SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

PKD domain alignments

These alignments are sequences aligned to the 0045880 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1b4ra_                              atlvgphg.......................................................
gi|269926256|ref|YP_003322879.1|   kapea..........................................................
gi|158335049|ref|YP_001516221.1|   ...............................................................
gi|158337554|ref|YP_001518729.1|   la.............................................................
JuK_gi|428310959|ref|YP_007121936.1| atgtytftglaqdkdgawsnpiertlivsnvaptitqvtqnlvakandffd............
gi|257061684|ref|YP_003139572.1|   ag.............................................................
gi|37520125|ref|NP_923502.1|       ntpplar........................................................
gi|37523274|ref|NP_926651.1|       kptveltapasga..................................................
ADw_gi|427735656|ref|YP_007055200.1| qp.............................................................
Cw6_gi|427728612|ref|YP_007074849.1| ltptitdisan....................................................
Cw6_gi|427730416|ref|YP_007076653.1| niapivnagadqtvtqgsl............................................
Cw6_gi|427730416|ref|YP_007076653.1| spviteitgdt....................................................
Cw6_gi|427728527|ref|YP_007074764.1| nitpvissltgdtn.................................................
Cw6_gi|427728612|ref|YP_007074849.1| nvapiveagenqtta................................................
Cw6_gi|427728527|ref|YP_007074764.1| niapvissltgdtnl................................................
Cw6_gi|427728527|ref|YP_007074764.1| psitsiev.......................................................
Cw6_gi|427728527|ref|YP_007074764.1| nvapvvkagkaqtinkg..............................................
Cw6_gi|427730429|ref|YP_007076666.1| giktirgviqdqdggatelftevtllevsptliisgadsavegapyilnl.............
Cw6_gi|427728589|ref|YP_007074826.1| dngistirgviqdqdggatelftditvlevaptlivsgadtaiegasyt..............
Cw6_gi|427728488|ref|YP_007074725.1| viqdqdgdttelstevtvlevsptliisgadsavegapyilnl....................
Cw6_gi|427728488|ref|YP_007074725.1| dgtyqigvratnsdgfssnafttltiintppsiqvsgane.......................
Cw6_gi|427730429|ref|YP_007076666.1| dngtyqigvratnsdgfssnaltnltiintpptiqvsgane......................
Cw6_gi|427728589|ref|YP_007074826.1| dgtyqiavqaintdgftsnaltnltiintpptiqvsgane.......................
Cw6_gi|427728589|ref|YP_007074826.1| attaveggi......................................................
gi|284045355|ref|YP_003395695.1|   trvldarapvvsanv................................................
gi|284044170|ref|YP_003394510.1|   t..............................................................
gi|284042862|ref|YP_003393202.1|   tvgwyvgaapdnlsfttanydahpptvdatip...............................
gi|284045306|ref|YP_003395646.1|   vapsvta........................................................
gi|284041896|ref|YP_003392236.1|   avtfdadgdalvtwyrtdgttfriqyavddthaprlddlva......................
gi|284041598|ref|YP_003391938.1|   gral...........................................................
gi|284044167|ref|YP_003394507.1|   tpt............................................................
gi|284045953|ref|YP_003396293.1|   ...............................................................
gi|284046213|ref|YP_003396553.1|   vrvrtsdgvrressg................................................
gi|284044780|ref|YP_003395120.1|   aeltvvdpptarlaltrgavhtge.......................................
gi|284045249|ref|YP_003395589.1|   gvhswqvtvadrrgqtfaakagtvrvdtvaptatlrvsgarrpettlrlalraqdlapkpakg
gi|257065172|ref|YP_003144844.1|   stpgtyeltytatdaagnssqvtrtvevrdmtaptitlegdesinvfqdttfedpgysasddy
gi|257063394|ref|YP_003143066.1|   vdt............................................................
D6J_gi|470176999|ref|YP_007563043.1| laprasfepd.....................................................
gi|258654576|ref|YP_003203732.1|   nqap...........................................................
gi|258654576|ref|YP_003203732.1|   nv.............................................................
gi|258654576|ref|YP_003203732.1|   nqpp...........................................................
gi|258654576|ref|YP_003203732.1|   nqp............................................................
Whk_gi|389862670|ref|YP_006364910.1| nqapna.........................................................
Whk_gi|389862670|ref|YP_006364910.1| nta............................................................
Whk_gi|389862670|ref|YP_006364910.1| nv.............................................................
Whk_gi|389862641|ref|YP_006364881.1| nrpptaq........................................................
pr7_gi|379734260|ref|YP_005327765.1| nlvpt..........................................................
pr7_gi|379734260|ref|YP_005327765.1| nae............................................................
pr7_gi|379734480|ref|YP_005327985.1| ndppvadaggpyrvpeggstvlagsat....................................
pr7_gi|379734480|ref|YP_005327985.1| nvaptvdlgddvtvyrndpvrsvgtftdpagaldepygyawtgtgplqpargsae........
gi|284988758|ref|YP_003407312.1|   nqap...........................................................
gi|152967163|ref|YP_001362947.1|   ttvlgyp........................................................
gi|152967489|ref|YP_001363273.1|   lkapat.........................................................
gi|256395288|ref|YP_003116852.1|   fwvqgstpls.....................................................
gi|256395288|ref|YP_003116852.1|   aas............................................................
gi|256392350|ref|YP_003113914.1|   tftftlngtnaastgnrynigvdtlqlvpttstapvasetvtpvs..................
gi|256396258|ref|YP_003117822.1|   gaclvpga.......................................................
gi|256396564|ref|YP_003118128.1|   tva............................................................
gi|256392297|ref|YP_003113861.1|   pshtygadktyngtvtvtdahgrvfttpftvtlakrvfspslevdqsg...............
gi|256392709|ref|YP_003114273.1|   pysvsanlagssv..................................................
gi|256397819|ref|YP_003119383.1|   kvphvytaggaydvivtvndgsktpptatthlvvadatlaasls...................
gi|256389450|ref|YP_003111014.1|   nvn............................................................
gi|256389479|ref|YP_003111043.1|   npsaav.........................................................
gi|256397820|ref|YP_003119384.1|   qlqihsdsg......................................................
gi|256395691|ref|YP_003117255.1|   sa.............................................................
gi|256392888|ref|YP_003114452.1|   evsissatvt.....................................................
gi|256389731|ref|YP_003111295.1|   nltlalpyaglasvtvsavdaagnvsapvtysfnvlsavptklsaqieiggssdgtvtgv...
gi|256389729|ref|YP_003111293.1|   ytattagphwidvqvvgaspslttrytftvpatdtvvaptayftvagdra.............
gi|256397557|ref|YP_003119121.1|   gsgsf..........................................................
gi|256392888|ref|YP_003114452.1|   vlhasvtvtaph...................................................
gi|256389730|ref|YP_003111294.1|   aaggq..........................................................
gi|256392297|ref|YP_003113861.1|   tvsv...........................................................
gi|256397820|ref|YP_003119384.1|   vpaeq..........................................................
gi|256389449|ref|YP_003111013.1|   vhhvftaprsygvsvvttdgidssapplyptavsawglafsstvnttaf..............
gi|291300455|ref|YP_003511733.1|   sggnrapea......................................................
gi|291297757|ref|YP_003509035.1|   nkqpiadftsnc...................................................
gi|291302699|ref|YP_003513977.1|   ptadftaqcfsg...................................................
gi|291298780|ref|YP_003510058.1|   kk.............................................................
