SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

C2 domain (Calcium/lipid-binding domain, CaLB) alignments in Heterocephalus glaber v1.7-2

These alignments are sequences aligned to the 0044591 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1v27a_               gs............................................................................
HGL_H00000418143    dnnnpfqivlvkgnklnteetvkvhvraglfhgtellckt......................................
HGL_H00000369257    etihlergenlfeihinkitfssevlqasgdkepitfctya.....................................
HGL_H00000356236    eek...........................................................................
HGL_H00000391056    eepk..........................................................................
HGL_H00000391056    l.............................................................................
HGL_H00000353766    ieliqgskvnadermklvvqaglfhghemlcktvss..........................................
HGL_H00000263846    sr............................................................................
HGL_H00000382895    isllhqsenlfelhihqafltsaalvqagdtqpttfctyafydfethctplsvgpqplydftsqyvve..........
HGL_H00000263967    nsalrikilcatyvnvnirdidkiyvrtgichggeplcdnvntqr.................................
HGL_H00000358558    l.............................................................................
HGL_H00000346265    vaek..........................................................................
HGL_H00000356236    l.............................................................................
HGL_H00000324419-1  l.............................................................................
HGL_H00000228567-2  l.............................................................................
HGL_H00000361021-1  yrpvallfhkmmfetipmfsggtcnpqfvvcqlkvkiyssnsgptrredkfmyfefpq....................
HGL_H00000171887    mnnkplflhhvimh................................................................
HGL_H00000413254-1  ..............................................................................
HGL_H00000369257    dstdgn........................................................................
HGL_H00000358558    kseg..........................................................................
HGL_H00000324419-1  rs............................................................................
HGL_H00000340914    ag............................................................................
HGL_H00000228567-2  kte...........................................................................
HGL_H00000263431    pt............................................................................
HGL_H00000419260    tvslwdcdrnfrvki...............................................................
HGL_H00000381854    ngtplflhcvvl..................................................................
HGL_H00000319756    mnssplflhsvlvpmlpafepstg......................................................
HGL_H00000263846    ..............................................................................
HGL_H00000316464    ggtlq.........................................................................
HGL_H00000284384    ekrgriylka....................................................................
HGL_H00000357307    ..............................................................................
HGL_H00000413254-1  nsydsdea......................................................................
HGL_H00000413254-2  tfp...........................................................................
HGL_H00000369257    dstdgn........................................................................
HGL_H00000395220    tgdyg.........................................................................
HGL_H00000352065    gdfg..........................................................................
HGL_H00000340017-1  ..............................................................................
HGL_H00000382895    rsdtrn........................................................................
HGL_H00000340017-2  s.............................................................................
HGL_H00000362080    agdfgni.......................................................................
HGL_H00000340914    l.............................................................................
HGL_H00000356155    hripitwatsyedfylscslshggkelcsplqtrrahfskylfhli................................
HGL_H00000265970    eawttadqlqftifavhgissnwisnyekyylicslshngkdlfkpiqskkvgtyrnffyl.................
HGL_H00000228567-1  te............................................................................
HGL_H00000357307    spe...........................................................................
HGL_H00000297239    tsnf..........................................................................
HGL_H00000255224    ..............................................................................
HGL_H00000340017-2  d.............................................................................
HGL_H00000362080    p.............................................................................
HGL_H00000409572    k.............................................................................
HGL_H00000413254-2  ..............................................................................
HGL_H00000305355    rrgriyiqahid..................................................................
HGL_H00000260323    k.............................................................................
HGL_H00000347538    l.............................................................................
HGL_H00000380006    k.............................................................................
HGL_H00000262940    p.............................................................................
HGL_H00000402861    ..............................................................................
HGL_H00000308957    hl............................................................................
HGL_H00000255224    tsee..........................................................................
HGL_H00000377520    ad............................................................................
HGL_H00000377612    ..............................................................................
HGL_H00000347538    kyq...........................................................................
HGL_H00000371394    lg............................................................................
HGL_H00000395220    yk............................................................................
HGL_H00000308957    v.............................................................................
HGL_H00000350377    v.............................................................................
HGL_H00000361021-2  mifetipmfrgrtcnpqfvvcqlkvkihssnsgptrregkfmysefpqllpvcgdikvef..................
HGL_H00000396185-1  t.............................................................................
HGL_H00000264839    vlp...........................................................................
HGL_H00000285094    l.............................................................................
HGL_H00000374218    ..............................................................................
HGL_H00000228567-1  l.............................................................................
HGL_H00000402784    ip............................................................................
HGL_H00000374218    g.............................................................................
HGL_H00000350377    s.............................................................................
HGL_H00000361021-3  mfetipmfsggtcnpqfvvcqlkvkiyssns...............................................
HGL_H00000400409    ..............................................................................
HGL_H00000266505    ..............................................................................
HGL_H00000358200    ..............................................................................
HGL_H00000308957    n.............................................................................
HGL_H00000345988    ..............................................................................
HGL_H00000346265    apreel........................................................................
HGL_H00000324419-2  l.............................................................................
HGL_H00000371394    gtnea.........................................................................
HGL_H00000347244    g.............................................................................
HGL_H00000334105    s.............................................................................
HGL_H00000367747    q.............................................................................
HGL_H00000388756    ..............................................................................
HGL_H00000400409    e.............................................................................
HGL_H00000377612    pv............................................................................
HGL_H00000386881    n.............................................................................
HGL_H00000377612    pl............................................................................
HGL_H00000261729    vqllq.........................................................................
HGL_H00000356155    kvg...........................................................................
HGL_H00000256832    lpevf.........................................................................
HGL_H00000370719    g.............................................................................
HGL_H00000020926    e.............................................................................
HGL_H00000400398    ikl...........................................................................
HGL_H00000306124-2  vf............................................................................
HGL_H00000244751    gtiilaaeelsncrdvatmq..........................................................
HGL_H00000290472    c.............................................................................
HGL_H00000338185    t.............................................................................
HGL_H00000316464    pspkel........................................................................
HGL_H00000331602    mapflriafnsyelgslqaedea.......................................................
HGL_H00000265970    gav...........................................................................
HGL_H00000362369    ..............................................................................
HGL_H00000329127    ..............................................................................
HGL_H00000361768-2  qv............................................................................
HGL_H00000389039    p.............................................................................
HGL_H00000363443    e.............................................................................
HGL_H00000381982    qlriqqgippnh..................................................................
HGL_H00000373343    gtilltaeelsncrdia.............................................................
HGL_H00000385255    tfg...........................................................................
HGL_H00000386881    ..............................................................................
HGL_H00000262650    ks............................................................................
HGL_H00000374195    ..............................................................................
HGL_H00000374195    kl............................................................................
HGL_H00000356436    ys............................................................................
HGL_H00000324510    qn............................................................................
HGL_H00000352336    ..............................................................................
HGL_H00000279230    ..............................................................................
HGL_H00000382434    sp............................................................................
HGL_H00000394700    e.............................................................................
HGL_H00000264839    igm...........................................................................
HGL_H00000352208    pprqfrelpd....................................................................
HGL_H00000352065    e.............................................................................
HGL_H00000324510    gyiqqvfgtspeehieaiervkka......................................................
HGL_H00000377612    ..............................................................................
HGL_H00000361942-1  mkteg.........................................................................
HGL_H00000259406    v.............................................................................
HGL_H00000020926    pekaaswnq.....................................................................
HGL_H00000386881    qg............................................................................
HGL_H00000263125    spflriglsnfdcgscqscqgea.......................................................
HGL_H00000261729    s.............................................................................
HGL_H00000258098    ..............................................................................
HGL_H00000380006    pv............................................................................
HGL_H00000400843    py............................................................................
HGL_H00000340017-1  dsd...........................................................................
HGL_H00000198765    dnrvvlf.......................................................................
HGL_H00000388091    f.............................................................................
HGL_H00000361768-1  pmgdvhia......................................................................
HGL_H00000260323    vgqisvhvdiaatpgt..............................................................
HGL_H00000352208    y.............................................................................
HGL_H00000290776    vels..........................................................................
HGL_H00000352208    ..............................................................................
HGL_H00000388093    ts............................................................................
HGL_H00000388093    hqrm..........................................................................
HGL_H00000381982    i.............................................................................
HGL_H00000371646    gt............................................................................
HGL_H00000402784    l.............................................................................
HGL_H00000290776    l.............................................................................
HGL_H00000360108    hfkpltmksitvspvpffnkqrtgc.....................................................
HGL_H00000394700    is............................................................................
HGL_H00000361942-2  qer...........................................................................
HGL_H00000260402    visgqflser....................................................................
HGL_H00000262435    e.............................................................................
HGL_H00000352208    sddve.........................................................................
HGL_H00000354621-1  f.............................................................................
HGL_H00000316746    l.............................................................................
HGL_H00000262940    ..............................................................................
HGL_H00000244751    pat...........................................................................
HGL_H00000373343    pat...........................................................................
HGL_H00000385255    ediegnlllpdgvp................................................................
HGL_H00000360431    l.............................................................................
HGL_H00000377612    l.............................................................................
HGL_H00000389039    kpfdp.........................................................................
HGL_H00000265428    rl............................................................................
HGL_H00000386881    dk............................................................................
HGL_H00000381982    erp...........................................................................
HGL_H00000352208    n.............................................................................
HGL_H00000350377    g.............................................................................
HGL_H00000314499    hskpllvkavvmspvplfskqr........................................................
HGL_H00000262940    s.............................................................................
HGL_H00000400398    fs............................................................................
HGL_H00000198765    ..............................................................................
HGL_H00000381982    q.............................................................................
HGL_H00000216775    f.............................................................................
HGL_H00000385255    q.............................................................................
HGL_H00000388091    q.............................................................................
HGL_H00000386881    q.............................................................................
HGL_H00000386881    sedredi.......................................................................
HGL_H00000385255    md............................................................................
HGL_H00000352208    q.............................................................................
HGL_H00000216775    asrvelr.......................................................................
HGL_H00000317214    q.............................................................................
HGL_H00000400398    q.............................................................................
HGL_H00000377520    l.............................................................................
HGL_H00000274376    ..............................................................................
HGL_H00000317257    ..............................................................................
HGL_H00000264554    g.............................................................................
HGL_H00000374218    knk...........................................................................
HGL_H00000400398    g.............................................................................
HGL_H00000360642    elnst.........................................................................
HGL_H00000398577    a.............................................................................
HGL_H00000387882    le............................................................................
HGL_H00000385255    kp............................................................................
HGL_H00000388091    k.............................................................................
HGL_H00000313731    ..............................................................................
HGL_H00000331342    ..............................................................................
HGL_H00000380006    eisrld........................................................................
HGL_H00000348283    s.............................................................................
HGL_H00000303507    y.............................................................................
HGL_H00000387882    g.............................................................................
HGL_H00000400398    rp............................................................................
HGL_H00000261729    g.............................................................................
HGL_H00000266497    qlvisye.......................................................................
HGL_H00000370242    p.............................................................................
HGL_H00000388091    tt............................................................................
HGL_H00000386881    keani.........................................................................
HGL_H00000356621    ..............................................................................
HGL_H00000381982    vls...........................................................................
HGL_H00000381845    kavledpmlkfsglyqdt............................................................
HGL_H00000388091    lrlvvesariepp.................................................................
HGL_H00000352208    vqlt..........................................................................
HGL_H00000297239    tlp...........................................................................
HGL_H00000377473    r.............................................................................
HGL_H00000386183    i.............................................................................
HGL_H00000303909    y.............................................................................
HGL_H00000313601    ifpelssndm....................................................................
HGL_H00000325012    vpqstppdishlsps...............................................................
HGL_H00000369853    r.............................................................................
HGL_H00000343325-2  pl............................................................................
HGL_H00000381982    hv............................................................................
HGL_H00000385255    girpvl........................................................................
HGL_H00000334379    vsi...........................................................................
HGL_H00000350649-2  vallsvhf......................................................................
HGL_H00000379227    q.............................................................................
HGL_H00000363443    plelgnlqfclsyddylcrpmvmvlraralrlqedrgiasespphllgksfllsgvlisatrllpghlvpplagtsws
HGL_H00000260983    sdl...........................................................................
HGL_H00000266497    ..............................................................................
HGL_H00000340594    qyi...........................................................................
HGL_H00000350649-2  ..............................................................................
HGL_H00000388091    aieila........................................................................
HGL_H00000388091    lss...........................................................................
HGL_H00000400409    k.............................................................................
HGL_H00000317257    ..............................................................................
HGL_H00000303058    v.............................................................................
HGL_H00000291906    ssellavlkvdnravgqtgwgqvaer....................................................
HGL_H00000262992    ..............................................................................
HGL_H00000074304    a.............................................................................
HGL_H00000400398    vcvrrlig......................................................................
HGL_H00000385255    llvhl.........................................................................
HGL_H00000400398    svrpvlr.......................................................................
HGL_H00000334379    esepp.........................................................................
HGL_H00000354087    q.............................................................................
HGL_H00000338885    cprptrlflqqlrashlgse..........................................................
HGL_H00000398391    v.............................................................................
HGL_H00000334379    hkntfcylryklydheafwtplkkpkesanknqvmvtfkasrraevtrgpsllwyfr.....................
HGL_H00000348455-2  lrn...........................................................................


