpsrkrrslgdvgnagnneehrpfekvvnkeslvisglrhf
d2dtge3 sqnhpgwlmrglkpwtqyaifvktlvtfsderrtygaksdiiyvqtda............................................
d2fnba_ ............................................................................................
d2haza1 ............................................................................................
d2hfta1 ............................................................................................
d2hfta2 ............................................................................................
d2ibga1 ............................................................................................
d2ic2a1 ............................................................................................
d2mfna2 ............................................................................................
d2rbla_ ............................................................................................
d2yrza1 ............................................................................................
d3d1md_ ............................................................................................


                                       
                                       
d1a21a1 ...............................
d1axib1 ...............................
d1axib2 ...............................
d1bp3b1 ...............................
d1bp3b2 ...............................
d1bpva_ ...............................
d1bqua2 ...............................
d1cd9b2 ...............................
d1cfba1 ...............................
d1cfba2 ...............................
d1eerb1 ...............................
d1eerb2 ...............................
d1egja_ ...............................
d1f42a2 ...............................
d1f42a3 ...............................
d1fnfa1 ...............................
d1fnfa2 ...............................
d1fnfa3 ...............................
d1fnha1 ...............................
d1fnha2 ...............................
d1fyhb1 ...............................
d1fyhb2 ...............................
d1gh7a1 ...............................
d1gh7a2 ...............................
d1gh7a3 ...............................
d1i1ra1 ...............................
d1iarb1 ...............................
d1iarb2 ...............................
d1j7vr1 ...............................
d1j7vr2 ...............................
d1j8ka_ ...............................
d1k85a_ ...............................
d1lwra_ ...............................
d1n26a2 ...............................
d1n26a3 ...............................
d1n6va1 ...............................
d1n6va2 ...............................
d1owwa_ ...............................
d1qg3a1 ...............................
d1qg3a2 ...............................
d1qr4a1 ...............................
d1tdqa1 ...............................
d1tdqa2 ...............................
d1tdqa3 ...............................
d1uc6a_ ...............................
d1uena_ ...............................
d1ueya_ ...............................
d1ujta_ ...............................
d1v5ja_ ...............................
d1va9a1 ...............................
d1wf5a1 ...............................
d1wfna1 ...............................
d1wfoa1 ...............................
d1wfta_ ...............................
d1wfua_ ...............................
d1wisa1 ...............................
d1wj3a_ ...............................
d1wk0a_ ...............................
d1x3da1 ...............................
d1x4xa1 ...............................
d1x4ya1 ...............................
d1x4za1 ...............................
d1x5aa1 ...............................
d1x5fa1 ...............................
d1x5ga1 ...............................
d1x5ha1 ...............................
d1x5ia1 ...............................
d1x5ja1 ...............................
d1x5ka1 ...............................
d1x5la1 ...............................
d1x5xa1 ...............................
d1x5ya1 ...............................
d1x5za1 ...............................
d2b5ib1 ...............................
d2b5ib2 ...............................
d2b5ic1 ...............................
d2b5ic2 ...............................
d2crma1 ...............................
d2crza1 ...............................
d2cspa1 ...............................
d2cuha1 ...............................
d2cuia1 ...............................
d2d9qb3 ...............................
d2dlha1 ...............................
d2dn7a1 ...............................
d2dtge1 ...............................
d2dtge2 tgyrielqacnqdtpeercsvaayvsartmp
d2dtge3 ...............................
d2fnba_ ...............................
d2haza1 ...............................
d2hfta1 ...............................
d2hfta2 ...............................
d2ibga1 ...............................
d2ic2a1 ...............................
d2mfna2 ...............................
d2rbla_ ...............................
d2yrza1 ...............................
d3d1md_ ...............................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0034836 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Trichoplax adhaerens
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Amycolatopsis mediterranei U32
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Listeria innocua Clip11262
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]