MaI_gi|336179099|ref|YP_004584474.1| fvfnvdqpvlatit.................................................
gi|158315596|ref|YP_001508104.1|   gpt............................................................
gi|158315596|ref|YP_001508104.1|   qi.............................................................
gi|158313592|ref|YP_001506100.1|   tavpdaftfdvaepvlat.............................................
gi|158315596|ref|YP_001508104.1|   ptarltvtrpagagaaqvtada.........................................
gi|158312295|ref|YP_001504803.1|   drvd...........................................................
gi|158312315|ref|YP_001504823.1|   sttytvdgntqinlpaaaaqrngvqpvvtlsannansg.........................
gi|158318515|ref|YP_001511023.1|   apavsagadrtvagqrsvtlagkvsgas...................................
gi|111224558|ref|YP_715352.1|      at.............................................................
gi|111223459|ref|YP_714253.1|      pvasvtanggaradvg...............................................
gi|111222769|ref|YP_713563.1|      svtanggarae....................................................
gi|72162358|ref|YP_290015.1|       nnstfl.........................................................
gi|297561276|ref|YP_003680250.1|   ttpv...........................................................
gi|269125269|ref|YP_003298639.1|   elpe...........................................................
gi|271965255|ref|YP_003339451.1|   nrnpv..........................................................
gi|271964999|ref|YP_003339195.1|   nqa............................................................
gi|271969115|ref|YP_003343311.1|   rapia..........................................................
gi|271965721|ref|YP_003339917.1|   nqaptvrvspafdtveagavwvapa......................................
gi|271965721|ref|YP_003339917.1|   trtftapksgtamvmvydssnnlgdagvpyviseaapntapvvtagadveltagevlq.....
gi|271965721|ref|YP_003339917.1|   gsaqvtvhvtnaapevaltapavakqpakvakvge............................
gi|271963973|ref|YP_003338169.1|   rligkvkddal....................................................
gi|271962487|ref|YP_003336683.1|   gpvnqpptakitkpvaga.............................................
ReI_gi|357392895|ref|YP_004907736.1| ptal...........................................................

                                                        10        20                        30      
                                                         |         |                         |      
d1b4ra_                              ...........--------PLASGQLAAFHI.......AA.....PLP....VTATRWDF..G
gi|269926256|ref|YP_003322879.1|   ...........-HATISARTVYVGEPVTFDAsass...DP.....QGR....ELMFRWDL..G
gi|158335049|ref|YP_001516221.1|   ...........----------------TFID.......NP.....SRG....IVSYAWDF..D
gi|158337554|ref|YP_001518729.1|   ...........--------------------.......--.....SNA....IAAYGWDF..N
JuK_gi|428310959|ref|YP_007121936.1| ...........-------------FAVSAVD.......PGk....DST....VLTYEWDLn.G
gi|257061684|ref|YP_003139572.1|   ...........--------------------.......--.....NNT....IASFAWDF..D
gi|37520125|ref|NP_923502.1|       ...........--VGATPTSGLAPLAVSFSSggss...DA.....DGG....PLLYSWQF..A
gi|37523274|ref|NP_926651.1|       ...........--------KLTAPATVTLNA.......EAr....DNN....GTVSKVEFf.R
ADw_gi|427735656|ref|YP_007055200.1| ...........--------------------.......--.....SKG....IVAYGWDL..N
Cw6_gi|427728612|ref|YP_007074849.1| ...........-------TNLNEGETTTFSA.......TAtdp..GND....SLTYTWNF..G
Cw6_gi|427730416|ref|YP_007076653.1| ...........-----------VSFAGQFTD.......PG.....ILD....THTIEWDF..G
Cw6_gi|427730416|ref|YP_007076653.1| ...........--------NLNEGDTGIFSViat....DP.....GND....TLTYRWSF..G
Cw6_gi|427728527|ref|YP_007074764.1| ...........------LNEGTPGTWRAIAS.......DS.....GDD....TLTYTWNF..G
Cw6_gi|427728612|ref|YP_007074849.1| ...........-------TGTNISFAGQFTD.......PG.....ILD....THTITWDF..G
Cw6_gi|427728527|ref|YP_007074764.1| ...........-------NEGTPGTWRAIAS.......DP.....GND....TLTYTWNF..G
Cw6_gi|427728527|ref|YP_007074764.1| ...........------PTSLNEGQEGSFSAlat....DV.....KND....NLTYIWDF..G
Cw6_gi|427728527|ref|YP_007074764.1| ...........---------GLINLSGSFSD.......VG.....TLD....THTINWDF..G
Cw6_gi|427730429|ref|YP_007076666.1| ...........----------------SATD.......PG.....NDT....VSQWIVDW..N
Cw6_gi|427728589|ref|YP_007074826.1| ...........-------------LNLSATD.......PG.....NDT....VSQWVVDW..N
Cw6_gi|427728488|ref|YP_007074725.1| ...........----------------SATD.......PG.....NDT....VSQWIVDW..N
Cw6_gi|427728488|ref|YP_007074725.1| ...........-------VAVGTPYTVNFSA.......TD.....PGNdr..VFEWRIDW..G
Cw6_gi|427730429|ref|YP_007076666.1| ...........-------VAVGTPYTINFSA.......TD.....PGNdr..VFEWRIDW..G
Cw6_gi|427728589|ref|YP_007074826.1| ...........-------VAVGTPYTINFSA.......TD.....PGNdr..VFEWRIDW..G