                                                                                                   1
                                                                                                    
d1v27a_               .....................................................................--SGSSGGQ
HGL_H00000418143    .....................................................................---------
HGL_H00000369257    .....................................................................---------
HGL_H00000356236    .....................................................................--EPENLGK
HGL_H00000391056    .....................................................................--EEEKLGK
HGL_H00000391056    .....................................................................-------GD
HGL_H00000353766    .....................................................................---------
HGL_H00000263846    .....................................................................----ENLGR
HGL_H00000382895    .....................................................................---------
HGL_H00000263967    .....................................................................---------
HGL_H00000358558    .....................................................................-------GE
HGL_H00000346265    .....................................................................----HELGR
HGL_H00000356236    .....................................................................-------GD
HGL_H00000324419-1  .....................................................................-------GE
HGL_H00000228567-2  .....................................................................-------GE
HGL_H00000361021-1  .....................................................................---------
HGL_H00000171887    .....................................................................---------
HGL_H00000413254-1  .....................................................................------RGK
HGL_H00000369257    .....................................................................---------
HGL_H00000358558    .....................................................................---AKSCGK
HGL_H00000324419-1  .....................................................................--NSKACGK
HGL_H00000340914    .....................................................................----TPCGR
HGL_H00000228567-2  .....................................................................--DVKTCGK
HGL_H00000263431    .....................................................................---------
HGL_H00000419260    .....................................................................---------
HGL_H00000381854    .....................................................................---------
HGL_H00000319756    .....................................................................---------
HGL_H00000263846    .....................................................................------RGE
HGL_H00000316464    .....................................................................-----VCGS
HGL_H00000284384    .....................................................................---------
HGL_H00000357307    .....................................................................------RGE
HGL_H00000413254-1  .....................................................................----TTLGA
HGL_H00000413254-2  .....................................................................-----ALGT
HGL_H00000369257    .....................................................................---------
HGL_H00000395220    .....................................................................--NVKVSGE
HGL_H00000352065    .....................................................................--NLEVKGN
HGL_H00000340017-1  .....................................................................------RGR
HGL_H00000382895    .....................................................................---------
HGL_H00000340017-2  .....................................................................---------
HGL_H00000362080    .....................................................................----FVTGK
HGL_H00000340914    .....................................................................-------GE
HGL_H00000356155    .....................................................................---------
HGL_H00000265970    .....................................................................---------
HGL_H00000228567-1  .....................................................................--NVKTCGK
HGL_H00000357307    .....................................................................--EDVMLGS
HGL_H00000297239    .....................................................................-DNTDVTGE
HGL_H00000255224    .....................................................................------RGE
HGL_H00000340017-2  .....................................................................---------
HGL_H00000362080    .....................................................................----SHKGE
HGL_H00000409572    .....................................................................---------
HGL_H00000413254-2  .....................................................................------RGR
HGL_H00000305355    .....................................................................---------
HGL_H00000260323    .....................................................................---------
HGL_H00000347538    .....................................................................-------GE
HGL_H00000380006    .....................................................................---------
HGL_H00000262940    .....................................................................--DEEVQGE
HGL_H00000402861    .....................................................................---------
HGL_H00000308957    .....................................................................---------
HGL_H00000255224    .....................................................................--KQEKLGT
HGL_H00000377520    .....................................................................-----AVGE
HGL_H00000377612    .....................................................................---------
HGL_H00000347538    .....................................................................------LGM
HGL_H00000371394    .....................................................................--DPRRWGR
HGL_H00000395220    .....................................................................-------GE
HGL_H00000308957    .....................................................................---------
HGL_H00000350377    .....................................................................---------
HGL_H00000361021-2  .....................................................................---------
HGL_H00000396185-1  .....................................................................---------
HGL_H00000264839    .....................................................................-------GQ
HGL_H00000285094    .....................................................................---------
HGL_H00000374218    .....................................................................---------
HGL_H00000228567-1  .....................................................................-------GE
HGL_H00000402784    .....................................................................---------
HGL_H00000374218    .....................................................................------LGE
HGL_H00000350377    .....................................................................---------
HGL_H00000361021-3  .....................................................................---------
HGL_H00000400409    .....................................................................---------
HGL_H00000266505    .....................................................................---------
HGL_H00000358200    .....................................................................---------
HGL_H00000308957    .....................................................................---------
HGL_H00000345988    .....................................................................---------
HGL_H00000346265    .....................................................................----EKLGD
HGL_H00000324419-2  .....................................................................-------GE
HGL_H00000371394    .....................................................................----EQMGE
HGL_H00000347244    .....................................................................---------
HGL_H00000334105    .....................................................................---------
HGL_H00000367747    .....................................................................---------
HGL_H00000388756    .....................................................................---------
HGL_H00000400409    .....................................................................---------
HGL_H00000377612    .....................................................................----GPLGQ
HGL_H00000386881    .....................................................................---------
HGL_H00000377612    .....................................................................---------
HGL_H00000261729    .....................................................................---------
HGL_H00000356155    .....................................................................-------GE
HGL_H00000256832    .....................................................................---------
HGL_H00000370719    .....................................................................---------
HGL_H00000020926    .....................................................................--PSSGTGE
HGL_H00000400398    .....................................................................---------
HGL_H00000306124-2  .....................................................................---------
HGL_H00000244751    .....................................................................---------
HGL_H00000290472    .....................................................................---------
HGL_H00000338185    .....................................................................---------
HGL_H00000316464    .....................................................................----PSRGF
HGL_H00000331602    .....................................................................---------
HGL_H00000265970    .....................................................................---------
HGL_H00000362369    .....................................................................---------
HGL_H00000329127    .....................................................................---------
HGL_H00000361768-2  .....................................................................---------
HGL_H00000389039    .....................................................................--------E
HGL_H00000363443    .....................................................................---------
HGL_H00000381982    .....................................................................---------
HGL_H00000373343    .....................................................................---------
HGL_H00000385255    .....................................................................--------M
HGL_H00000386881    .....................................................................---------
HGL_H00000262650    .....................................................................---------
HGL_H00000374195    .....................................................................---------
HGL_H00000374195    .....................................................................---------
HGL_H00000356436    .....................................................................---------
HGL_H00000324510    .....................................................................-----RFGR
HGL_H00000352336    .....................................................................---------
HGL_H00000279230    .....................................................................---------
HGL_H00000382434    .....................................................................---------
HGL_H00000394700    .....................................................................---------
HGL_H00000264839    .....................................................................---------
HGL_H00000352208    .....................................................................---------
HGL_H00000352065    .....................................................................-----NRGE
HGL_H00000324510    .....................................................................---------
HGL_H00000377612    .....................................................................---------
HGL_H00000361942-1  .....................................................................---------
HGL_H00000259406    .....................................................................------QGM
HGL_H00000020926    .....................................................................------APK
HGL_H00000386881    .....................................................................---------
HGL_H00000263125    .....................................................................---------
HGL_H00000261729    .....................................................................---------
HGL_H00000258098    .....................................................................---------
HGL_H00000380006    .....................................................................-------GE
HGL_H00000400843    .....................................................................---------
HGL_H00000340017-1  .....................................................................--DSTALGT
HGL_H00000198765    .....................................................................---------
HGL_H00000388091    .....................................................................---------
HGL_H00000361768-1  .....................................................................---------
HGL_H00000260323    .....................................................................---------
HGL_H00000352208    .....................................................................---------
HGL_H00000290776    .....................................................................---------
HGL_H00000352208    .....................................................................---------
HGL_H00000388093    .....................................................................----EWLGA
HGL_H00000388093    .....................................................................---------
HGL_H00000381982    .....................................................................---------
HGL_H00000371646    .....................................................................---------
HGL_H00000402784    .....................................................................---------
HGL_H00000290776    .....................................................................---------
HGL_H00000360108    .....................................................................---------
HGL_H00000394700    .....................................................................-----KCGN
HGL_H00000361942-2  .....................................................................---------
HGL_H00000260402    .....................................................................---------
HGL_H00000262435    .....................................................................---------
HGL_H00000352208    .....................................................................-------SN
HGL_H00000354621-1  .....................................................................---------
HGL_H00000316746    .....................................................................---------
HGL_H00000262940    .....................................................................---------
HGL_H00000244751    .....................................................................---------
HGL_H00000373343    .....................................................................---------
HGL_H00000385255    .....................................................................---------
HGL_H00000360431    .....................................................................---------
HGL_H00000377612    .....................................................................---------
HGL_H00000389039    .....................................................................-EPEAKYGT
HGL_H00000265428    .....................................................................---------
HGL_H00000386881    .....................................................................---------
HGL_H00000381982    .....................................................................---------
HGL_H00000352208    .....................................................................---------
HGL_H00000350377    .....................................................................---------
HGL_H00000314499    .....................................................................---------
HGL_H00000262940    .....................................................................---------
HGL_H00000400398    .....................................................................---------
HGL_H00000198765    .....................................................................---------
HGL_H00000381982    .....................................................................-------GR
HGL_H00000216775    .....................................................................---------
HGL_H00000385255    .....................................................................---------
HGL_H00000388091    .....................................................................-------GK
HGL_H00000386881    .....................................................................-------GK
HGL_H00000386881    .....................................................................------EGN
HGL_H00000385255    .....................................................................---------
HGL_H00000352208    .....................................................................-------GK
HGL_H00000216775    .....................................................................---------
HGL_H00000317214    .....................................................................---------
HGL_H00000400398    .....................................................................-------GS
HGL_H00000377520    .....................................................................-------GQ
HGL_H00000274376    .....................................................................---------
HGL_H00000317257    .....................................................................---------
HGL_H00000264554    .....................................................................-----PRGS
HGL_H00000374218    .....................................................................---------
HGL_H00000400398    .....................................................................---------
HGL_H00000360642    .....................................................................---------
HGL_H00000398577    .....................................................................--------Q
HGL_H00000387882    .....................................................................---------
HGL_H00000385255    .....................................................................---GIEQGR
HGL_H00000388091    .....................................................................---------
HGL_H00000313731    .....................................................................---------
HGL_H00000331342    .....................................................................---------
HGL_H00000380006    .....................................................................---------
HGL_H00000348283    .....................................................................---------
HGL_H00000303507    .....................................................................---------
HGL_H00000387882    .....................................................................--DERDFGR
HGL_H00000400398    .....................................................................---------
HGL_H00000261729    .....................................................................---------
HGL_H00000266497    .....................................................................---------
HGL_H00000370242    .....................................................................--------Q
HGL_H00000388091    .....................................................................---------
HGL_H00000386881    .....................................................................---------
HGL_H00000356621    .....................................................................---------
HGL_H00000381982    .....................................................................---------
HGL_H00000381845    .....................................................................---------
HGL_H00000388091    .....................................................................---------
HGL_H00000352208    .....................................................................---------
HGL_H00000297239    .....................................................................---------
HGL_H00000377473    .....................................................................---------
HGL_H00000386183    .....................................................................---------
HGL_H00000303909    .....................................................................---------
HGL_H00000313601    .....................................................................---------
HGL_H00000325012    .....................................................................---------
HGL_H00000369853    .....................................................................---------
HGL_H00000343325-2  .....................................................................---------
HGL_H00000381982    .....................................................................---------
HGL_H00000385255    .....................................................................---------
HGL_H00000334379    .....................................................................---------
HGL_H00000350649-2  .....................................................................---------
HGL_H00000379227    .....................................................................---------
HGL_H00000363443    ekpvptvnpisppgskqakatpcppvpqdspmapsvscppllvptpqlgpvptgardlslighchprpa---------
HGL_H00000260983    .....................................................................---------
HGL_H00000266497    .....................................................................---------
HGL_H00000340594    .....................................................................---------
HGL_H00000350649-2  .....................................................................---------
HGL_H00000388091    .....................................................................---------
HGL_H00000388091    .....................................................................---------
HGL_H00000400409    .....................................................................---------
HGL_H00000317257    .....................................................................---------
HGL_H00000303058    .....................................................................---------
HGL_H00000291906    .....................................................................---------
HGL_H00000262992    .....................................................................---------
HGL_H00000074304    .....................................................................---------
HGL_H00000400398    .....................................................................---------
HGL_H00000385255    .....................................................................---------
HGL_H00000400398    .....................................................................---------
HGL_H00000334379    .....................................................................---------
HGL_H00000354087    .....................................................................---------
HGL_H00000338885    .....................................................................---------
HGL_H00000398391    .....................................................................---------
HGL_H00000334379    .....................................................................---------
HGL_H00000348455-2  .....................................................................---------


                      0                                     20        30                            
                      |                                      |         |                            
d1v27a_               LSIKLWFDK.............................VGHQLIVTILGAKDLPSR.......E....DG........
HGL_H00000418143    ---------.............................------------------.......-....--........
HGL_H00000369257    ---------.............................------------------.......-....--........
HGL_H00000356236    LQFSLDYDF.............................QANQLTVGVLQAAELPAL.......D....MG........
HGL_H00000391056    LQYSLDYDF.............................QNNQLLVGIIQAAELPAL.......D....MG........
HGL_H00000391056    ICFSLRYVP.............................TAGKLTVVILEAKNLKKM.......D....VG........
HGL_H00000353766    ---------.............................------------------.......-....--........
HGL_H00000263846    IQFSVGYNF.............................QESTLTVKILKAQELPAK.......D....FS........
HGL_H00000382895    ---------.............................------------------.......-....--........
HGL_H00000263967    ---------.............................------------------.......-....--........
HGL_H00000358558    IMFSLCYLP.............................TAGRLTLTVIKCRNLKAM.......D....IT........
HGL_H00000346265    LQYSLDYDF.............................QSGQLLVGILQAEGLAAL.......D....LG........
HGL_H00000356236    ICTSLRYVP.............................TAGKLTVCILEAKNLKKM.......D....VG........
HGL_H00000324419-1  LMFSLCYLP.............................TAGRLTITIIKARNLKAM.......D....IT........
HGL_H00000228567-2  IMFSLCYLP.............................TAGRMTLTVIKCRNLKAM.......D....IT........
HGL_H00000361021-1  ---------.............................------------------.......-....--........
HGL_H00000171887    ---------.............................-------------GIPNF.......E....SK........
HGL_H00000413254-1  ILVSLMYST.............................QQGGLIVGIIRCVHLAAM.......D....AN........
HGL_H00000369257    ---------.............................-LNELHITIRCCSHLQSR.......A....SH........
HGL_H00000358558    INFSLRYDY.............................ESETLIVRILKAFDLPAK.......D....FC........
HGL_H00000324419-1  LNFILKYDC.............................DLEQLIVKIHKAINLPAK.......D....FS........
HGL_H00000340914    ISFALRYLY.............................GSDQLVVRILQALDLPAK.......D....SN........
HGL_H00000228567-2  LNFTLQYDY.............................ENELLVVKIIKALDLPAK.......D....FT........
HGL_H00000263431    ---------.............................-NEEIHVTVGEARNLIPM.......D....PN........
HGL_H00000419260    ---------.............................----------RGIDIPVL.......P....RN........
HGL_H00000381854    ---------.............................------------HGTPNF.......D....TG........
HGL_H00000319756    ---------.............................------------------.......-....--........
HGL_H00000263846    LLLSLCYNP.............................SANSIIVNIIKARNLKAM.......D....IG........
HGL_H00000316464    LNFALRYDP.............................GARELRVHVIQCQGLAAA.......-....--........
HGL_H00000284384    -----EV--.............................TDEKLHVTVRDAKNLIPM.......D....PN........
HGL_H00000357307    LQVSLSYQP.............................VVQRMTVVVLKARHLPKM.......D....IT........
HGL_H00000413254-1  LEFSLLYNQ.............................DNSSLQCTIIKAKGLKPM.......D....SN........
HGL_H00000413254-2  LDFSLLYDQ.............................ENNALHCTISKAKGLKPM.......D....HN........
HGL_H00000369257    ---------.............................-LNELHITIRCCSHLQSR.......A....SH........
HGL_H00000395220    ILLHISYCY.............................KTGGLNIFVKNCRNLAIG.......De...KK........
HGL_H00000352065    IQFAVDYVE.............................SLKELHVFVAQCKDLAAA.......Di...KR........
HGL_H00000340017-1  ILLSLCYSS.............................QRGGLLVGVLRCAHLAPM.......D....AN........
HGL_H00000382895    ---------.............................PQNELRIEITRCCGLRSR.......R....LG........
HGL_H00000340017-2  ----LSYSS.............................QRRGLLVGIIRCAHLAAM.......D....VN........
HGL_H00000362080    IAFSLNFEQ.............................QTQTLVIHVKECHQLAYA.......De...AK........
HGL_H00000340914    LNFSLCYLP.............................TAGRLTVTIIKASNLKAM.......D....LT........
HGL_H00000356155    ---------.............................------------------.......-....--........
HGL_H00000265970    ---------.............................------------------.......-....--........
HGL_H00000228567-1  LNFTLQYDYe............................KNELLVVKIIKALDLPEK.......D....FT........
HGL_H00000357307    LTFSVDYNF.............................PKKALVVTIQEAHGLPVM.......Dd...QT........
HGL_H00000297239    IEFAIRYCF.............................KTYCLEICIKTCKNLAYG.......Ee...KK........
HGL_H00000255224    LLISLCYQS.............................TTNTLTVVVLKARHLPKS.......D....VS........
HGL_H00000340017-2  ----LLYDR.............................ASCTLHCSILRAKGLRPM.......D....FN........
HGL_H00000362080    LVVSLKYIPspklpvggnwkkskgm.............EGGELQVWIKEAKNLTAA.......K....SG........
HGL_H00000409572    ---------.............................---RLIVKVISGQQLPKV.......Nkn..KN........
HGL_H00000413254-2  ILISLKYSS.............................QKQGLLVGIVRCAHLAAM.......D....AN........
HGL_H00000305355    ---------.............................-RDVLIVVVRDAKNLVPM.......D....PN........
HGL_H00000260323    ---------.............................----ITITVVSAQGLQAK.......D....KT........
HGL_H00000347538    LLLSLNYLP.............................SAGRLNVDIIRAKQLLQT.......D....VS........
HGL_H00000380006    ---------.............................----ITITVVCAQGLQAK.......D....KT........
HGL_H00000262940    IHLRLELLPga...........................RGCRLRCSVLEARDLAPK.......D....RN........
HGL_H00000402861    ---------.............................----LHVKIISGQNFPKP.......KgacaKG........
HGL_H00000308957    ---------.............................WRGIVSITLIEGRDLKAM.......D....SN........
HGL_H00000255224    LYFSLEYNF.............................EKKAFVVNIKEACGLPAM.......De...QS........
HGL_H00000377520    ILLSLSYLP.............................TAERLTVVVVKAKNLIWT.......N....DK........
HGL_H00000377612    ---------.............................---VLRIHILEAQDLIAK.......D....RFlgglvk..
HGL_H00000347538    LHFSTQYDL.............................LHNHLTVRVIEARDLPPPiaqdgsrQ....DM........
HGL_H00000371394    MQLSLAYDF.............................GSQEIKVGLKQAADLRAE.......-....--........
HGL_H00000395220    LTVVLRYTPpgesvmlplgqlqgkkaskkgkkkespviSGGILEVFIKEAKNLTAV.......K....SG........
HGL_H00000308957    ---------.............................--GFLQVKVIRAEGLMAA.......D....VT........
HGL_H00000350377    ---------.............................--GILQVKVLKAVDLLAA.......D....FS........
HGL_H00000361021-2  ---------.............................------------------.......-....--........
HGL_H00000396185-1  ---------.............................----LLVQVISGQQLPKV.......Nntk.EK........
HGL_H00000264839    LAVKLWYDK.............................VGHQLIVNVLQATDLPCR.......V....DG........
HGL_H00000285094    ---------.............................----LHIKIISGQNFPKP.......KgsgaKG........
HGL_H00000374218    ---------.............................--GVIRIHLLEAEKLAQK.......DnflgLG........
HGL_H00000228567-1  IMFSLCYLP.............................AAGHMILTVIKCRNLKAM.......D....IT........
HGL_H00000402784    ---------.............................-KGVLRIHFIEAQDLQGK.......D....TYlkglvk..
HGL_H00000374218    IQLTVRYVC.............................LWRCLRVLVNGCRNLTPC.......-....TS........
HGL_H00000350377    --------P.............................FAYLLTIHLKEGRNLVVR.......D....RC........
HGL_H00000361021-3  ---------.............................------------------.......-....--........
HGL_H00000400409    ---------.............................-------------GLQAK.......D....KT........
HGL_H00000266505    ---------.............................----ITIRLISGIQLPLS.......Gs...SS........
HGL_H00000358200    ---------.............................----VQVTVLQAKDLKPK.......G....KS........
HGL_H00000308957    --------P.............................GMYQLDITLKRGQSLAAR.......D....RG........
HGL_H00000345988    ---------.............................---QLILKVISGQQLPKPpdsmfg.D....RG........
HGL_H00000346265    ICFSLRYVP.............................TAGKLTVIVLEAKNLKKM.......D....VG........
HGL_H00000324419-2  LMFSLCYLP.............................MAGRIIITIIKARDLKAM.......D....LT........
HGL_H00000371394    LCLSLRYVP.............................SSGRLTVVVLEARGLSP-.......-....--........
HGL_H00000347244    ---------.............................-IGRLMVHVIEATELKAC.......K....PN........
HGL_H00000334105    ---------.............................------VQVISGQFLSDK.......-....--........
HGL_H00000367747    ---------.............................----LALRIISGQQLPKPrdsmlg.D....RG........
HGL_H00000388756    ---------.............................--GKLKVKIVAGRHLPVM.......Dr...AS........
HGL_H00000400409    ---------.............................------------------.......-....--........
HGL_H00000377612    VKLTVWYYS.............................EERKLVSIVHGCRALRQN.......-....GR........
HGL_H00000386881    ---------.............................-RYHLRCYMYQARDLPSM.......D....KD........
HGL_H00000377612    ---------.............................PRGIIRIHLLAAQGLSSK.......D....KYvkglie..
HGL_H00000261729    -------DS.............................RGRCLRCHLLQARDLAPR.......D....MS........
HGL_H00000356155    VKLSISY--.............................KNNKLFIMVMHIRGLQLL.......Q....DG........
HGL_H00000256832    ---------.............................------------------.......-....LL........
HGL_H00000370719    ---------.............................-IGRLMVNVVEGIELKPC.......R....SH........
HGL_H00000020926    VLLSISYLP.............................AANRLLVVLIKAKNLHSN.......Qsk..VL........
HGL_H00000400398    ---------.............................---LIRVYVVKATNLAPA.......D....PN........
HGL_H00000306124-2  ---------.............................-NGLLKIKICEAVSLKPT.......A....WSlrhavgpr
HGL_H00000244751    ---------.............................---------FCANKLDKK.......D....FF........
HGL_H00000290472    ---------.............................--WRLTVRVLEAWRLHRV.......D....LL........
HGL_H00000338185    ---------.............................----LSVKIISGQFLSDK.......-....--........
HGL_H00000316464    LSLSLKYVPagsegggqp....................VSGELHFWVKEAQNLMPL.......-....RS........
HGL_H00000331602    ---------.............................------------------.......-....--........
HGL_H00000265970    ---KLSISY.............................RNGTLFIMVMHIKDLVTE.......D....GA........
HGL_H00000362369    ---------.............................----ICIEVLGARHLPKN.......-....GR........
HGL_H00000329127    ---------.............................----LRVRIGEAVGLQPT.......R....WSlrhslfkk
HGL_H00000361768-2  -----GMMD.............................KKGQLEVEIIRARGLVVK.......Pg...SK........
HGL_H00000389039    ILIGLLYNA.............................TTGRLSAEVIKGSHFKNL.......A....ANrppnglfc
HGL_H00000363443    ------YQP.............................KAEKLLVGLIKAQQLRT-.......-....PS........
HGL_H00000381982    --------P.............................VQVLIRVYIVAAFNLSPA.......D....PD........
HGL_H00000373343    ---------.............................------TMQLCANKLDKK.......D....FF........
HGL_H00000385255    FQGIPSNDS.............................INVLVRVYVVRATDLHPA.......D....IN........
HGL_H00000386881    ---------.............................----LCCLLVRASNLPSV.......K....KD........
HGL_H00000262650    ---------.............................---QLQITVLSAKLKENK.......K....NW........
HGL_H00000374195    ---------.............................----VRIKIGEAKNLPSY.......Pg...PT........
HGL_H00000374195    ---------.............................-----ATRILECQGLPIV.......-....-N........
HGL_H00000356436    ---------.............................--HKFTVVVLRATKVTKGafg....D....ML........
HGL_H00000324510    LSIRCYYEA.............................AEQRLTVEVLHAADLLPL.......D....TN........
HGL_H00000352336    ---------.............................---TLTIKVLGARHLPKP.......-....GR........
HGL_H00000279230    ---------.............................----LRVKVISGQFLSDR.......-....--........
HGL_H00000382434    ---------.............................-CHLLTVRVIQMKNVRQA.......D....LL........
HGL_H00000394700    LLVGLSYNA.............................TTGRLSVEMIKGSHFRNL.......A....VN........
HGL_H00000264839    -------ED.............................KKGQLEVEVIRARSLTQK.......Pg...SK........
HGL_H00000352208    ------SVP.............................QECTVRIYIVRGLELQPQ.......D....NN........
HGL_H00000352065    MKLALQYVPepipgkklp....................TTGEVHIWVKECFDLPLL.......-....RG........
HGL_H00000324510    -------KA.............................PTYTLKVSVMRAKNLLAK.......D....PN........
HGL_H00000377612    ---------.............................---ILVVYLDRAQDLPLK.......K....GN........
HGL_H00000361942-1  ---------.............................--EQLVVEILQCRNITYK.......Fks..PD........
HGL_H00000259406    GQLKLSIDA.............................QDRVLLLHIIEAKGLMSK.......-....EP........
HGL_H00000020926    LHYCLDYDR.............................QKAELFVTCLEAL---TS.......D....HD........
HGL_H00000386881    --------P.............................QDCLVRIYIVRAFGLQPK.......D....PN........
HGL_H00000263125    ---------.............................------------------.......-....--........
HGL_H00000261729    ---------.............................----LHIRVVEGRALPAK.......D....VS........
HGL_H00000258098    ---------.............................----VQVTVLRARGLRGK.......Ssg..VG........
HGL_H00000380006    VSIQVDLFThpgt.........................GEHKVTVKVVAANDLKWQ.......-....TA........
HGL_H00000400843    ---------.............................--YDLQVKVLRARNIQGT.......D....LL........
HGL_H00000340017-1  LEFTLLFDA.............................DNSALHCTAHRAKGLKPP.......-....AS........
HGL_H00000198765    ---------.............................--------EMQARKLDNK.......D....LF........
HGL_H00000388091    --------P.............................QQCLVRVYVVRAINLQPQ.......D....YN........
HGL_H00000361768-1  ------IMD.............................RGGQLEVEVIEARGLTPK.......Pg...SK........
HGL_H00000260323    ---------.............................GEHKVTVKVIAINDLHWQ.......-....TT........
HGL_H00000352208    ---------.............................-IYHLRCYIYQARNLMAL.......D....KD........
HGL_H00000290776    ---------.............................---------VSGQNLLDR.......D....VT........
HGL_H00000352208    ---------.............................----LRVIVESASNIPKT.......-....KF........
HGL_H00000388093    VTVKASYRS.............................SEQKLHVELLSASSLLPL.......D....SN........
HGL_H00000388093    LQQARELKK.............................PIFCLKATVKQAKGILGK.......D....VS........
HGL_H00000381982    ---------.............................-----SITIIEARQLVG-.......-....--........
HGL_H00000371646    ---------.............................-VGRLSITVVQAKLAKNY.......-....GM........
HGL_H00000402784    ---------.............................----LILYLDSARNLPVG.......Kk...IN........
HGL_H00000290776    ---------.............................----------AGRKLDKK.......D....LF........
HGL_H00000360108    ---------.............................------------------.......-....--........
HGL_H00000394700    LDVMFEYRV.............................ATQKLTVTIVRAQGLPDK.......D....RS........
HGL_H00000361942-2  ---------.............................-NGQLEVDIIQARGLTAR.......Pg...SK........
HGL_H00000260402    ---------.............................------------------.......-....--........
HGL_H00000262435    ---------.............................--------VLCAKNLVKK.......D....FF........
HGL_H00000352208    LLLPAGIAL.............................RWVTFMLKIYRAEDIPQM.......D....DAfsqtvkei
HGL_H00000354621-1  ---------.............................-------KILCAKNLAKK.......D....FF........
HGL_H00000316746    ---------.............................--ARLEVTIVQARNLWGD.......-....WI........
HGL_H00000262940    ---------.............................------------------.......-....--........
HGL_H00000244751    ---------.............................---KVEITV-SCRNLLDK.......D....MF........
HGL_H00000373343    ---------.............................---KIEITV-SCRNLLDL.......D....TF........
HGL_H00000385255    --------Aer...........................QWARFYVKIYRAEGLPRM.......N....TSlmanvkka
HGL_H00000360431    ---------.............................-------TIVSGQNVCPG.......N....ST........
HGL_H00000377612    ---------.............................----LSVYLERAEDLPLR.......K....GT........
HGL_H00000389039    LDVTFDYDS.............................QEQKLLVTVTAVTDIPAY.......N....RA........
HGL_H00000265428    ---------.............................---QLQVTVSSAKLKRKK.......N....WF........
HGL_H00000386881    --------P.............................QDFQIRVQVIKGHQLPGV.......N....--........
HGL_H00000381982    ---------.............................-WARFYVRLYRAEGLPKM.......N....SSimanvtka
HGL_H00000352208    -------KP.............................QDFQLRVRVIEGRQLSG-.......-....--........
HGL_H00000350377    ---------.............................---IISIILLEGKNISGG.......-....--........
HGL_H00000314499    ---------.............................------------------.......-....--........
HGL_H00000262940    ---------.............................----LSIRIVEGKNLPAK.......D....IT........
HGL_H00000400398    ---------.............................-YFQLRAHLYQARGVLAA.......D....DS........
HGL_H00000198765    ---------.............................---------ISCNNLLDL.......D....AT........
HGL_H00000381982    LQMWVDMFPkdmpqpgppvdisprkp............KGYELRVTIWNTEDVILE.......D....ENiftgq...
HGL_H00000216775    ---------.............................----------RAQKLDNK.......D....LF........
HGL_H00000385255    ---------.............................-AFQLRAHMYQARSLFAA.......D....SS........
HGL_H00000388091    VQMWVDIFPqklgppgppvkistrkp............KRYELRCIVWKTTQVDLV.......DealsRE........
HGL_H00000386881    LQMWIDIFPkalgrpgppfnitprka............RRFFLRCIIWNTRDVILD.......D....LSltge....
HGL_H00000386881    LLRPTGVAL.............................RGAHFCLKIFRAEDLPQM.......D....DAvmdnvkqi
HGL_H00000385255    ---------.............................--YQVSITVIEARQLVGL.......N....--........
HGL_H00000352208    LQMWVDVFPkslgppgppfnitprks............KRYYLRVIIWNTKDVILD.......E....KSitge....
HGL_H00000216775    ---------.............................---------VSCHGLLDR.......D....TL........
HGL_H00000317214    ---------.............................------ITIHSAEGLEKK.......N....AN........
HGL_H00000400398    LHMWIDIFPkdvpapppvdikprqp.............ISYELRVIIWNTEDVVLD.......D....VN........
HGL_H00000377520    VEVSMEYDS.............................ASHTLHVAVLQGKDLLER.......E....EA........
HGL_H00000274376    ---------.............................----LVLHIEEAHKLPVK.......-....--........
HGL_H00000317257    ---------.............................---------ISCEHLIDK.......D....IS........
HGL_H00000264554    VRLLAEYEA.............................AQARLRVRLLVAEGLYER.......Pw...EA........
HGL_H00000374218    ---------.............................------------------.......-....VS........
HGL_H00000400398    ---------.............................------VTVLEAQKLVGV.......N....--........
HGL_H00000360642    ---------.............................---EMHLIIVRGMNLPAP.......Pgv..TT........