Cw6_gi|427728589|ref|YP_007074826.1| ...........-----------SRLTGRIVD.......PG.....TQD....SFTLLVDW..G
gi|284045355|ref|YP_003395695.1|   ...........------PASAVAGTPVAFSA.......TAs....DPA....GIRMSWDF..G
gi|284044170|ref|YP_003394510.1|   ...........------PATATAGAPAPFSAs......AS.....DRT....GASVWWDF..G
gi|284042862|ref|YP_003393202.1|   ...........-------ATATVGEDVVFSA.......RA.....SDPsg..VTGFAWEF..G
gi|284045306|ref|YP_003395646.1|   ...........---AADATTVTVGQIVHFSA.......TTsda..SGV....PGQVEWDF..G
gi|284041896|ref|YP_003392236.1|   ...........------PATAKAGVAAAFSV.......AP.....WDAws..AMTTRWEF..G
gi|284041598|ref|YP_003391938.1|   ...........-----------VGHPVYVEApay....AP.....RGG....GVTVGWRL..G
gi|284044167|ref|YP_003394507.1|   ...........AAFTHSPAVPNPGQLVTFDAg......TSvc...DVT....PCTYSWDDvaS
gi|284045953|ref|YP_003396293.1|   ...........ARLTASPPQVRVNQLVQFTV.......TL.....PPGldaaAVEFEWDF..N
gi|284046213|ref|YP_003396553.1|   ...........--------------------.......--.....---....LARVAIEW..G
gi|284044780|ref|YP_003395120.1|   ...........----------PVGLDASSSS.......DP.....NGP....IVRYEFDLd.G
gi|284045249|ref|YP_003395589.1|   akpaetsgvad--------------------.......--.....---....---AVVDW..G
gi|257065172|ref|YP_003144844.1|   ......dgdit--------------------.......--.....---....--------..-
gi|257063394|ref|YP_003143066.1|   ...........--------------------.......--.....---....--------..-
D6J_gi|470176999|ref|YP_007563043.1| ...........--------QLGNSLSYRMDN.......TSip...FDG....PTTYEWDF..G
gi|258654576|ref|YP_003203732.1|   ...........---VASFTATAVHLAVTVDAsgss...DP.....DGT....VASYAWDF..G
gi|258654576|ref|YP_003203732.1|   ...........-RPTAGFTSTTDGLTANLSS.......TStds..DGT....VVAWSWDF..G
gi|258654576|ref|YP_003203732.1|   ...........---TAAFTSTTSGLTANVDAsgst...DS.....DGT....IASYAWDF..G
gi|258654576|ref|YP_003203732.1|   ...........--PTADFTTAVDGLTASITS.......IStdp..DGT....VAAYAWNF..G
Whk_gi|389862670|ref|YP_006364910.1| ...........-AFTSTATFLDAAFDARSSS.......DT.....DGT....VAGYAWDF..G
Whk_gi|389862670|ref|YP_006364910.1| ...........--PTAAFTAAPAGLSVTVDGsgst...DA.....DGT....VVASAWDF..G
Whk_gi|389862670|ref|YP_006364910.1| ...........-APTAAFTAVSGGATGSFDA.......TAstdt.DGT....VTGWRWSF..G
Whk_gi|389862641|ref|YP_006364881.1| ...........----ITLTSDAATRTVAFDG.......TAsgdl.DGE....VLTYRWDF..G
pr7_gi|379734260|ref|YP_005327765.1| ...........ADFTAATEDLTAALDATGSI.......DP.....DGS....ITSHEWDF..G
pr7_gi|379734260|ref|YP_005327765.1| ...........--PVAAFTAAVEGLSVSLDGsgss...DA.....DGS....IASYGWDF..G
pr7_gi|379734480|ref|YP_005327985.1| ...........--------------------.......DP.....DDN....VETVTWDFd.G
pr7_gi|379734480|ref|YP_005327985.1| ...........--------------------.......--.....---....--------..-
gi|284988758|ref|YP_003407312.1|   ...........---IAAVTTTSTGATFTFSAagsa...DS.....DGA....VTGFTWSF..G
gi|152967163|ref|YP_001362947.1|   ...........---------------VTV--.......--.....RAT....PTSWTWDL..G
gi|152967489|ref|YP_001363273.1|   ...........--------------------.......--.....--G....AVALSVDF..G
gi|256395288|ref|YP_003116852.1|   ...........ASATASPTTGNAPLAVNFTG.......SA.....TGGta..PYKYSWNF..G
gi|256395288|ref|YP_003116852.1|   ...........--AAGTPTSGQIPLAVNFTG.......TA.....TGGtp..AYHYSWNF..G
gi|256392350|ref|YP_003113914.1|   ...........----------SVGQPITIDD.......SA.....TNPgaasITAYAIDF..G
gi|256396258|ref|YP_003117822.1|   ...........--PTAAFTMAPDGLSVHFSD.......VStd...TGSp...LNFERWSY..G
gi|256396564|ref|YP_003118128.1|   ...........----------VDGATARFHAsgs....VP.....GGT....ITGYYWTF..G
gi|256392297|ref|YP_003113861.1|   ...........------PSLGDVTALIQTTN.......ED.....DPY....LGSYAIDF..G
gi|256392709|ref|YP_003114273.1|   ...........--------------------.......DV.....DAK....AATYTIDW..G
gi|256397819|ref|YP_003119383.1|   ...........----ANTTKKNSPVTLSLAG.......SS.....VDQsik.AATTTVTW..G
gi|256389450|ref|YP_003111014.1|   ...........-----------------AVG.......SV.....QGG....VGDWSIDF..G
gi|256389479|ref|YP_003111043.1|   ...........-------APATIGIRVAANT.......ID.....AAN....GCKAVLDF..G
gi|256397820|ref|YP_003119384.1|   ...........-----SANPLATDFVIQAKD.......TM.....PGA....KLTYTLDF..G
gi|256395691|ref|YP_003117255.1|   ...........--------------------.......-S.....WGP....GATYDFEF..G
gi|256392888|ref|YP_003114452.1|   ...........-------------------A.......DI.....SGSeapaGATYTIDW..G
gi|256389731|ref|YP_003111295.1|   ...........-----------------VTA.......SG.....PNP....VLNYHVDF..G
gi|256389729|ref|YP_003111293.1|   ...........-----NPKSVTVNAIKSLHG.......--.....TTP....IQSFTYHF..G
gi|256397557|ref|YP_003119121.1|   ...........--------------------.......--.....---....INEYFIDW..G
gi|256392888|ref|YP_003114452.1|   ...........--------TVQVDLAGCSVD.......FA.....PSS....YPMFSIDW..G
gi|256389730|ref|YP_003111294.1|   ...........--------------------.......--.....---....---YSLSM..G