HGL_H00000398577    VQIGLRYDA.............................KSSSFMVIIAQLRNLHAF.......L....IP........
HGL_H00000387882    --LGTCFQA.............................VNSRIQLQILEAQYLPSS.......-....TP........
HGL_H00000385255    LELWVDMFPmdmpapgtpldisprkp............KKYELRVIVWNTDEVVLE.......D....DDfftge...
HGL_H00000388091    --------P.............................HYYQLFCYIYQARNLMSN.......Q....VL........
HGL_H00000313731    --------P.............................PNTTLTIQVLSAQQLPKL.......Ntek.PG........
HGL_H00000331342    ---------.............................----VQVTVLQARGLRAK.......G....PG........
HGL_H00000380006    ---------.............................------------------.......-....--........
HGL_H00000348283    ---------.............................---QLTLKVVSAKPKVHN.......-....RQ........
HGL_H00000303507    ---------.............................--GFLNVIVHSASGFKQS.......-....--........
HGL_H00000387882    LNVKLFYNS.............................SVDQIWITVLQCRDLNWP.......Ss...YG........
HGL_H00000400398    ---------.............................-WARLRVRVYRAERLPAL.......R....PGllgsltra
HGL_H00000261729    ---------.............................------------------.......-....--........
HGL_H00000266497    ---------.............................-DAKLTILVKHMKNIHLP.......-....DG........
HGL_H00000370242    IHVGFLHDS.............................ASECLLVHVLQLRNFAGL.......V....MR........
HGL_H00000388091    ---------.............................-MAYLQLFIYCAEDLLLG.......-....RN........
HGL_H00000386881    YMVPQNIKPal...........................QRTAIEILAWGLRNMKSY.......Q....LA........
HGL_H00000356621    ---------.............................---VLRLWIIEAKDLAPK.......-....--........
HGL_H00000381982    ---------.............................-KYRVEVLFWGVREMKKV.......Q....LL........
HGL_H00000381845    ---------.............................------------------.......-....--........
HGL_H00000388091    ---------.............................------------------.......-....LS........
HGL_H00000352208    ---------.............................---AIEILAWGLRNMKNY.......Q....MA........
HGL_H00000297239    ---------.............................------------------.......-....--........
HGL_H00000377473    VQVALKYDE.............................KNKQFAILIIRLSNLSAL.......L....LQ........
HGL_H00000386183    ---------.............................----LKLWVIEAKDLPAK.......-....--........
HGL_H00000303909    ---------.............................--GFLHVIVHSAKGFKQS.......-....--........
HGL_H00000313601    ---------.............................-----LLFIVKGINLPTP.......Pgl..SP........
HGL_H00000325012    ---------.............................NKETIEVTLHGATNLPAC.......S....DG........
HGL_H00000369853    ---------.............................----LQVKNIRASLLLDP.......G....AS........
HGL_H00000343325-2  ---------.............................-TGTLEVRVVGCRDLPEN.......I....PWnplpsgtp
HGL_H00000381982    ---------.............................--FQLRAHMYQARGLIAA.......D....SN........
HGL_H00000385255    ---------.............................SKYRVEVLFWGLRDLKRV.......N....LA........
HGL_H00000334379    ---------.............................-------LVERAMHLSLK.......G....SPlterkv..
HGL_H00000350649-2  ---------.............................------------------.......-....--........
HGL_H00000379227    ---------.............................-----------AMGLKKG.......-....MF........
HGL_H00000363443    ---------.............................------------------.......-....--........
HGL_H00000260983    ---------.............................----------RAVGLKKG.......-....MF........
HGL_H00000266497    ---------.............................------------------.......-....--........
HGL_H00000340594    ---------.............................-SGLMSVHFYGAEDLKPP.......-....RI........
HGL_H00000350649-2  ---------.............................----------NARKLDDK.......D....FF........
HGL_H00000388091    ---------.............................---------WGLRNMKQA.......-....--........
HGL_H00000388091    -------KP.............................QHFQVRVKVFEARQLMGN.......-....--........
HGL_H00000400409    ---------.............................----VTVKVVAANDLKWQ.......-....TS........
HGL_H00000317257    ---------.............................------------------.......-....--........
HGL_H00000303058    ---------.............................-----VVSILEGRHFPKR.......-....--........
HGL_H00000291906    ---------.............................------------------.......-....--........
HGL_H00000262992    ---------.............................--------ILACKDLVAP.......V....CD........
HGL_H00000074304    ---------.............................-----------CSELHTP.......S....LD........
HGL_H00000400398    ---------.............................------------------.......-....LP........
HGL_H00000385255    ---------.............................---------KSVSEL---.......-....-R........
HGL_H00000400398    ---------.............................-EFRVEVLFWGLRGLGRV.......H....LF........
HGL_H00000334379    ---------.............................------------------.......-....--........
HGL_H00000354087    ---------.............................------VHVLGAAGLKDS.......-....-T........
HGL_H00000338885    ---------.............................------------------.......-....LG........
HGL_H00000398391    ---------.............................------------------.......-....--........
HGL_H00000334379    ---------.............................------------------.......-....--........
HGL_H00000348455-2  ---------.............................---------IAAQNIVNR.......N....GH........


                                                        40             50                           
                                                         |              |                           
d1v27a_               ...................................R.....PRNPYVKIYF.LPD.......RSD.............
HGL_H00000418143    ...................................-.....----------.---.......---.............
HGL_H00000369257    ...................................-.....---------F.---.......--Y.............
HGL_H00000356236    ...................................G.....TSDPYVKVFL.LPD.......--K.............
HGL_H00000391056    ...................................G.....TSDPYVKVFL.LPD.......--K.............
HGL_H00000391056    ...................................G.....LSDPYVKIHL.MQN.......GKR.............
HGL_H00000353766    ...................................-.....----------.---.......---.............
HGL_H00000263846    ...................................G.....TSDPFVKIYL.LPD.......--K.............
HGL_H00000382895    ...................................-.....----------.---.......---.............
HGL_H00000263967    ...................................-.....----------.---.......---.............
HGL_H00000358558    ...................................G.....YSDPYVKVSL.LCD.......GRR.............
HGL_H00000346265    ...................................G.....SSDPYVRVYL.LPD.......--K.............
HGL_H00000356236    ...................................G.....LSDPYVKIHL.MQN.......GKR.............
HGL_H00000324419-1  ...................................G.....ASDPYVKVSL.MCD.......SRR.............
HGL_H00000228567-2  ...................................G.....SSDPYVKVSL.MCE.......GRR.............
HGL_H00000361021-1  ...................................-.....----------.---.......---.............
HGL_H00000171887    ...................................G.....GCRPFLRIYQ.---.......--A.............
HGL_H00000413254-1  ...................................G.....YSDPFVKLWL.KPD.......MGK.............
HGL_H00000369257    ...................................L.....QPHPYVVYKF.---.......-FD.............
HGL_H00000358558    ...................................G.....SSDPYVKIYL.LPD.......--R.............
HGL_H00000324419-1  ...................................G.....TSDPYVKIYL.LPD.......--R.............
HGL_H00000340914    ...................................G.....FSDPYVKIYL.LPD.......--R.............
HGL_H00000228567-2  ...................................G.....TSDPYVKMYL.LPD.......--R.............
HGL_H00000263431    ...................................G.....LSDPYVKLKL.IPD.......PRN.............
HGL_H00000419260    ...................................A.....DLTVFVEANI.QHG.......QQV.............
HGL_H00000381854    ...................................G.....ACRPFLKVYQ.---.......--A.............
HGL_H00000319756    ...................................-.....-FQPFLKIYQ.---.......--S.............
HGL_H00000263846    ...................................G.....TSDPYVKVWL.MYK.......DKR.............
HGL_H00000316464    ...................................R.....RSDPYVKSYL.HPD.......--K.............
HGL_H00000284384    ...................................G.....LSDPYVKLKL.IPD.......PKN.............
HGL_H00000357307    ...................................G.....LSDPYVKVNV.YYG.......RKR.............
HGL_H00000413254-1  ...................................G.....LADPYVKLHL.LPG.......ASK.............
HGL_H00000413254-2  ...................................G.....LADPYVKLHL.LPG.......ASK.............
HGL_H00000369257    ...................................L.....QPHPYVVYKF.---.......-FD.............
HGL_H00000395220    ...................................Q.....RTDAYVKSYL.LPD.......KSR.............
HGL_H00000352065    ...................................Q.....RSDPYVKTYL.LPD.......KGK.............
HGL_H00000340017-1  ...................................G.....YSDPFVRLSF.LHPn......LGK.............
HGL_H00000382895    ...................................T.....QPSPYAVYRF.---.......-FT.............
HGL_H00000340017-2  ...................................G.....YSDPYVKTYL.RPD.......VDK.............
HGL_H00000362080    ...................................K.....RSNPYVKTYL.LPD.......KSR.............
HGL_H00000340914    ...................................G.....FSDPYVKASL.ISE.......GRR.............
HGL_H00000356155    ...................................-.....----------.---.......---.............
HGL_H00000265970    ...................................-.....----------.---.......---.............
HGL_H00000228567-1  ...................................G.....TSGPHVKTYL.LPD.......--R.............
HGL_H00000357307    ...................................Q.....ASDPYIKMTI.LPD.......--K.............
HGL_H00000297239    ...................................K.....KCNPYVKTYL.LPD.......RSS.............
HGL_H00000255224    ...................................G.....LSDPYVKVNL.YHA.......KKR.............
HGL_H00000340017-2  ...................................G.....LADPYVKLHL.LPG.......ACK.............
HGL_H00000362080    ...................................G.....TSDSFVKGYL.LPM.......RNK.............
HGL_H00000409572    ...................................S.....IVDPRVTVEI.HGV.......GRD.............
HGL_H00000413254-2  ...................................G.....YSDPYVKTQA.RPC.......TKLghgqlvwelqgpc
HGL_H00000305355    ...................................G.....LSDPYVKLKL.IPD.......PKS.............
HGL_H00000260323    ...................................G.....SSDPYVTVQV.---.......--G.............
HGL_H00000347538    ...................................Q.....GSDPFVKIQL.VHG.......LKL.............
HGL_H00000380006    ...................................G.....SSDPYVTVQV.---.......--G.............
HGL_H00000262940    ...................................G.....ASDPFVRVRY.---.......--N.............
HGL_H00000402861    ...................................D.....VIDPYVCVEI.HGI.......PAD.............
HGL_H00000308957    ...................................G.....LSDPYVKFRL.---.......--G.............
HGL_H00000255224    ...................................M.....TSDPYIKMTI.LPE.......--K.............
HGL_H00000377520    ...................................T.....TADPFVKVYL.LQD.......GRK.............
HGL_H00000377612    ...................................G.....KSDPYVKLKL.---.......--A.............
HGL_H00000347538    ...................................A.....HSNPYVKICL.LPD.......--Q.............
HGL_H00000371394    ...................................G.....MADPYARVSV.--S.......TQA.............
HGL_H00000395220    ...................................G.....TSDSFVKGYL.LPD.......DSK.............
HGL_H00000308957    ...................................G.....KSDPFCVVEL.---.......--N.............
HGL_H00000350377    ...................................G.....KSDPFCLLEL.---.......--G.............
HGL_H00000361021-2  ...................................-.....----------.---.......---.............
HGL_H00000396185-1  ...................................S.....IVDPLVKVEI.FGI.......HAD.............
HGL_H00000264839    ...................................R.....PRNPYVKMYF.LPD.......RSD.............
HGL_H00000285094    ...................................D.....VVDPYVYVEI.HGI.......PAD.............
HGL_H00000374218    ...................................C.....KSDPYAKVSI.---.......--G.............
HGL_H00000228567-1  ...................................G.....SSDLYVKVSL.ICE.......GRR.............
HGL_H00000402784    ...................................G.....KSDPYGIIRV.---.......--G.............
HGL_H00000374218    ...................................S.....GADPYVRVYL.LPE.......RRW.............
HGL_H00000350377    ...................................G.....TSDPYVKFKL.---.......-NG.............
HGL_H00000361021-3  ...................................-.....----------.---.......---.............
HGL_H00000400409    ...................................G.....SSDPYVTVQV.---.......--G.............
HGL_H00000266505    ...................................H.....KPDTLVIIEV.FGV.......PND.............
HGL_H00000358200    ...................................G.....TNDTYTIIQL.---.......--G.............
HGL_H00000308957    ...................................G.....TSDPYVKFKI.---.......-GR.............
HGL_H00000345988    ...................................E.....IIDPFVEVEI.IGL.......PVD.............
HGL_H00000346265    ...................................G.....LSDPYVKVHL.LQG.......GKK.............
HGL_H00000324419-2  ...................................G.....VSDPYVKVSL.MCE.......GRE.............
HGL_H00000371394    ...................................E.....LAEPYVKVQL.---.......MXK.............
HGL_H00000347244    ...................................G.....KSNPYCEVSM.---.......--G.............
HGL_H00000334105    ...................................-.....KIGTYVEVDM.YGLpt.....DTI.............
HGL_H00000367747    ...................................E.....IIDPFVEVEV.IGL.......PVD.............
HGL_H00000388756    ...................................D.....LTDAFVEVKF.---.......--G.............
HGL_H00000400409    ...................................-.....KFNTYVTLKV.---.......--Q.............
HGL_H00000377612    ...................................D.....PPDPYVSLLL.LPD.......KNR.............
HGL_H00000386881    ...................................S.....FSDPYAIVSF.---.......--L.............
HGL_H00000377612    ...................................G.....KSDPYALVRV.---.......--G.............
HGL_H00000261729    ...................................G.....TSDPFARIFW.---.......--G.............
HGL_H00000356155    ...................................N.....DPDPYVKIYL.LPD.......PQK.............
HGL_H00000256832    ...................................G.....ICDPYVKLSL.YVAde.....NRE.............
HGL_H00000370719    ...................................G.....KSNPYCEVTM.---.......--G.............
HGL_H00000020926    ...................................L.....GKDVSVKVTL.KHQ.......AQK.............
HGL_H00000400398    ...................................G.....KADPYVVVSA.---.......--G.............
HGL_H00000306124-2  ................................pqtF.....LLDPYIALNV.---.......-DD.............
HGL_H00000244751    ...................................G.....KSDPFLVFYR.SNEd......GTF.............
HGL_H00000290472    ...................................S.....EADPYVILQL.--P.......TSP.............
HGL_H00000338185    ...................................-.....KVGTYVEVDM.FGLpv.....DTR.............
HGL_H00000316464    ...................................G.....SPDTFVQCSV.LPD.......DSR.............
HGL_H00000331602    ...................................-.....-SQPFCAVKM.KEA.......-LS.............
HGL_H00000265970    ...................................-.....DPNPYVKTYL.LPD.......THK.............
HGL_H00000362369    ...................................G.....IVCPFVEIEV.AGA.......EYD.............
HGL_H00000329127    .................................ghQ.....LLDPYLTVSV.---.......-DQ.............
HGL_H00000361768-2  ...................................T.....LPAPYVKVYL.LNN.......GVC.............
HGL_H00000389039    ........................clkhliggqvyI.....IRDTYVKLTL.LNSm......GQE.............
HGL_H00000363443    ...................................E.....TCSPLVKLYL.LPD.......--E.............