gi|256392297|ref|YP_003113861.1|   ...........--------------AVQGDG.......GS.....WWP....IVSYNVDF..G
gi|256397820|ref|YP_003119384.1|   ...........--------------------.......--.....--S....IALIRLNW..G
gi|256389449|ref|YP_003111013.1|   ...........-----------ATVTVTSSAgksl...PT.....YSD....YYMFSVNW..G
gi|291300455|ref|YP_003511733.1|   ...........-KAAASPDNGLAPLRVRFSSagsd...DP.....DND....PISYRWDF..G
gi|291297757|ref|YP_003509035.1|   ...........----------FAGIGYCFFDgngss..DP.....DGS....VASYKWNF..G
gi|291302699|ref|YP_003513977.1|   ...........------------PGVCFFNGq......GS.....KGE....IASYRWTF..G
gi|291298780|ref|YP_003510058.1|   ...........--PVASFTEICFGQWWSFCFfdanassDS.....DGT....VEEYSWEY..G
MaI_gi|336179099|ref|YP_004584474.1| ...........--------------------.......--.....--A....VPHYRWDF..G
gi|158315596|ref|YP_001508104.1|   ...........AALTVNPATGPAPLQVTADA.......SGsa...PGGap..IQGYRYDF..G
gi|158315596|ref|YP_001508104.1|   ...........---QVSATKVAVGETVTVRV.......VA.....SGGar..VSSARWRF..G
gi|158313592|ref|YP_001506100.1|   ...........--------------------.......--.....ISA....NPHYVWDF..G
gi|158315596|ref|YP_001508104.1|   ...........------------------SG.......ST.....EGSad..IASYAFNF..T
gi|158312295|ref|YP_001504803.1|   ...........---------VNAGEKVDFRA.......QVatppgAGR....IVSAGWDVt.G
gi|158312315|ref|YP_001504823.1|   ...........-----HPIDVRVGQQVTFSV.......QAqvppgAGK....IVRTEWDFl.G
gi|158318515|ref|YP_001511023.1|   ...........--------------------.......--.....---....ATAWTQLA..G
gi|111224558|ref|YP_715352.1|      ...........------ILYTPVPESYTFNVdepvv..AT.....ISA....IPHYRWEF..G
gi|111223459|ref|YP_714253.1|      ...........-----------VGEPVTLTV.......TAavppgAGR....IIAVEWDFd.G
gi|111222769|ref|YP_713563.1|      ...........---------VAVGEPVTLSA.......HAetppgAGS....IIGIRWDFd.G
gi|72162358|ref|YP_290015.1|       ...........-----------VNDPIELTAv......AS.....DPD....GSIDRVEFa.A
gi|297561276|ref|YP_003680250.1|   ...........ADISASTTSGPAPLEVEFSAegss...HP.....GGL....PLEYAWSF..G
gi|269125269|ref|YP_003298639.1|   ...........----ASFTSQCDQLECSFDAsase...DP.....DGT....IASYSWDF..G
gi|271965255|ref|YP_003339451.1|   ...........AKVTADRTSGPNPLAVAFSSagss...DP.....EGG....ALTYSWRF..G
gi|271964999|ref|YP_003339195.1|   ...........--PSANFTFTVNGLATTFTD.......TStds..DGT....IASRQWNF..G
gi|271969115|ref|YP_003343311.1|   ...........-KAAADRVSGKAPLTVAFSSagss...DP.....DGG....ALTYSWTF..G
gi|271965721|ref|YP_003339917.1|   ...........----------------SFTD.......-S.....DST....SWTYMVDY..G
gi|271965721|ref|YP_003339917.1|   ...........-------------RTVTFAD.......-P.....DST....SWTATVDY..G
gi|271965721|ref|YP_003339917.1|   ...........----------AVSLSASFTD.......SG.....KAD....THTATWSI..G
gi|271963973|ref|YP_003338169.1|   ...........--------------------.......--.....PNG....TLTSAWSLvnG
gi|271962487|ref|YP_003336683.1|   ...........--------TFTAPATVDITA.......DAa....DGD....GTVAKVEF..F
ReI_gi|357392895|ref|YP_004907736.1| ...........------FNQSVNGATVTLTD.......RSvv...TNSpaq.ITGWHWTF..G

                                                 40                          50               60    
                                                  |                           |                |    
d1b4ra_                              DGSAE........VDAAGP.................AA.SHRY.....VLPGR..YHVTAVLA
gi|269926256|ref|YP_003322879.1|   DGD--........-ISESP.................LV.THTY.....VDPGF..YRVGLTVN
gi|158335049|ref|YP_001516221.1|   GDNVA........-DRFGR.................QT.SYVF.....DKAGS..HNITLQIW
gi|158337554|ref|YP_001518729.1|   NDGKI........-DKFGR.................QV.SHQF.....SQA--..--VTLTVW
JuK_gi|428310959|ref|YP_007121936.1| DGLFD........-DFVGA.................AG.QWTF.....PDYGN..YKVAVRVS
gi|257061684|ref|YP_003139572.1|   NDGEI........-DDFGR.................YA.THVY.....DTPGT..YSVTLEVT
gi|37520125|ref|NP_923502.1|       DGT--........-SSTDP.................NP.VHTY.....TADGT..YSATLTVT
gi|37523274|ref|NP_926651.1|       DSTKIge......DLASPY.................SA.TWKL.....AEAGT..YALKAKVT
ADw_gi|427735656|ref|YP_007055200.1| NDGDI........-DKFGR.................KI.NHYF.....DKAGL..QDITLKVW
Cw6_gi|427728612|ref|YP_007074849.1| DNSD-........-TVTGQ.................TV.QHTF.....ADNGN..YTITLTVT
Cw6_gi|427730416|ref|YP_007076653.1| DGNT-........-ATGTL.................NP.SHRY.....ERDGS..YTVTLTVT
Cw6_gi|427730416|ref|YP_007076653.1| DNNQ-........-TVTGQ.................TV.QHTF.....ADNGE..YIVTLTVT
Cw6_gi|427728527|ref|YP_007074764.1| DGSP-........-EVTGA.................EV.NHSY.....RDNGI..YTVTLTVT
Cw6_gi|427728612|ref|YP_007074849.1| DGEQ-........-VTGTL.................NP.THSY.....TQDGQ..YTVILTVT
Cw6_gi|427728527|ref|YP_007074764.1| DGSP-........-EVTGA.................EV.NHSY.....RDNGI..YTITVIVS
Cw6_gi|427728527|ref|YP_007074764.1| DGST-........-KVTGS.................AV.KHIY.....GDNGI..YIGTLTVT
Cw6_gi|427728527|ref|YP_007074764.1| NGVT-........-ATGTL.................KP.IYTY.....TESGS..FTVTLTVT
Cw6_gi|427730429|ref|YP_007076666.1| DGTVEt.......FAGATQ.................SL.THRF.....TDNGT..RVIVVTAI
Cw6_gi|427728589|ref|YP_007074826.1| DGTVEt.......FAGATQ.................SL.THRF.....TDNGT..RVIVVTAI
Cw6_gi|427728488|ref|YP_007074725.1| DGTVEt.......FAGATQ.................SL.THRF.....TDNGT..RVILVTAI
Cw6_gi|427728488|ref|YP_007074725.1| DGTPIei......FGSNTI.................SA.THIY.....TNPGK..AQIIVGAV
Cw6_gi|427730429|ref|YP_007076666.1| DGTPIei......FGSNTT.................SA.THIY.....TNPGK..AQILVGAV
Cw6_gi|427728589|ref|YP_007074826.1| DGTPIei......FGSNTT.................SA.THIY.....TNPGK..AQILVGAV
Cw6_gi|427728589|ref|YP_007074826.1| DGSSEtfnla...AGTTNF.................DL.SHQY.....EDNRD..YMITVTVT
gi|284045355|ref|YP_003395695.1|   DDS--........-GSQRA.................SV.SHRY.....AEPGT..YAVTLTVT
gi|284044170|ref|YP_003394510.1|   DDS--........-GSRRA.................AV.DHVY.....TRAGT..YTVTLTAT
gi|284042862|ref|YP_003393202.1|   DGS--........-GARGE.................TV.RHAY.....ARPGA..YPIELTVT
gi|284045306|ref|YP_003395646.1|   DNTA-........-RGSGT.................SA.SHTY.....TQAGT..YQAKASTA
gi|284041896|ref|YP_003392236.1|   DGA--........-TATGT.................SV.EHVY.....AEAGE..RTVTVTAT
gi|284041598|ref|YP_003391938.1|   DGT--........-TTSGS.................KA.NHVY.....DAPGT..YTVTVEAR
gi|284044167|ref|YP_003394507.1|   DGPGApdy.....PLGSGT.................PL.TFTF.....RNAGT..KYVRLIVT
gi|284045953|ref|YP_003396293.1|   NGEPP........VRNRKT.................TM.SKSF.....KNVGA..YNPSVTI-
gi|284046213|ref|YP_003396553.1|   DGR--........-RGRGA.................AA.THRY.....RRAGA..YRVRVTAR
gi|284044780|ref|YP_003395120.1|   DGRYEi.......DAGRDP.................RR.VISY.....PSIGD..RRVAVRVT
gi|284045249|ref|YP_003395589.1|   DRTRR........-ERIRT.................VG.QHAY.....ARAGR..YTVTVTVT
gi|257065172|ref|YP_003144844.1|   -----........-DTVEI.................TG.KVDI.....ATPGD..YTITYTAT
gi|257063394|ref|YP_003143066.1|   -----........------.................--.----.....STPGD..YEVTYTVS
D6J_gi|470176999|ref|YP_007563043.1| DGSA-........-VVQGS.................EP.THVY.....DALGN..YRVTLTMR
gi|258654576|ref|YP_003203732.1|   DGA--........-TATGP.................TG.SHTY.....ATAGT..KTVTLTVT
gi|258654576|ref|YP_003203732.1|   DSTP-........-AITTE.................NA.THTY.....ATAGT..RQVTLTVT
gi|258654576|ref|YP_003203732.1|   DGA--........-TGTGA.................TA.SHAY.....ATGGT..KTVTLTVT
gi|258654576|ref|YP_003203732.1|   DNSTD........-IVSTP.................TA.SHTF.....ATAGT..YQVTLTVT
Whk_gi|389862670|ref|YP_006364910.1| DGT--........-TGTGP.................TA.THGY.....RAAGS..YPVTLTVT
Whk_gi|389862670|ref|YP_006364910.1| DAG--........-TGTGA.................TA.THTY.....AAAGS..YTVTLTVT
Whk_gi|389862670|ref|YP_006364910.1| DGT--........-TGTGA.................TT.SHAY.....AKDGT..YTVTLTVT
Whk_gi|389862641|ref|YP_006364881.1| DGS--........-TGTGA.................QV.SHTY.....AAPSTapVPVTLTVS
pr7_gi|379734260|ref|YP_005327765.1| DGS--........-IGTGA.................TV.EHVY.....AAAGT..YTVTLTVT
pr7_gi|379734260|ref|YP_005327765.1| DGA--........-TGAGA.................TA.SHTY.....AAAGT..YTVTLTVT
pr7_gi|379734480|ref|YP_005327985.1| DGS--........-HDDGT.................GL.TPTFsaaalDGPSV..HQVAVRVC
pr7_gi|379734480|ref|YP_005327985.1| -----........-YGASP.................ST.DISY.....EIEGT..YTIDLAVT
gi|284988758|ref|YP_003407312.1|   DGST-........-PATGE.................QV.VHEY.....AAPGT..YTVTLTVT
gi|152967163|ref|YP_001362947.1|   DGTTL........GPTTDPgnpypra..........TL.THAY.....DTPGE..HLITLTTT
gi|152967489|ref|YP_001363273.1|   DGSAPeamrvvgsAATPKA.................FG.KHRY.....TTAGT..FTVTVTAT
gi|256395288|ref|YP_003116852.1|   DGA--........-TSTTQ.................SP.SHTY.....SSAGS..YTATLTVT
gi|256395288|ref|YP_003116852.1|   DGSA-........-TSTAQ.................NP.SHSY.....TAAGT..YTATLTVT
gi|256392350|ref|YP_003113914.1|   DGTSA........TSPTPN.................VA.THAY.....STPGT..YPVKLTVT
gi|256396258|ref|YP_003117822.1|   DNTIS........-TTDGP.................NP.THTF.....PAAGT..YTIALTVD
gi|256396564|ref|YP_003118128.1|   DTRMT........-NETGA.................DV.THVF.....SEPGT..YTATVTIT
gi|256392297|ref|YP_003113861.1|   DHTPT........VTWTSGgvlvptd..........TL.RHTY.....AASGT..YTVTLSAT
gi|256392709|ref|YP_003114273.1|   DGTAQ........APDTQTfhgvgatlpa.......NP.SHKY.....AAAGN..YTVRLTVR
gi|256397819|ref|YP_003119383.1|   DKATAsfagdpakISATDA.................KL.THSY.....AADGT..YPVTVTLN
gi|256389450|ref|YP_003111014.1|   DGYSTnf......YSQTQA.................TA.NHSY.....AKPGT..YKVTLTAN
gi|256389479|ref|YP_003111043.1|   DGTST........ALSTDA.................DV.AHTY.....TNPGD..YRVTLT--
gi|256397820|ref|YP_003119384.1|   DGSSPvsgpvia.GSSGTV.................TV.QHIY.....KATGT..YPVKLSVS