HGL_H00000381982    ...................................G.....KSDPYIVLRL.---.......GKT.............
HGL_H00000373343    ...................................G.....KSDPFLVFYR.SNEd......GTF.............
HGL_H00000385255    ...................................G.....KADPYIAIRL.---.......GKT.............
HGL_H00000386881    ...................................R.....RSDPVASLTF.---.......--R.............
HGL_H00000262650    ...................................F.....GPSPYVEVTV.---.......--D.............
HGL_H00000374195    ...................................R.....MRDCYCTVNL.---.......-DQ.............
HGL_H00000374195    ...................................G.....QCDPYATVTL.AGPfrqvvpvPPT.............
HGL_H00000356436    ...................................D.....TPDPYVELFI.--S.......TTP.............
HGL_H00000324510    ...................................G.....LSDPFVIVEL.GPPhl.....FPL.............
HGL_H00000352336    ...................................S.....IACPFVEVEI.CGA.......EYD.............
HGL_H00000279230    ...................................-.....KVGIYVEVDM.FGLp......IDT.............
HGL_H00000382434    ...................................S.....QTDCFVSLWL.--P.......TAS.............
HGL_H00000394700    ...................................R.....APDTYGKLFL.LNSv......GQE.............
HGL_H00000264839    ...................................S.....TPAPYVKVYL.LEN.......GAC.............
HGL_H00000352208    ...................................G.....LCDPYIKITL.---.......GKK.............
HGL_H00000352065    ...................................S.....HLNSFVKCTI.LPD.......TSR.............
HGL_H00000324510    ...................................G.....FSDPYCMLGI.LPG.......SGTpreqsgqkekrfs
HGL_H00000377612    ...................................K.....EPNPMVQLSI.---.......--Q.............
HGL_H00000361942-1  ...................................H.....LPDLYVKIYV.MNIst.....QKK.............
HGL_H00000259406    ...................................G.....VCDPYVKISL.IPE.......SNR.............
HGL_H00000020926    ...................................G.....GCDCYVQGSV.AI-.......TTG.............
HGL_H00000386881    ...................................G.....KCDPYIKISI.---.......GKK.............
HGL_H00000263125    ...................................-.....-VNPYCAVLV.KEYvese...NGQ.............
HGL_H00000261729    ...................................G.....SSDPYCLVKV.---.......-DD.............
HGL_H00000258098    ...................................S.....TSDAYTVIQV.---.......--G.............
HGL_H00000380006    ...................................G.....MFRPFVEVTM.VGPhq.....SDK.............
HGL_H00000400843    ...................................S.....KADCYVQLSL.--P.......TAS.............
HGL_H00000340017-1  ...................................G.....SVDTYVKANL.LPG.......PSK.............
HGL_H00000198765    ...................................G.....KSDPYLEFHK.QTSd......GNW.............
HGL_H00000388091    ...................................G.....LCDPYVVLKL.---.......--G.............
HGL_H00000361768-1  ...................................S.....LPATYIKAYL.LEN.......GCC.............
HGL_H00000260323    ...................................A.....MFRPFVEVCM.LGPnl.....GDK.............
HGL_H00000352208    ...................................S.....FSDPYAHVSF.---.......--L.............
HGL_H00000290776    ...................................S.....KSDPFCVLFT.ENS.......GRW.............
HGL_H00000352208    ...................................G.....KPDPIVSVIF.---.......--K.............
HGL_H00000388093    ...................................G.....SSDPFVQLTL.EPRhe.....FPE.............
HGL_H00000388093    ...................................G.....FSDPYCLLGI.---.......--Eqgvgmpggspgsr
HGL_H00000381982    ...................................E.....NIDPVVTIEI.---.......--G.............
HGL_H00000371646    ...................................T.....RMDPYCRLRL.---.......--G.............
HGL_H00000402784    ...................................S.....NPNPLVQMSV.---.......--G.............
HGL_H00000290776    ...................................G.....KSDPFLEFYK.PGDd......GKW.............
HGL_H00000360108    ...................................-.....--RPYCDVLI.---.......-GE.............
HGL_H00000394700    ...................................G.....VNNWHVHVVL.LPS.......--K.............
HGL_H00000361942-2  ...................................T.....LPAAYIKAYL.LEN.......GVC.............
HGL_H00000260402    ...................................-.....SVRTYVEVEL.FGLp......GDP.............
HGL_H00000262435    ...................................R.....LPDPFAKVVV.---.......DGS.............
HGL_H00000352208    ...........................fggtadkkN.....LVDPFVEVSF.---.......--A.............
HGL_H00000354621-1  ...................................R.....LPDPFAKIVV.---.......DGS.............
HGL_H00000316746    ...................................T.....DSDAYVKVFF.---.......--G.............
HGL_H00000262940    ...................................G.....SSDPYCIVKV.---.......-DS.............
HGL_H00000244751    ...................................S.....KSDPLCVMYT.QGMen.....KQW.............
HGL_H00000373343    ...................................S.....KSDPMVVLYT.QSRas.....QEW.............
HGL_H00000385255    .............................figenkD.....LVDPYVQVFF.---.......--A.............
HGL_H00000360431    ...................................G.....--SPCIEVDV.LGM.......SLD.............
HGL_H00000377612    ...................................K.....PPSPYATLTV.---.......--G.............
HGL_H00000389039    ...................................G.....GNSWQVHLVL.LPI.......--K.............
HGL_H00000265428    ...................................G.....-TAIYTEVGV.---.......--D.............
HGL_H00000386881    ...................................-.....-IKPVVKVTA.---.......--A.............
HGL_H00000381982    .............................fvgdskD.....LVDPFVEVSF.---.......--A.............
HGL_H00000352208    ...................................N.....NIKPVVKVHV.---.......--C.............
HGL_H00000350377    ...................................N.....MTEMFVQLKL.---.......--G.............
HGL_H00000314499    ...................................S.....GCRPFCEVYV.---.......--A.............
HGL_H00000262940    ...................................G.....SSDPYCIVKV.---.......-DS.............
HGL_H00000400398    ...................................G.....LSDPFARVLI.---.......--S.............
HGL_H00000198765    ...................................S.....KSDPLCVLFL.NTSg......QQW.............
HGL_H00000381982    ...................................K.....SSDIYVKGWL.KGL.......--E.............
HGL_H00000216775    ...................................S.....KSDPFMEIYK.TNRd......QSD.............
HGL_H00000385255    ...................................G.....LSDPFARVFF.---.......--I.............
HGL_H00000388091    ...................................K.....MSDIYIKGWL.FGL.......--E.............
HGL_H00000386881    ...................................K.....MSDIYVKGWM.VGF.......--E.............
HGL_H00000386881    ...........................fgfdsnkkN.....LVDPFVEVSF.---.......--A.............
HGL_H00000385255    ...................................-.....-MDPVVCVEV.---.......--G.............
HGL_H00000352208    ...................................E.....MSDIYVKGWI.--P.......GNE.............
HGL_H00000216775    ...................................A.....KPHPCVLLKL.YSD.......EQW.............
HGL_H00000317214    ...................................E.....TVNPYLVIKC.---.......--G.............
HGL_H00000400398    ...................................PltgemSSDIYVKSWV.KGL.......--E.............
HGL_H00000377520    ...................................S.....FESCFMRVSL.LPE.......--E.............
HGL_H00000274376    ...................................H.....FTNPYCNIYL.---.......-NS.............
HGL_H00000317257    ...................................S.....KSDPLCVLLQdVGG.......ATW.............
HGL_H00000264554    ...................................R.....SINCCVGLCL.VPG.......--K.............
HGL_H00000374218    ...................................R.....DPSSYVKLSV.---.......--G.............
HGL_H00000400398    ...................................-.....-INPYVAVRV.---.......--R.............
HGL_H00000360642    ...................................D.....DLDAFVRFEF.HYPn......SDQ.............
HGL_H00000398577    ...................................H.....TSKVYFRVAV.LPSs......TDV.............
HGL_H00000387882    ...................................L.....TLSFFVKVGM.FSS.......GEL.............
HGL_H00000385255    ...................................K.....SSDIFVRGWL.--K.......GQQ.............
HGL_H00000388091    ...................................A.....FQGPFVRAVF.---.......--L.............
HGL_H00000313731    ...................................S.....IVDPLVRVEI.HGV.......PED.............
HGL_H00000331342    ...................................G.....TSDAYAAIQA.VPA.......---.............
HGL_H00000380006    ...................................-.....----------.---.......---.............
HGL_H00000348283    ...................................P.....RINSYVEVAV.DGL.......--P.............
HGL_H00000303507    ...................................-.....-YNLYCTLEV.DSF.......GYF.............
HGL_H00000387882    ...................................D.....TPTISVKGIL.TLP.......--K.............
HGL_H00000400398    ..............................lhdqrV.....LVDPYVRVSF.---.......--L.............
HGL_H00000261729    ...................................-.....----------.---.......---.............
HGL_H00000266497    ...................................S.....APSAHVEFYL.LPY.......PSE.............
HGL_H00000370242    ...................................E.....DCKVHIRVYL.PPLd......SGT.............
HGL_H00000388091    ...................................Q.....SVSLVLEVEL.---.......--I.............
HGL_H00000386881    ...................................S.....ISSPSLIVEC.---.......--G.............
HGL_H00000356621    ...................................-.....-KKYFCELCL.---.......-DD.............
HGL_H00000381982    ...................................S.....VDRPQVLIEC.---.......--G.............
HGL_H00000381845    ...................................-.....CSDLYVTCQV.FAE.......---.............
HGL_H00000388091    ...................................P.....PPRPCLTVYF.---.......--R.............
HGL_H00000352208    ...................................S.....ITSPSLVVEC.---.......--G.............
HGL_H00000297239    ...................................-.....----------.---.......DQQ.............
HGL_H00000377473    ...................................Q.....DRKVNIRVAV.LPCs......EST.............
HGL_H00000386183    ...................................-.....-KKYLCELCL.---.......-DD.............
HGL_H00000303909    ...................................-.....-ANLYCTLEV.DSF.......GYF.............
HGL_H00000313601    ...................................G.....DLDVFVRFDF.PYPn......VEE.............
HGL_H00000325012    ...................................S.....EPCPYVVVKT.TSE.......EDN.............
HGL_H00000369853    ...................................G.....GTSPVCMAQL.---.......DDP.............
HGL_H00000343325-2  gtpdsrtpflsrpgrglysrsgslsgrsslkaeaeN.....TGEVSTVLKL.---.......-DN.............
HGL_H00000381982    ...................................G.....LSDPFARVTF.LSQ.......CQTtkggfsevlcsgd
HGL_H00000385255    ...................................Q.....VDRPRVDIEC.---.......--A.............
HGL_H00000334379    ...................................P.....IPSCCVSFAT.---.......ADE.............
HGL_H00000350649-2  ...................................-.....----------.---.......--A.............
HGL_H00000379227    ...................................F.....NPDPYLKISI.QPG.......KHSifpalphh.....
HGL_H00000363443    ...................................-.....PTGVFVKVSL.MNH.......NKF.............
HGL_H00000260983    ...................................F.....NPDPYLKMSI.QPG.......KKSsfptcahh.....
HGL_H00000266497    ...................................-.....----------.---.......---.............
HGL_H00000340594    ...................................D.....SKDVFCAIQV.---.......-DS.............
HGL_H00000350649-2  ...................................S.....KSDPFLEIFR.MNDd......ATQ.............
HGL_H00000388091    ...................................-.....-RHPQLLVEF.---.......--G.............
HGL_H00000388091    ...................................-.....NIRPVVKVTI.---.......--A.............
HGL_H00000400409    ...................................G.....IFRPFIEVNI.IGPql.....SDK.............
HGL_H00000317257    ...................................-.....----------.---.......---.............
HGL_H00000303058    ...................................P.....KHMLIVEAKF.---.......--D.............
HGL_H00000291906    ...................................-.....----------.---.......---.............
HGL_H00000262992    ...................................R.....KLNTLVQISV.IHPte.....QSL.............
HGL_H00000074304    ...................................R.....KPNSFVAVSV.TTPpq.....AFW.............
HGL_H00000400398    ...................................G.....THDRQVKLSF.---.......--R.............
HGL_H00000385255    ...................................G.....KGDRIAKVTF.---.......--R.............
HGL_H00000400398    ...................................E.....VEQPQVVLEV.---.......--A.............
HGL_H00000334379    ...................................-.....-CNVYLICKF.---.......FST.............
HGL_H00000354087    ...................................A.....GANSYVIIKC.---.......--E.............
HGL_H00000338885    ...................................D.....IEELCCVAEL.---.......DNP.............
HGL_H00000398391    ...................................-.....--RPFVEVSF.---.......--Q.............
HGL_H00000334379    ...................................-.....----------.---.......---.............
HGL_H00000348455-2  ...................................Q.....LLDTYFTLHL.CNAe......KIY.............