gi|256395691|ref|YP_003117255.1|   DGQSD........KNNYTG.................YS.DHRY.....AASGT..YTVTVTVR
gi|256392888|ref|YP_003114452.1|   DGVQS........VTSDKD.................TPlTHTY.....TRVGG..FGVTLKVT
gi|256389731|ref|YP_003111295.1|   DGTTV........-NQASP.................AF.RHVY.....RSTWW..YQIVVTVT
gi|256389729|ref|YP_003111293.1|   DGTST........GPTSAT.................SA.THIY.....STADK..FPITVTVQ
gi|256397557|ref|YP_003119121.1|   DGSDQwve.....NAPVTS.................PV.PHAY.....AKSGT..YPVKLTVE
gi|256392888|ref|YP_003114452.1|   DGTSLknddlas.ASLHQS.................MP.THWY.....TTAGT..KTVTIWIG
gi|256389730|ref|YP_003111294.1|   DGTTLr.......GADNQP.................EI.YYTY.....QASGR..YLVQLADT
gi|256392297|ref|YP_003113861.1|   DGTKSgtrp....YPEAGT.................AP.SHTY.....GADKT..YNGTVTVT
gi|256397820|ref|YP_003119384.1|   DGSSTdirtpt..ARVLQI.................PV.AHTY.....KAAGS..YGVVTQVV
gi|256389449|ref|YP_003111013.1|   DGTTS........PATQSE.................DM.THQY.....KTGGP..YAVTVTM-
gi|291300455|ref|YP_003511733.1|   DGT--........-TSTRA.................NP.SHTF.....FRNGK..YQVKLTVS
gi|291297757|ref|YP_003509035.1|   DGT--........-TGTGA.................AP.FHRY.....S-PGT..YKVTLTVT
gi|291302699|ref|YP_003513977.1|   DGG--........-TGQGQ.................LV.HHWY.....AAAGQ..YRVTLTVT
gi|291298780|ref|YP_003510058.1|   DGS--........-TGTGS.................FA.SHAY.....PGPGT..YTVTLTVT
MaI_gi|336179099|ref|YP_004584474.1| DGAIG........PDSPGRpfdpaisprehpda...YV.SHPY.....RQPGT..YTITLTVT
gi|158315596|ref|YP_001508104.1|   DGTA-........-ASGSS.................TA.THTY.....ADPGS..YSVRVTVT
gi|158315596|ref|YP_001508104.1|   DDA--........-EGSGV.................DA.RHSW.....SKPGE..YTVSAQVT
gi|158313592|ref|YP_001506100.1|   DGETG........---PDApgrpydpaisprdhpdaYV.AHAY.....HRPGT..YQVTLTVT
gi|158315596|ref|YP_001508104.1|   GTFQA........-AQTAP.................TA.NFTF.....PAAGT..YTVTVRVT
gi|158312295|ref|YP_001504803.1|   SGTFT........PATTGF.................TA.SHRF.....TEPGT..YYVSLKVA
gi|158312315|ref|YP_001504823.1|   AGDYP........ITATNQpieaaekl.........RA.TYSY.....SKPGT..YFPVVRVT
gi|158318515|ref|YP_001511023.1|   PGQVT........FSAGSA.................NA.VATF.....STLGT..YALRLTAV
gi|111224558|ref|YP_715352.1|      DGGTG........---PDApgrpydsaisprdhpeaYV.SHEY.....ARPGQ..YQVTLTVT
gi|111223459|ref|YP_714253.1|      TGTYP........LRHAGIdgtaaeltv........ST.THAY.....DRPGT..YFATARVT
gi|111222769|ref|YP_713563.1|      QGTFP........-RTE-Dldgspaevtv.......TT.THAY.....DAPGT..YFATALVE
gi|72162358|ref|YP_290015.1|       DNTVIgi......DTTSPY.................SF.TWTD.....AAAGS..YSVTAIAY
gi|297561276|ref|YP_003680250.1|   DGQ--........-TSTEV.................SP.THTF.....EEAGQ..YTVVLTVT
gi|269125269|ref|YP_003298639.1|   DGK--........-TGTGK.................TV.EHTY.....DEPGT..YTVKLTVT
gi|271965255|ref|YP_003339451.1|   DGG--........-TSTQA.................NP.SHTY.....TANGT..YTPTLTVT
gi|271964999|ref|YP_003339195.1|   DGT--........-SSTSA.................NP.SHTY.....TTAGT..YTVQLTVT
gi|271969115|ref|YP_003343311.1|   DGG--........-TSTAA.................NP.THTY.....TADGR..RTATLTVR
gi|271965721|ref|YP_003339917.1|   AGAGPqpls....KVAGQL.................KL.EHVY.....ASAGD..YTVVLTVT
gi|271965721|ref|YP_003339917.1|   DGSGPqpvtp...NAAKQI.................TL.EHQW.....ATPGT..YPVTVKVK
gi|271965721|ref|YP_003339917.1|   GEPVP........AAVAGHggkgtv...........SG.SHVF.....TKAGL..YPISVTVT
gi|271963973|ref|YP_003338169.1|   PGTAI........FTAPGSt................TT.LASF.....TVAGT..YTVRLTAG
gi|271962487|ref|YP_003336683.1|   NGTTL........-LGTDT.................TA.PYAYswaa.VPAGD..YSLTAKAT
ReI_gi|357392895|ref|YP_004907736.1| DGG--........-TSEER.................NP.SHTY.....AKAGT..YTVALTVT

                                           70        80           
                                            |         |           
d1b4ra_                              LGAG..SALLGTDVQV--ea.........
gi|269926256|ref|YP_003322879.1|   NGHL..ADLTWFDVYVT-l..........
gi|158335049|ref|YP_001516221.1|   DEYGa.TRSLSQTIEVT-pt.........
gi|158337554|ref|YP_001518729.1|   DNQGa.THTLTKTFNVQ-r..........
JuK_gi|428310959|ref|YP_007121936.1| DGDG..------------...........
gi|257061684|ref|YP_003139572.1|   DIQGn.TTTTTQNITV--sy.........
gi|37520125|ref|NP_923502.1|       DAQGs.AATATIAISV--gnrpp......
gi|37523274|ref|NP_926651.1|       DSQGvtADSTSRTITV--sq.........
ADw_gi|427735656|ref|YP_007055200.1| DNQGt.ANTITQAINI--q..........
Cw6_gi|427728612|ref|YP_007074849.1| DSEGa.ATTQTILVN---vanva......
Cw6_gi|427730416|ref|YP_007076653.1| DKDGg.RTQDTLQVIV--n..........
Cw6_gi|427730416|ref|YP_007076653.1| DAYGa.TTTQTFTVTV--an.........
Cw6_gi|427728527|ref|YP_007074764.1| DDDGg.ETSRSLNVTV--nni........
Cw6_gi|427728612|ref|YP_007074849.1| DKDGg.TTSDTLTVSV--ns.........