                                                                                                  60
                                                                                                   |
d1v27a_               .......................................................................KNK...R
HGL_H00000418143    .......................................................................---...I
HGL_H00000369257    .......................................................................DFE...L
HGL_H00000356236    .......................................................................KKK...Y
HGL_H00000391056    .......................................................................KKK...F
HGL_H00000391056    .......................................................................LKK...K
HGL_H00000353766    .......................................................................---...-
HGL_H00000263846    .......................................................................KHK...L
HGL_H00000382895    .......................................................................---...-
HGL_H00000263967    .......................................................................---...-
HGL_H00000358558    .......................................................................LKK...K
HGL_H00000346265    .......................................................................RRR...H
HGL_H00000356236    .......................................................................LKK...K
HGL_H00000324419-1  .......................................................................LKK...R
HGL_H00000228567-2  .......................................................................LKK...R
HGL_H00000361021-1  .......................................................................---...-
HGL_H00000171887    .......................................................................MQP...V
HGL_H00000413254-1  .......................................................................KAK...H
HGL_H00000369257    .......................................................................FAD...H
HGL_H00000358558    .......................................................................KCK...L
HGL_H00000324419-1  .......................................................................KTK...H
HGL_H00000340914    .......................................................................KKK...F
HGL_H00000228567-2  .......................................................................KKK...F
HGL_H00000263431    .......................................................................LTK...Q
HGL_H00000419260    .......................................................................LCQ...R
HGL_H00000381854    .......................................................................MQP...L
HGL_H00000319756    .......................................................................MQL...V
HGL_H00000263846    .......................................................................VEK...K
HGL_H00000316464    .......................................................................QSK...R
HGL_H00000284384    .......................................................................ESK...Q
HGL_H00000357307    .......................................................................IAK...K
HGL_H00000413254-1  .......................................................................SNK...L
HGL_H00000413254-2  .......................................................................ANK...L
HGL_H00000369257    .......................................................................FAD...H
HGL_H00000395220    .......................................................................NNK...R
HGL_H00000352065    .......................................................................MGK...K
HGL_H00000340017-1  .......................................................................KSK...Y
HGL_H00000382895    .......................................................................FSD...H
HGL_H00000340017-2  .......................................................................KSK...H
HGL_H00000362080    .......................................................................QGK...R
HGL_H00000340914    .......................................................................LKK...R
HGL_H00000356155    .......................................................................---...-
HGL_H00000265970    .......................................................................---...-
HGL_H00000228567-1  .......................................................................KKK...F
HGL_H00000357307    .......................................................................RHR...V
HGL_H00000297239    .......................................................................QGK...R
HGL_H00000255224    .......................................................................ISK...K
HGL_H00000340017-2  .......................................................................ANK...L
HGL_H00000362080    .......................................................................ASK...R
HGL_H00000409572    .......................................................................MAS...R
HGL_H00000413254-2  ..............................................shilhpspsqvhlafqrylkpdvdkKSK...H
HGL_H00000305355    .......................................................................ESK...Q
HGL_H00000260323    .......................................................................KNK...K
HGL_H00000347538    .......................................................................VKT...K
HGL_H00000380006    .......................................................................KTK...K
HGL_H00000262940    .......................................................................GQT...R
HGL_H00000402861    .......................................................................CAE...Q
HGL_H00000308957    .......................................................................HQK...Y
HGL_H00000255224    .......................................................................KHK...V
HGL_H00000377520    .......................................................................MSK...K
HGL_H00000377612    .......................................................................GRS...F
HGL_H00000347538    .......................................................................KNS...K
HGL_H00000371394    .......................................................................GRR...H
HGL_H00000395220    .......................................................................ATK...H
HGL_H00000308957    .......................................................................NDR...L
HGL_H00000350377    .......................................................................NDR...L
HGL_H00000361021-2  .......................................................................---...-
HGL_H00000396185-1  .......................................................................TAR...Q
HGL_H00000264839    .......................................................................KSK...R
HGL_H00000285094    .......................................................................CAE...Q
HGL_H00000374218    .......................................................................LQH...F
HGL_H00000228567-1  .......................................................................LKK...R
HGL_H00000402784    .......................................................................NQI...F
HGL_H00000374218    .......................................................................AGR...K
HGL_H00000350377    .......................................................................KTL...Y
HGL_H00000361021-3  .......................................................................---...-
HGL_H00000400409    .......................................................................KTK...K
HGL_H00000266505    .......................................................................HMK...R
HGL_H00000358200    .......................................................................KEK...Y
HGL_H00000308957    .......................................................................KEV...F
HGL_H00000345988    .......................................................................CCK...D
HGL_H00000346265    .......................................................................VRK...K
HGL_H00000324419-2  .......................................................................LKK...R
HGL_H00000371394    .......................................................................WKK...K
HGL_H00000347244    .......................................................................SQS...Y
HGL_H00000334105    .......................................................................RKE...F
HGL_H00000367747    .......................................................................CGK...E
HGL_H00000388756    .......................................................................NTT...F
HGL_H00000400409    .......................................................................NVK...S
HGL_H00000377612    .......................................................................GTK...R
HGL_H00000386881    .......................................................................HQS...Q
HGL_H00000377612    .......................................................................TQT...F
HGL_H00000261729    .......................................................................SQS...W
HGL_H00000356155    .......................................................................TTK...R
HGL_H00000256832    .......................................................................LAL...V
HGL_H00000370719    .......................................................................SQC...H
HGL_H00000020926    .......................................................................LKK...K
HGL_H00000400398    .......................................................................KER...Q
HGL_H00000306124-2  .......................................................................SRI...G
HGL_H00000244751    .......................................................................TIC...H
HGL_H00000290472    .......................................................................GMK...F
HGL_H00000338185    .......................................................................RKA...F
HGL_H00000316464    .......................................................................AGR...Q
HGL_H00000331602    .......................................................................TER...G
HGL_H00000265970    .......................................................................TSK...R
HGL_H00000362369    .......................................................................NTK...Q
HGL_H00000329127    .......................................................................VRV...G
HGL_H00000361768-2  .......................................................................VAK...K
HGL_H00000389039    .......................................................................MSK...C
HGL_H00000363443    .......................................................................RRF...L
HGL_H00000381982    .......................................................................EIK...D
HGL_H00000373343    .......................................................................TIC...H
HGL_H00000385255    .......................................................................DIR...D
HGL_H00000386881    .......................................................................GVK...K
HGL_H00000262650    .......................................................................GQS...K
HGL_H00000374195    .......................................................................EEV...F
HGL_H00000374195    .......................................................................LEA...K
HGL_H00000356436    .......................................................................DSR...K
HGL_H00000324510    .......................................................................VRS...Q
HGL_H00000352336    .......................................................................NNK...F
HGL_H00000279230    .......................................................................RRK...Y
HGL_H00000382434    .......................................................................SEK...V
HGL_H00000394700    .......................................................................MSR...C
HGL_H00000264839    .......................................................................IAK...K
HGL_H00000352208    .......................................................................VIE...D
HGL_H00000352065    .......................................................................KSR...Q
HGL_H00000324510    ..........................................................frkgskhssplpaKCI...Q
HGL_H00000377612    .......................................................................DVT...Q
HGL_H00000361942-1  .......................................................................VIK...K
HGL_H00000259406    .......................................................................IRS...Q
HGL_H00000020926    .......................................................................SVE...A
HGL_H00000386881    .......................................................................SVS...D
HGL_H00000263125    .......................................................................MYI...-
HGL_H00000261729    .......................................................................EVV...A
HGL_H00000258098    .......................................................................REK...Y
HGL_H00000380006    .......................................................................KRK...F
HGL_H00000400843    .......................................................................PSP...V
HGL_H00000340017-1  .......................................................................ASQ...L
HGL_H00000198765    .......................................................................LIV...H
HGL_H00000388091    .......................................................................SMK...L
HGL_H00000361768-1  .......................................................................LAK...K
HGL_H00000260323    .......................................................................KRK...Q
HGL_H00000352208    .......................................................................HRS...K
HGL_H00000290776    .......................................................................MEY...D
HGL_H00000352208    .......................................................................DEK...K
HGL_H00000388093    .......................................................................LAP...R
HGL_H00000388093    ..........................................................rrqkavvrhtipeEQT...H
HGL_H00000381982    .......................................................................DEK...K
HGL_H00000371646    .......................................................................YAV...Y
HGL_H00000402784    .......................................................................HKA...Q
HGL_H00000290776    .......................................................................MLV...H
HGL_H00000360108    .......................................................................TKI...Y
HGL_H00000394700    .......................................................................KQR...G
HGL_H00000361942-2  .......................................................................IAK...K
HGL_H00000260402    .......................................................................KRR...Y
HGL_H00000262435    .......................................................................GQC...H
HGL_H00000352208    .......................................................................GKK...V
HGL_H00000354621-1  .......................................................................GQC...H
HGL_H00000316746    .......................................................................KQE...L
HGL_H00000262940    .......................................................................EPI...I
HGL_H00000244751    .......................................................................REF...G
HGL_H00000373343    .......................................................................REF...G
HGL_H00000385255    .......................................................................GQK...G
HGL_H00000360431    .......................................................................SCH...F
HGL_H00000377612    .......................................................................ETS...H
HGL_H00000389039    .......................................................................KQR...A
HGL_H00000265428    .......................................................................GEI...K
HGL_H00000386881    .......................................................................GQT...K
HGL_H00000381982    .......................................................................GQT...G
HGL_H00000352208    .......................................................................GQT...H
HGL_H00000350377    .......................................................................DQR...Y
HGL_H00000314499    .......................................................................DER...V
HGL_H00000262940    .......................................................................EPI...I
HGL_H00000400398    .......................................................................TQC...Q
HGL_H00000198765    .......................................................................YEV...E
HGL_H00000381982    .......................................................................DDK...Q
HGL_H00000216775    .......................................................................QLV...W
HGL_H00000385255    .......................................................................NQS...Q
HGL_H00000388091    .......................................................................KNM...Q
HGL_H00000386881    .......................................................................EHK...Q
HGL_H00000386881    .......................................................................GKM...L
HGL_H00000385255    .......................................................................DDK...K
HGL_H00000352208    .......................................................................ENK...Q
HGL_H00000216775    .......................................................................VEV...E
HGL_H00000317214    .......................................................................KEE...V
HGL_H00000400398    .......................................................................HDK...Q
HGL_H00000377520    .......................................................................QIV...V
HGL_H00000274376    .......................................................................VQV...A
HGL_H00000317257    .......................................................................VEL...G
HGL_H00000264554    .......................................................................LQK...Q
HGL_H00000374218    .......................................................................RKT...Y
HGL_H00000400398    .......................................................................EQR...R
HGL_H00000360642    .......................................................................AQK...G
HGL_H00000398577    .......................................................................SCL...F
HGL_H00000387882    .......................................................................IYK...K
HGL_H00000385255    .......................................................................EDK...Q
HGL_H00000388091    .......................................................................NYS...Q
HGL_H00000313731    .......................................................................CAQ...Q
HGL_H00000331342    .......................................................................---...-
HGL_H00000380006    .......................................................................---...-
HGL_H00000348283    .......................................................................SET...K
HGL_H00000303507    .......................................................................VNK...A
HGL_H00000387882    .......................................................................PVH...F
HGL_H00000400398    .......................................................................GQQ...G
HGL_H00000261729    .......................................................................---...-
HGL_H00000266497    .......................................................................VRR...R
HGL_H00000370242    .......................................................................PNT...Y
HGL_H00000388091    .......................................................................GEK...L
HGL_H00000386881    .......................................................................GQM...V
HGL_H00000356621    .......................................................................TLF...A
HGL_H00000381982    .......................................................................GRG...V
HGL_H00000381845    .......................................................................---...-
HGL_H00000388091    .......................................................................DIK...K
HGL_H00000352208    .......................................................................GER...V
HGL_H00000297239    .......................................................................KLR...L
HGL_H00000377473    .......................................................................TCL...F
HGL_H00000386183    .......................................................................VLY...A
HGL_H00000303909    .......................................................................VSK...A
HGL_H00000313601    .......................................................................AQK...D
HGL_H00000325012    .......................................................................KQSsraV
HGL_H00000369853    .......................................................................AQS...F
HGL_H00000343325-2  .......................................................................TVV...G
HGL_H00000381982    sgcsltscmagehlnspalrsnfssawlalakrgaapgvyravpgvkwgleetgrvrcsrgrhkhpvrvtaVIA...A
HGL_H00000385255    .......................................................................GKG...V
HGL_H00000334379    .......................................................................PSP...V
HGL_H00000350649-2  .......................................................................AHV...D
HGL_H00000379227    .......................................................................GQE...R
HGL_H00000363443    .......................................................................VQC...K
HGL_H00000260983    .......................................................................GQE...R
HGL_H00000266497    .......................................................................---...-
HGL_H00000340594    .......................................................................VNK...A
HGL_H00000350649-2  .......................................................................QLV...H
HGL_H00000388091    .......................................................................GES...L
HGL_H00000388091    .......................................................................GQQ...Y
HGL_H00000400409    .......................................................................KRK...F
HGL_H00000317257    .......................................................................---...-
HGL_H00000303058    .......................................................................GEQ...L
HGL_H00000291906    .......................................................................---...-
HGL_H00000262992    .......................................................................TRY...S
HGL_H00000074304    .......................................................................TKH...A
HGL_H00000400398    .......................................................................GFT...Q
HGL_H00000385255    .......................................................................GQP...F
HGL_H00000400398    .......................................................................GKR...V
HGL_H00000334379    .......................................................................EEV...T
HGL_H00000354087    .......................................................................GEK...V
HGL_H00000338885    .......................................................................MQQ...K
HGL_H00000398391    .......................................................................RTI...C
HGL_H00000334379    .......................................................................---...-
HGL_H00000348455-2  .......................................................................KEF...Y


                                         70               80                                        
                                          |                |                                        
d1v27a_               RTK........TVK.KTL..EPKWN.....QTFIY..SPV......HR.......................RE.....
HGL_H00000418143    VSS........EIS.GKN..DHIWN.....ETLEF..DIN......TC.......................DL.....
HGL_H00000369257    QTT........PIV.RGL..HPKYN.....FTSQY..LVH......VN.......................DLflqy.
HGL_H00000356236    ETK........VHR.KTL..NPAFN.....ETFTF..KVP......Y-.......................QE.....
HGL_H00000391056    ETK........VHR.KTL..NPVFN.....EQFTF..KVP......Y-.......................SE.....
HGL_H00000391056    KTT........IKK.NTL..NPYYN.....ESFSF..EVP......F-.......................EQ.....
HGL_H00000353766    --S........EVS.VCS..EPVWK.....QRLEF..DIS......IC.......................DL.....
HGL_H00000263846    ETK........VKR.KNL..NPHWN.....ETFLF..EGF......PY.......................EK.....
HGL_H00000382895    ---........---.---..-----.....-----..---......T-.......................--.....
HGL_H00000263967    ---........--V.PCS..NPRWN.....EWLNY..DMY......IP.......................DL.....
HGL_H00000358558    KTT........IKK.NTL..NPIYN.....EAIIF..DIP......P-.......................EN.....
HGL_H00000346265    ETK........VHR.QTL..NPHFG.....EAFTF..KVP......YV.......................EL.....
HGL_H00000356236    KTT........VKK.KTL..NPYFN.....ESFSF..EIP......F-.......................EQ.....
HGL_H00000324419-1  KTS........TKR.NTL..NPVYN.....EAIVF..DVP......P-.......................EN.....
HGL_H00000228567-2  KTT........IKK.NTL..NPVYN.....EAIIF..DIP......P-.......................EN.....
HGL_H00000361021-1  ---........---.---..-----.....-----..---......--.......................PL.....
HGL_H00000171887    YTS........GIY.N--..-----.....-----..---......--.......................--.....
HGL_H00000413254-1  KTQ........IKK.KTL..NPEFN.....EEFFY..DIK......H-.......................SD.....
HGL_H00000369257    DTA........IIP.SSS..DPQFD.....DYMCF..PVP......M-.......................NMdldry
HGL_H00000358558    QTR........VHR.KTL..NPTFD.....ENFHF..PVP......Y-.......................EE.....
HGL_H00000324419-1  QTK........VHR.KTL..NPVFD.....EVFLF..PVP......Y-.......................SD.....
HGL_H00000340914    QTK........VHR.KTL..NPVFN.....ETFQF..SVP......L-.......................AE.....
HGL_H00000228567-2  QTR........VHR.KTL..NPLFD.....EAFQF..PVV......Y-.......................DQ.....
HGL_H00000263431    KTR........TVK.ATL..NPVWN.....ETFVF..NLK......PG.......................DV.....
HGL_H00000419260    RTS........AK-.---..-----.....-----..---......--.......................--.....
HGL_H00000381854    YTS........GIY.N--..-----.....-----..---......--.......................--.....
HGL_H00000319756    YTS........GVY.HIT..GPGPQ.....QICI-..-SL......EP.......................AL.....
HGL_H00000263846    KTV........TMK.RNL..NPIFN.....ESFAF..DIP......T-.......................EK.....
HGL_H00000316464    KTA........VKK.RNL..NPVFN.....EILRY..SVP......K-.......................DE.....
HGL_H00000284384    KTK........TIR.STL..NPQWN.....ESFTF..KLK......PS.......................D-.....
HGL_H00000357307    KTH........VKK.CTL..NPAFN.....ESFIY..DIP......T-.......................DL.....
HGL_H00000413254-1  RTK........TLR.NTR..NPIWN.....ETLVY..HGI......TD.......................ED.....
HGL_H00000413254-2  RTK........TLR.NTL..NPTWN.....ETLTY..YGI......TD.......................ED.....
HGL_H00000369257    DTA........IIP.SSS..DPQFD.....DYMCF..PVP......M-.......................NMdldry
HGL_H00000395220    KTK........IRT.GT-..NPEFN.....ETLKY..TIS......H-.......................TQ.....
HGL_H00000352065    KTL........VAK.KTL..NPVFN.....EILRY..KIE......K-.......................QI.....
HGL_H00000340017-1  KTS........VRR.KTL..NPEFN.....EEFFY..AGP......R-.......................EE.....
HGL_H00000382895    DTT........IIP.ASD..NPYFK.....DQAQF..PVL......ES.......................SEldqy.
HGL_H00000340017-2  KTC........VKK.KTL..NPEFN.....EEFFY..EIQ......L-.......................ST.....
HGL_H00000362080    KTS........IKR.DTV..NPLYD.....EILRY..EIP......E-.......................SL.....
HGL_H00000340914    KTS........IKK.NTL..NPTYN.....EALVF..DVA......PE.......................S-.....
HGL_H00000356155    ---........---.---..--IWD.....QQICF..PVQ......VN.......................RL.....
HGL_H00000265970    ---........---.---..-IKWD.....ELIIF..PIQ......IS.......................QL.....
HGL_H00000228567-1  QTH........VHR.KTL..NPLFD.....EAFQF..PVV......Y-.......................DQ.....
HGL_H00000357307    KTR........VLR.KTL..DPVFD.....ETFTF..YGI......PY.......................SQ.....
HGL_H00000297239    KTG........VQK.NTL..DPIFQ.....ETLKY..QVD......P-.......................AQ.....
HGL_H00000255224    KTH........VKK.CTP..NAVFN.....ELFVF..DIP......C-.......................EG.....
HGL_H00000340017-2  KTR........TQR.NTL..NPVWN.....EDLTY..SGI......TD.......................DD.....
HGL_H00000362080    KTP........VMK.KTL..NPHYN.....HTFVY..SGM......RL.......................ED.....
HGL_H00000409572    QTA........VIT.NNGf.NPRWN.....TEFEF..EVV......VP.......................EL.....
HGL_H00000413254-2  KTA........VKK.KTL..NPEFN.....EEFCY..EIK......H-.......................GD.....
HGL_H00000305355    KTK........TIK.CSL..NPEWN.....ETFRF..QLK......ES.......................D-.....
HGL_H00000260323    RTK........TIF.GNL..NPVWD.....EKFYF..ECH......N-.......................ST.....
HGL_H00000347538    KTS........FLR.GTI..DPFYN.....ESFSF..KVP......Q-.......................EE.....
HGL_H00000380006    RTK........TIF.GNL..NPVWE.....EKFHF..ECH......NS.......................S-.....
HGL_H00000262940    ESS........VVK.KSC..YPRWN.....ETFEF..ELE......EG.......................ST.....
HGL_H00000402861    RTK........TVQ.QNSd.NPIFD.....ETFEF..QVN......LP.......................EL.....
HGL_H00000308957    KSK........IMP.KTL..NPQWR.....EQFDF..HLY......EE.......................RG.....
HGL_H00000255224    KTR........VLR.KTL..DPAFD.....ETFTF..YGI......PY.......................TQ.....
HGL_H00000377520    KTA........VKR.DDP..NPVFN.....EAMIF..SVP......A-.......................IV.....
HGL_H00000377612    RSR........VVR.EDL..NPRWN.....EVFEV..IVT......SV.......................PG.....
HGL_H00000347538    QTG........VKR.KTQ..KPVFE.....ERYTF..EIP......FL.......................EA.....
HGL_H00000371394    ETK........VHH.GTL..CPIFE.....ETCSF..HVP......P-.......................AE.....
HGL_H00000395220    KTV........VIK.KSV..NPQWN.....HTFMF..SGL......YP.......................QD.....
HGL_H00000308957    LTH........TVY.KNL..NPEWN.....KVFTF..NIK......DI.......................H-.....
HGL_H00000350377    QTH........TIY.KNL..NPEWN.....KVFTF..PIK......DI.......................H-.....
HGL_H00000361021-2  ---........---.---..-----.....-----..---......--.......................--.....
HGL_H00000396185-1  ETN........YVE.NNGf.NPYWG.....QTLSF..RVL......VP.......................EL.....
HGL_H00000264839    RTK........TVK.KVL..EPKWN.....QTFVY..SHV......HR.......................RD.....
HGL_H00000285094    RTK........TVH.QNGd.APIFD.....ESFEF..QIN......LP.......................EL.....
HGL_H00000374218    RSR........TIY.KNL..NPTWN.....EVFEF..MVY......EV.......................PG.....
HGL_H00000228567-1  KTA........IKK.NTL..NPVYN.....EAIIF..DIP......L-.......................EN.....
HGL_H00000402784    QSK........VIK.ESL..SPKWN.....EVYEA..LVY......EH.......................PG.....
HGL_H00000374218    KTS........VKH.KTL..EPLFD.....ETFEF..FVP......M-.......................EE.....
HGL_H00000350377    KSK........VIY.KNL..NPVWD.....EIVVL..PIR......SL.......................D-.....
HGL_H00000361021-3  ---........---.---..-----.....-----..---......--.......................--.....
HGL_H00000400409    RTK........TIY.GNL..NPVWE.....ENFHF..ECH......NS.......................S-.....
HGL_H00000266505    QTR........VIK.KNAf.SPRWN.....ETFTF..IIQ......VP.......................EL.....
HGL_H00000358200    STS........VAE.KTL..EPVWK.....EEASF..ELPgllmqgN-.......................--.....
HGL_H00000308957    RSK........IIH.KNL..NPVWE.....EKACI..LIE......HL.......................R-.....
HGL_H00000345988    QTR........VVD.DNGf.NPVWE.....ETLTF..TVH......MP.......................EI.....
HGL_H00000346265    KTT........IKK.NTL..NPYYN.....EAFSF..EVP......C-.......................--.....
HGL_H00000324419-2  KTT........TKG.NRL..HPIYN.....EIIVF..DVP......PE.......................NI.....
HGL_H00000371394    KTS........TKK.GTT..APYFN.....EAFTF..LVP......F-.......................SQ.....
HGL_H00000347244    TTR........TLQ.DTL..NPKWN.....FNCQF..FVK......DL.......................Y-.....
HGL_H00000334105    RTR........MVM.NNGl.NPVYNe....ESFVFr.KVI......LP.......................DL.....
HGL_H00000367747    QTR........VVD.DNGf.NPMWE.....ETLVF..TVH......MP.......................EI.....
HGL_H00000388756    KTD........VYL.KSL..NPQWNs....EWFKF..EVD......D-.......................ED.....
HGL_H00000400409    TTI........AVR.G-S..QPSWE.....QDFMF..EIN......RL.......................D-.....
HGL_H00000377612    KTS........LKK.RTL..NPEFS.....ERFEW..ELP......M-.......................DE.....
HGL_H00000386881    KTV........VVK.NTL..NPTWD.....QTLIF..YEI......EI.......................FGepasi
HGL_H00000377612    CSC........VIN.EEL..SPQWG.....ETYEV..MVH......EV.......................PG.....
HGL_H00000261729    ESS........IIK.KTR..FPHWD.....EVLEL..REV......PG.......................A-.....
HGL_H00000356155    KTK........VAR.KTC..NPTYN.....EMLVY..DGI......PK.......................GD.....
HGL_H00000256832    QTK........TIK.KTL..NPKWN.....EEFYF..RVN......PS.......................N-.....
HGL_H00000370719    ITK........TIQ.DTL..NPKWN.....SNCQF..FIR......DL.......................EQ.....
HGL_H00000020926    QTK........RAK.HKI..NPVWN.....EMIMF..ELP......D-.......................DL.....
HGL_H00000400398    DTKeh......YIP.KQL..NPIFG.....EVLEL..SIS......LP.......................AE.....
HGL_H00000306124-2  QTA........TKQ.KTN..SPAWH.....DEFVT..DVC......NG.......................--.....
HGL_H00000244751    KTE........VMK.NTL..NPVWQ.....TFSIP..VRA......LC.......................NG.....
HGL_H00000290472    RTK........TVS.NSS..HPVWN.....ETFSF..LIQ......SR.......................--.....
HGL_H00000338185    KTK........TSQ.GNAv.NPVWE.....EEPIVfkKVV......LP.......................SL.....
HGL_H00000316464    RTR........VVR.HSF..SPVFN.....HTMVY..DGF......GP.......................AD.....
HGL_H00000331602    KTL........VQK.KPTm.YPEWK.....STFDA..HIY......EG.......................--.....
HGL_H00000265970    KTK........ISR.KTR..NPTFN.....EMLVY..SGY......SQ.......................ET.....
HGL_H00000362369    KTEf.......VVD.NGL..NPVWPa....KPFHF..QIS......NP.......................EF.....
HGL_H00000329127    QTS........TKQ.KTN..KPTYN.....EEFCA..NVT......DG.......................--.....
HGL_H00000361768-2  KTK........VAR.KTL..EPLYQ.....QLLSF..EES......PQ.......................--.....
HGL_H00000389039    KTS........IRR.GQP..NPVYK.....ETFVF..QVA......L-.......................FQ.....
HGL_H00000363443    QSR........IKR.KTS..NPQFD.....EHFIF..QVS......SK.......................SV.....
HGL_H00000381982    RDK........YIP.KQL..NPVFG.....RSFEI..QAT......FP.......................KE.....
HGL_H00000373343    KTE........VVK.NTL..NPVWQ.....PFSIP..VRA......LC.......................NG.....
HGL_H00000385255    KEN........YIS.KQL..NPVFG.....KSFDI..QAS......FP.......................--.....
HGL_H00000386881    RTK........VIK.NSV..NPVWN.....EGFEW..DLK......GI.......................PL.....
HGL_H00000262650    KTE........KCN.NTN..SPKWK.....QPLTV..IVT......PV.......................--.....
HGL_H00000374195    RTK........IVE.KSL..CPFYG.....EDFYC..EIP......RS.......................F-.....
HGL_H00000374195    KTK........VKK.KTN..NPQFD.....EVFYF..EVN......RPcsyskkshfdfee..........ED.....
HGL_H00000356436    RTR........HFN.NDI..NPVWN.....ESFEF..ILD......PN.......................QE.....
HGL_H00000324510    RTQ........VKS.RTL..HPVYD.....ELFHF..SVS......AE.......................ACr....
HGL_H00000352336    KTT........VVN.DNGl.SPVWAptq..EKVTF..EIY......DP.......................NL.....
HGL_H00000279230    RTR........TSQ.GNSf.NPVWDe....EIFEF..PKV......VL.......................PT.....
HGL_H00000382434    RTR........TIS.NCP..NPEWN.....ETFSF..QIQ......TQ.......................--.....
HGL_H00000394700    KTS........LRR.GQP..NPVYK.....ETFVF..QVA......L-.......................FQ.....
HGL_H00000264839    KTR........IAR.KTL..DPLYQ.....QSLVF..DES......PQ.......................--.....
HGL_H00000352208    RDH........YIP.NTL..NPVFG.....RMYEL..TCY......LP.......................QE.....
HGL_H00000352065    KTRa.......VGR.KTN..NPVFN.....HTMVY..DGF......RP.......................ED.....
HGL_H00000324510    VTE........VKS.STL..NPVWK.....EHFLF..EIE......DV.......................ST.....
HGL_H00000377612    ESK........AVY.GTN..SPVWE.....EAFRF..FLQ......DP.......................RS.....
HGL_H00000361942-1  KTR........VCR.HDR..EPSFN.....ETFRF..SLS......PA.......................G-.....
HGL_H00000259406    KTQ........TIP.DCR..DPAFH.....EHFFF..PVP......EE.......................DG.....
HGL_H00000020926    QTA........LKR.RQQ..HTAWE.....EGLVL..PLA......E-.......................EE.....
HGL_H00000386881    QDN........YIP.CTL..EPVFG.....KMFEL..TCT......LP.......................--.....
HGL_H00000263125    ---........QKK.PTM..YPPWD.....STFDA..HIN......KG.......................--.....
HGL_H00000261729    RTA........TVW.RSL..SPFWG.....EEYTV..HLP......L-.......................DF.....
HGL_H00000258098    STS........VVE.KTQg.CPEWR.....EECSF..ELP......PGaldgllraqeadagpapwasgsaA-.....
HGL_H00000380006    TTK........SKS.NNW..APKYN.....ETFHF..LLG......NE.......................EG.....
HGL_H00000400843    QTR........MVA.NCS..DPEWN.....ETFCY..QIH......GA.......................--.....
HGL_H00000340017-1  RTH........TVR.GTR..GPVWE.....ETLTY..HGF......TR.......................QD.....
HGL_H00000198765    GTE........VIK.NNL..NPVWK.....PFKIS..LNS......LC.......................YG.....
HGL_H00000388091    GSRda......YKP.NTV..DPIFG.....MMFQL..TCT......IP.......................--.....
HGL_H00000361768-1  KTK........VAK.KTC..DPLYQ.....QALLF..EEG......PQ.......................--.....
HGL_H00000260323    GTK........TKS.NTW..SPKYN.....ETFQF..TLS......KE.......................SQ.....
HGL_H00000352208    TTE........IIH.STL..NPTWD.....QTIIF..DEV......EI.......................YGepqtv
HGL_H00000290776    RTE........TAI.NNL..NPAFS.....KKFVL..DYH......FE.......................EV.....
HGL_H00000352208    KTK........KVD.NEL..NPVWN.....EILEF..DLR......GI.......................PL.....
HGL_H00000388093    ETQ........KHK.KDL..HPLFD.....ETFEF..LVAa.....EP.......................CR.....
HGL_H00000388093    RTQ........VIS.QTL..NPVWD.....ETFIL..EFE......DI.......................AN.....
HGL_H00000381982    QST........VKE.GTN..SPFYN.....EYFVF..DFI......GP.......................QVh....
HGL_H00000371646    ETP........TAH.NGAk.NPRWN.....KVIQC..TVP......P-.......................GV.....
HGL_H00000402784    ESK........IRY.KTN..EPVWE.....ENFTF..FIH......NP.......................KR.....
HGL_H00000290776    RTE........VIK.YTL..DPVWK.....PFTVP..LVS......LC.......................DG.....
HGL_H00000360108    ST-........---.---..-----.....-----..---......--.......................--.....
HGL_H00000394700    RTS........IQR.G-P..NPVFK.....EKVTF..AKL......EP.......................RD.....
HGL_H00000361942-2  KTK........VAR.KSL..DPLYN.....QVLLF..PES......PQ.......................--.....
HGL_H00000260402    RTK........LSP.SSNsiNPVWKe....EPFVF..EKIl.....VP.......................EL.....
HGL_H00000262435    STD........TVK.NTL..DPKWN.....QHYDL..YIG......KS.......................--.....
HGL_H00000352208    CTN........IIE.KNA..NPEWN.....QVVNL..QIK......FP.......................SM.....
HGL_H00000354621-1  STD........TVK.NTL..DPKWN.....QHYDL..YVG......KT.......................--.....