Cw6_gi|427728527|ref|YP_007074764.1| DGDGg.ETSQSLNVTV--nnv........
Cw6_gi|427728527|ref|YP_007074764.1| DDDGg.VTSQQFNVTV--nnva.......
Cw6_gi|427728527|ref|YP_007074764.1| DDDGa.VTSDRLTVTV--kpf........
Cw6_gi|427730429|ref|YP_007076666.1| DEDG..TYTATKTVTV--sn.........
Cw6_gi|427728589|ref|YP_007074826.1| DEDG..TYTATKTVTV--sn.........
Cw6_gi|427728488|ref|YP_007074725.1| DEDG..TYTATKTVTV--sn.........
Cw6_gi|427728488|ref|YP_007074725.1| DEDSapNAT---------faapktv....
Cw6_gi|427730429|ref|YP_007076666.1| DEDSapNA----------tfaapktv...
Cw6_gi|427728589|ref|YP_007074826.1| DEDS..------------apnatf.....
Cw6_gi|427728589|ref|YP_007074826.1| DKDGd.SDTATTTARI--sn.........
gi|284045355|ref|YP_003395695.1|   DGADn.QTVVTRKLTI--tp.........
gi|284044170|ref|YP_003394510.1|   DGVGn.ETTITRRVTV--a..........
gi|284042862|ref|YP_003393202.1|   DRSGd.AAVVRRTLTVT-aa.........
gi|284045306|ref|YP_003395646.1|   DGAGn.AGAGTVTITVQ-pap........
gi|284041896|ref|YP_003392236.1|   DALGl.ATTRTAVVTV--s..........
gi|284041598|ref|YP_003391938.1|   DTHGe.TTTATRTIVV--r..........
gi|284044167|ref|YP_003394507.1|   NRSG..QSHAVQRDVV--vapap......
gi|284045953|ref|YP_003396293.1|   ----..------------y..........
gi|284046213|ref|YP_003396553.1|   DKAG..NT----------rrsv.......
gi|284044780|ref|YP_003395120.1|   DAGGs.VAETS-------aslhvspap..
gi|284045249|ref|YP_003395589.1|   DKAG..NRT---------va.........
gi|257065172|ref|YP_003144844.1|   DAAGn.SSQVTRTVTVK-p..........
gi|257063394|ref|YP_003143066.1|   DSTGh.TATATRTVHVV-d..........
D6J_gi|470176999|ref|YP_007563043.1| GAQE..G-----------qvltasewidi
gi|258654576|ref|YP_003203732.1|   DDKGv.SSTLSQPVQVT-appp.......
gi|258654576|ref|YP_003203732.1|   DNNGa.TATVTRDVTVT-appp.......
gi|258654576|ref|YP_003203732.1|   DNKGa.TAQVSHTLSVT-sp.........
gi|258654576|ref|YP_003203732.1|   DNSGa.TATVTKPVTVT-sp.........
Whk_gi|389862670|ref|YP_006364910.1| DDDGa.TATKTASVTVV-app........
Whk_gi|389862670|ref|YP_006364910.1| DDDGa.TARTQRTVTVT-ap.........
Whk_gi|389862670|ref|YP_006364910.1| DDDGa.TTSTTQQVTI--v..........
Whk_gi|389862641|ref|YP_006364881.1| DPQGa.TGTSTATV----v..........
pr7_gi|379734260|ref|YP_005327765.1| DDHGa.TAQTSTPVTVT-dpp........
pr7_gi|379734260|ref|YP_005327765.1| DGEGa.TGTATESVTVT-a..........
pr7_gi|379734480|ref|YP_005327985.1| DTFGv.CATDTADVEV--anv........
pr7_gi|379734480|ref|YP_005327985.1| DDDGg.TGRDSQRVTV--lnrp.......
gi|284988758|ref|YP_003407312.1|   DDDGa.STTTSRQVVV--...........
gi|152967163|ref|YP_001362947.1|   ----..------------yt.........
gi|152967489|ref|YP_001363273.1|   PSTGt.PVSVPVQVQ---v..........
gi|256395288|ref|YP_003116852.1|   DTSSp.VKTATSQVAVN-v..........
gi|256395288|ref|YP_003116852.1|   DSASp.VNTATSTVSVT-as.........
gi|256392350|ref|YP_003113914.1|   DDNGa.SASTTKQVIV--l..........
gi|256396258|ref|YP_003117822.1|   DAKGl.SSTYAQNVTVT-gp.........
gi|256396564|ref|YP_003118128.1|   SSFGt.TTTVRKNIQV--la.........
gi|256392297|ref|YP_003113861.1|   DNLG..WPTA--------qpv........
gi|256392709|ref|YP_003114273.1|   DGLGg.AATAATTVLV--sapv.......
gi|256397819|ref|YP_003119383.1|   DGLG..TKTSVQT-----etf........
gi|256389450|ref|YP_003111014.1|   GILP..SNAAKLTQQVT-vtappa.....
gi|256389479|ref|YP_003111043.1|   ----..------------l..........
gi|256397820|ref|YP_003119384.1|   DGTH..S-----------vdlak......
gi|256395691|ref|YP_003117255.1|   DQNGw.TGTASTQVTVT-...........
gi|256392888|ref|YP_003114452.1|   SSDD..NDQQRVPVTV--...........
gi|256389731|ref|YP_003111295.1|   DSSGa.TTTAT-------alnv.......
gi|256389729|ref|YP_003111293.1|   DTDSl.SNSM--------qat........
gi|256397557|ref|YP_003119121.1|   TGTLq.SASVAHDITVTVpp.........
gi|256392888|ref|YP_003114452.1|   DGVGp.SATTTRTITL--tdp........
gi|256389730|ref|YP_003111294.1|   DAGGs.TGTAAVWVDVT-va.........
gi|256392297|ref|YP_003113861.1|   DAHG..RVFTT-------pftv.......
gi|256397820|ref|YP_003119384.1|   DQDGa.TATTTEQISV--gpp........
gi|256389449|ref|YP_003111013.1|   ----..------------apt........
gi|291300455|ref|YP_003511733.1|   DGTK..TDTATVPVQV--...........
gi|291297757|ref|YP_003509035.1|   DNKGa.TGSVTKTVTV--...........
gi|291302699|ref|YP_003513977.1|   DSRGg.SHSTTKTITV--...........
gi|291298780|ref|YP_003510058.1|   DDKGa.TGSISKTIT---...........
MaI_gi|336179099|ref|YP_004584474.1| ----..------------wq.........
gi|158315596|ref|YP_001508104.1|   DRNGr.TSSQSAQVTV--g..........
gi|158315596|ref|YP_001508104.1|   LADGr.RAVPTATITV--vgem.......
gi|158313592|ref|YP_001506100.1|   W---..------------d..........
gi|158315596|ref|YP_001508104.1|   DTAGr.SSE---------asat.......
gi|158312295|ref|YP_001504803.1|   ----..------------asrs.......
gi|158312315|ref|YP_001504823.1|   SQRD..G-----------nshtp......
gi|158318515|ref|YP_001511023.1|   SPTGl.SAHDDVTIRI--vd.........
gi|111224558|ref|YP_715352.1|      W---..------------dg.........
gi|111223459|ref|YP_714253.1|      SH--..------------rt.........
gi|111222769|ref|YP_713563.1|      S---..------------hrd........
gi|72162358|ref|YP_290015.1|       DDQG..ARTVSAPIAIR-vld........
gi|297561276|ref|YP_003680250.1|   DPEGr.TGTATTTVT---agn........
gi|269125269|ref|YP_003298639.1|   DNRGg.QGTVTEQVSVT-q..........
gi|271965255|ref|YP_003339451.1|   DPTGl.TGTASVIVTV--gn.........
gi|271964999|ref|YP_003339195.1|   DNAGa.TATAGKQVVVT-...........
gi|271969115|ref|YP_003343311.1|   DGTGl.TATADVVINV--gnt........
gi|271965721|ref|YP_003339917.1|   DDKGa.SGSAQVTVHVT-na.........
gi|271965721|ref|YP_003339917.1|   DDGDl.ETTATFIATV--va.........
gi|271965721|ref|YP_003339917.1|   DNHS..------------gat........
gi|271963973|ref|YP_003338169.1|   DGSS..STTSDVTVTV--...........
gi|271962487|ref|YP_003336683.1|   DDKG..SATTSAPVGI--sv.........
ReI_gi|357392895|ref|YP_004907736.1| DANG..RTTAT-------pss........

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0045880 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Onchocerca volvulus 22
NoYes   Echinococcus multilocularis
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Aspergillus wentii v1.0
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Cyanophora paradoxa
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Phytophthora capsici
NoYes   Fragilariopsis cylindrus
NoYes   Naegleria gruberi
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Acaryochloris marina MBIC11017
NoYes   Microcoleus sp. PCC 7113
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Nostoc sp. PCC 7524
NoYes   Conexibacter woesei DSM 14684
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Ilumatobacter coccineus
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus erythropolis PR4
NoYes   Mycobacterium sp. JLS
NoYes   Tropheryma whipplei TW08/27
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. FB24
NoYes   Micrococcus luteus NCTC 2665
NoYes   Bifidobacterium bifidum S17
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus bromii
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Acetobacterium woodii DSM 1030
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   Coprococcus sp. ART55/1
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Enterococcus hirae ATCC 9790
NoYes   Lactobacillus plantarum JDM1
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Isosphaera pallida ATCC 43644
NoYes   Rhodopirellula baltica SH 1
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Spirochaeta africana DSM 8902
NoYes   Desulfurispirillum indicum S5
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermovibrio ammonificans HB-1
NoYes   Persephonella marina EX-H1
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Nitrospira defluvii
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurovum sp. NBC37-1
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Methylibium petroleiphilum PM1
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia pickettii 12D
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia gladioli BSR3
NoYes   Variovorax paradoxus S110
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas mediterranea MMB-1
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Halothiobacillus neapolitanus c2
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Dickeya dadantii Ech703
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Nanoarchaeum equitans Kin4-M
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Acidilobus saccharovorans 345-15
NoYes   Aeropyrum pernix K1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus mucosus DSM 2162
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella conradii HZ254
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanocorpusculum labreanum Z
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasmatales archaeon BRNA1
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Methanobacterium sp. AL-21
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus fervens AG86
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Methanothermococcus okinawensis IH1
NoYes   Methanococcus aeolicus Nankai-3
NoYes   Methanococcus voltae A3
NoYes   Methanococcus vannielii SB
NoYes   Methanothermobacter marburgensis str. Marburg
NoYes   Methanothermobacter thermautotrophicus str. Delta H
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Crinalium epipsammum PCC 9333
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Anabaena cylindrica PCC 7122
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Tropheryma whipplei str. Twist
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Bifidobacterium longum NCC2705
NoYes   Bifidobacterium longum DJO10A
NoYes   Bifidobacterium breve UCC2003
NoYes   Bifidobacterium bifidum PRL2010
NoYes   Bifidobacterium bifidum BGN4
NoYes   Chthonomonas calidirosea T49
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus thermophilus JL-18
NoYes   Clostridium thermocellum DSM 1313
NoYes   Ruminococcus champanellensis 18P13
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Roseburia intestinalis XB6B4
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis IO-1
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus larvae subsp. larvae DSM 25430
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa SC2
NoYes   Paenibacillus polymyxa E681
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Alistipes shahii WAL 8301
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Treponema pedis str. T A4
NoYes   Acidithiobacillus ferrooxidans ATCC 23270
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Ralstonia pickettii 12J
NoYes   Burkholderia sp. CCGE1003
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Idiomarina loihiensis GSL 199
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Thioflavicoccus mobilis 8321
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Enterobacter aerogenes EA1509E
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Acinetobacter johnsonii SH046
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Caldisphaera lagunensis DSM 15908
NoYes   Sulfolobus islandicus LAL14/1
NoYes   Sulfolobus islandicus REY15A
NoYes   Sulfolobus islandicus HVE10/4
NoYes   Sulfolobus islandicus Y.G.57.14
NoYes   Sulfolobus islandicus L.S.2.15
NoYes   Sulfolobus islandicus M.16.27
NoYes   Sulfolobus islandicus M.14.25
NoYes   Sulfolobus islandicus M.16.4
NoYes   Sulfolobus islandicus L.D.8.5
NoYes   Sulfolobus acidocaldarius SUSAZ
NoYes   Sulfolobus acidocaldarius Ron12/I
NoYes   Sulfolobus acidocaldarius N8
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Thermococcus sp. AM4
NoYes   Thermococcus litoralis DSM 5473
NoYes   Pyrococcus furiosus DSM 3638
NoYes   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
NoYes   Halovivax ruber XH-70
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Natronobacterium gregoryi SP2
NoYes   Haloquadratum walsbyi C23
NoYes   Halorhabdus tiamatea SARL4B
NoYes   Natronomonas moolapensis 8.8.11
NoYes   Haloarcula hispanica N601
NoYes   Methanococcus maripaludis X1
NoYes   Methanobacterium sp. SWAN-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Anaerobic methane oxidation (AOM) community from Eel River Basin sediment, California (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP2 from Nymph Lake 10 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Single-cell genome from subgingival tooth surface TM7a (meta-genome)
NoYes   Single-cell genome from subgingival tooth surface TM7c (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]