HGL_H00000316746    RTG........TVW.NNN..NPRWA.....TRLDFg.DVL......LP.......................T-.....
HGL_H00000262940    RTA........TVW.KTL..CPFWG.....EEYQV..HLP......PT.......................F-.....
HGL_H00000244751    RTE........VID.NTL..NPDFV.....RKFIV..DYF......FE.......................EK.....
HGL_H00000373343    RTE........VID.NTL..NPDFV.....RKFVL..DYF......FE.......................EK.....
HGL_H00000385255    KTS........VQK.NSY..EPLWN.....EQVVF..TDL......FP.......................PL.....
HGL_H00000360431    RTKp.......IHR.NTL..NPMWS.....EQFLF..RVH......FE.......................DL.....
HGL_H00000377612    KTK........TVS.HSS..APVWD.....ESASF..LIR......KP.......................HT.....
HGL_H00000389039    KTS........IQR.G-P..CPVFT.....ETFKF..NHV......ES.......................EM.....
HGL_H00000265428    KTA........KSS.SSS..NPKWD.....EQLTV..SVT......PQ.......................--.....
HGL_H00000386881    RTR........IHK.GN-..SPLFN.....ETLFF..NLFd.....SP.......................EE.....
HGL_H00000381982    RTT........VQK.NCA..DPIWH.....EQVIF..KEM......FP.......................PL.....
HGL_H00000352208    RTR........IKR.GN-..NPFFD.....ELFFY..NVHm.....TP.......................SE.....
HGL_H00000350377    KSK........TLC.KSA..NPQWQ.....EQFDF..HYF......SD.......................RM.....
HGL_H00000314499    TTT........---.---..-----.....-----..---......--.......................--.....
HGL_H00000262940    RTA........TVW.KTL..CPFWG.....EEYQV..HLP......PT.......................F-.....
HGL_H00000400398    TTR........VLE.QTL..SPLWD.....ELLVF..DQL......IV.......................DGrrehl
HGL_H00000198765    RTE........RIK.NCL..NPKFS.....KTFII..DYY......FE.......................VV.....
HGL_H00000381982    ETD........VHY.NSLtgEGNFN.....WRFLF..PFQ......YLpaekqmvitkrenifslekt...EC.....
HGL_H00000216775    RTEvapwclskVVK.NNL..NPSWE.....PFRLS..LHS......LC.......................SC.....
HGL_H00000385255    CTE........VLN.ETL..CPTWD.....QMLVF..DNL......ELygeahelr...............E-.....
HGL_H00000388091    KTD........IHY.HSLsgEATFN.....WRFIF..TMD......YLaaehmcvesqkdyiwsldpt...ST.....
HGL_H00000386881    KTD........VHY.RSLggEGNFN.....WRFVF..PFD......YLpaeqvcsvakkdafwrldkt...ES.....
HGL_H00000386881    CSK........ILE.KTA..NPQWN.....QRVTL..PAM......FP.......................SM.....
HGL_H00000385255    YTS........MKE.STN..CPYYN.....EYFVF..DFHv.....SP.......................DV.....
HGL_H00000352208    KTD........VHY.RSLdgEGNFN.....WRFVF..PFD......YLpaeqlciiskkehfwsidqt...EF.....
HGL_H00000216775    RTE........VLR.SCS..SPVFS.....RALAL..EYF......FE.......................EK.....
HGL_H00000317214    RSP........VQK.NTV..HAIFD.....TQAIF..YRR......TT.......................D-.....
HGL_H00000400398    ETD........VHF.NSLtgEGNFN.....WRFVF..RFD......YLpterevsvrrrpgpfaleea...EF.....
HGL_H00000377520    ISR........IQR.NAY..SIFFD.....EKFSI..PLD......P-.......................TA.....
HGL_H00000274376    KTH........ARE.GQ-..NPVWS.....EEFVF..DDL......PP.......................DI.....
HGL_H00000317257    RTE........RIR.NCS..SPEFS.....KTLQL..EYH......FE.......................TV.....
HGL_H00000264554    RST........IIK.NSR..HPVFN.....EDFFF..DGL......GP.......................AS.....
HGL_H00000374218    TSK........TCP.HSK..DPVWS.....QVFSF..FVH......NV.......................AA.....
HGL_H00000400398    VTA........TQR.GTN..CPFYNevgenEYFLF..EFH......ET.......................RLr....
HGL_H00000360642    KTA........VVK.NTN..SPEFD.....QVFKL..NIN......RN.......................HRgfrrv
HGL_H00000398577    RTK........VHP.PTE..SVLFN.....DVFRM..AIS......Q-.......................TA.....
HGL_H00000387882    KTR........LLK.ATNg.RVKWG.....ETMIF..PLI......QS.......................E-.....
HGL_H00000385255    DTD........VHY.HSLtgEGNFN.....WRYLF..PFD......YLaaeekiviskkesmfswdet...EY.....
HGL_H00000388091    CTQ........RLP.SSV..APIWA.....QTLIF..QHL......LL.......................HEspqdt
HGL_H00000313731    ETS........HVL.NNG..G----.....-----..---......DLgrragagrggregqfllrap...EL.....
HGL_H00000331342    ---........---.---..-----.....-----..---......--.......................AA.....
HGL_H00000380006    ---........---.---..-----.....-----..---......--.......................--.....
HGL_H00000348283    KTG........KRI.GSS..ELLWN.....EIIIL..NVT......AQ.......................--.....
HGL_H00000303507    KTR........VYR.DTT..EPNWN.....EEFEI..ELE......GS.......................--.....
HGL_H00000387882    KSS........PKE.GSS..AIEFM.....ETFVF..AIK......LQ.......................HL.....
HGL_H00000400398    ETS........VRG.AAV..APEWN.....EQLSF..VEL......FP.......................PL.....
HGL_H00000261729    -TA........TVW.RSL..SPFWG.....EEYTV..HLP......L-.......................DF.....
HGL_H00000266497    KTK........SVP.KCT..DPTYN.....EIVVY..DEV......A-.......................EL.....
HGL_H00000370242    CSK........TLE.FQA..PLVFN.....EVFRI..PVH......F-.......................SM.....
HGL_H00000388091    RTN........VRP.QTD..NPIWN.....QILTF..QIQ......LP.......................CL.....
HGL_H00000386881    QSC........VIR.NLRk.NPNFDv....CTLFM..EVMl.....PR.......................EE.....
HGL_H00000356621    RTT........SKT.KAD..NIFWG.....EHFEF..YSL......PP.......................-L.....
HGL_H00000381982    KSC........VIQ.SYKn.NPNFSvqa..DTFEV..ELP......E-.......................NE.....
HGL_H00000381845    ---........---.---..-----.....-----..---......--.......................--.....
HGL_H00000388091    RTR........VVE.GN-..DPTWN.....ETLIW..HLW......SR.......................PL.....
HGL_H00000352208    ESV........VIK.NLKk.TPNFP.....SSVLF..MKV......FL.......................PKee...
HGL_H00000297239    KSP........VLK.KQA..CPQWK.....HSFVF..NGI......TR.......................SQ.....
HGL_H00000377473    RTR........PLD.ASD..SLVFN.....EAFWV..SMS......YP.......................A-.....
HGL_H00000386183    RTT........GKL.KTD..NVFWG.....EHFEF..HNL......P-.......................PL.....
HGL_H00000303909    KTR........VFR.DTA..EPKWD.....EEFEI..ELE......GS.......................--.....
HGL_H00000313601    KTS........VIK.NTD..SPEFK.....EQFKL..CIS......RS.......................HRgfrra
HGL_H00000325012    TSV........TSE.PTR..NPIWG.....DSVQM..QIP......E-.......................EE.....
HGL_H00000369853    TSS........RVR.NTT..DLAWE.....EEFTF..ELN......AK.......................S-.....
HGL_H00000343325-2  QTS........WKP.CG-..SSTWD.....QSFTL..ELE......RA.......................--.....
HGL_H00000381982    PLK........VIS.QTL..SPTWN.....QMLLF..NEV......VL.......................HGderel
HGL_H00000385255    QSS........LIH.NYKk.NPNFNtlv..KWFEV..DLP......E-.......................NE.....
HGL_H00000334379    YTQ........VVE.NTD..SPIWN.....FQHQS..RLS......K-.......................ELll...
HGL_H00000350649-2  RTE........VIR.TCI..NPVYS.....KLFTV..DFY......FE.......................EV.....
HGL_H00000379227    RSK........IIG.NTV..NPIWQa....EQFSF..VSL......PT.......................--.....
HGL_H00000363443    KTS........AVL.GSP..NPFYN.....ETFSF..KAN......A-.......................TK.....
HGL_H00000260983    RST........IIS.NTT..NPIWHr....EKYSF..FAL......LT.......................--.....
HGL_H00000266497    ---........---.---..---WV.....HRINF..PLE......TK.......................SL.....
HGL_H00000340594    RTA........LLTcRTT..FLDMD.....HTFNI..EIE......NA.......................--.....
HGL_H00000350649-2  RTE........VVM.NNL..SPAWK.....SFKVS..VNS......LC.......................SG.....
HGL_H00000388091    RTE........PIK.DFPt.NPNFP.....ESVLL..LMVfm....PK.......................EE.....
HGL_H00000388091    HTR........IKM.GN-..SPFFN.....EIFFQ..NFY......EV.......................PA.....
HGL_H00000400409    ATK........SKN.NSW..APKYN.....ESF--..---......--.......................--.....
HGL_H00000317257    ---........VIK.NNL..NPAWK.....RFSIP..LQH......FC.......................SG.....
HGL_H00000303058    ATD........PVD.HTN..QPEFA.....TELAW..EID......RK.......................ALhqhr.
HGL_H00000291906    ---........---.---..--CWD.....QTFAI..PLE......RA.......................--.....
HGL_H00000262992    STE........IVE.GTR..DPLFL.....TGVIF..PSE......Y-.......................PI.....
HGL_H00000074304    QTE........IIE.GTN..NPIFL.....SSIAF..FQD......SL.......................-I.....
HGL_H00000400398    KTR........KIH.CGR..EADVG.....ELFRW..PHY......GA.......................PL.....
HGL_H00000385255    YSR........VLE.NCEd.VADFD.....ETTSV..XXX......PXxxfrwpvas..............NI.....
HGL_H00000400398    ESE........VLP.SYHd.SPNFT.....ELVRH..LTV......DL.......................PEqp...
HGL_H00000334379    RSV........IAW.STT..QPVFN.....FSQVI..PVS......LS.......................SKyler.
HGL_H00000354087    HSP........VQK.GTS..VPEYN.....VKGIF..YRK......KP.......................G-.....
HGL_H00000338885    WTK........PVR.AGP..EVEWT.....EDLSL..DLG......PQ.......................S-.....
HGL_H00000398391    HTT........TAE.G-P..NPSWN.....EELEF..PFR......AP.......................NG.....
HGL_H00000334379    ---........---.---..-----.....-----..---......--.......................--.....
HGL_H00000348455-2  GSE........VVK.NSL..IPKWR.....-----..---......--.......................--.....


                                 90               100                                               
                                  |                 |                                               
d1v27a_               .FR........ERMLEITLW.D.......QA.........RV....................................
HGL_H00000418143    .PR........MARLCFAVY.A.......--.........--....................................
HGL_H00000369257    .IQ........KNTVTLEVH.Q.......AY.........ST....................................
HGL_H00000356236    .LG........GKTLVMAIY.D.......FD.........RF....................................
HGL_H00000391056    .LG........GKTLVMAVY.D.......FD.........RF....................................
HGL_H00000391056    .IQ........KVQVVVTVL.D.......YD.........KI....................................
HGL_H00000353766    .PR........MARLCFALY.A.......--.........--....................................
HGL_H00000263846    .VV........QRVLYLQVL.D.......YD.........RF....................................
HGL_H00000382895    .--........---------.-.......--.........--....................................
HGL_H00000263967    .PR........AARLCLSIC.S.......VK.........G-....................................
HGL_H00000358558    .MD........QVSLLISVM.D.......YD.........RV....................................
HGL_H00000346265    .-G........GRVLVMAVY.D.......FD.........RF....................................
HGL_H00000356236    .IQ........KVQVVVTVL.D.......YD.........KL....................................
HGL_H00000324419-1  .ID........QIHLSIAVM.D.......YD.........RV....................................
HGL_H00000228567-2  .VD........QVSLSITVM.D.......YD.........RV....................................
HGL_H00000361021-1  .PV........CGDIKVEFF.H.......K-.........--....................................
HGL_H00000171887    .--........---------.-.......--.........--....................................
HGL_H00000413254-1  .LA........KKSLDISVW.D.......YD.........IG....................................
HGL_H00000369257    .LK........SESLGFYVF.D.......DS.........DT....................................
HGL_H00000358558    .LA........DRKLHLSVF.D.......FD.........RF....................................
HGL_H00000324419-1  .LE........ARKLHFSVY.D.......FD.........RF....................................
HGL_H00000340914    .LA........QRKLHFSVY.D.......FD.........RF....................................
HGL_H00000228567-2  .LS........NRKLHFSVY.D.......FD.........RF....................................
HGL_H00000263431    .--........ERRLSVEVW.D.......WD.........RT....................................
HGL_H00000419260    .--........---------.-.......--.........--....................................
HGL_H00000381854    .--........---------.-.......--.........--....................................
HGL_H00000319756    .LL........KGDVMVTCY.H.......KG.........SR....................................
HGL_H00000263846    .LR........ETTIIITVM.D.......KD.........RL....................................
HGL_H00000316464    .LS........GRVLSLSVW.H.......RE.........SL....................................
HGL_H00000284384    .-K........DRRLSVEIW.D.......WD.........RT....................................
HGL_H00000357307    .LP........GISIEFLVI.D.......FD.........RT....................................
HGL_H00000413254-1  .MQ........RKTLRISVC.D.......ED.........KF....................................
HGL_H00000413254-2  .MI........RKTLRISVC.D.......ED.........KF....................................
HGL_H00000369257    .LK........SESLGFYVF.D.......DS.........DT....................................
HGL_H00000395220    .LE........TRTLQLSVW.H.......YD.........RF....................................
HGL_H00000352065    .LK........TQKLNLSVW.H.......RD.........TF....................................
HGL_H00000340017-1  .LA........KKTLLVSVW.D.......YD.........LG....................................
HGL_H00000382895    .LR........QEALSIYVF.D.......DE.........DS....................................
HGL_H00000340017-2  .LA........TKTLEVTVW.D.......YD.........IG....................................
HGL_H00000362080    .LA........QRTLQFSVW.H.......HG.........RF....................................
HGL_H00000340914    .VE........NVGLSIAVV.D.......Y-.........-I....................................
HGL_H00000356155    .PR........ETLLCATLY.-.......--.........--....................................
HGL_H00000265970    .PL........ESLLHLTLF.G.......I-.........--....................................
HGL_H00000228567-1  .LS........NRKLHFSVY.D.......FD.........RF....................................
HGL_H00000357307    .LQ........DLVLHFLIL.S.......FD.........RF....................................
HGL_H00000297239    .LV........TRQLQVSVW.H.......VG.........TL....................................
HGL_H00000255224    .LE........DISVEFLVL.D.......SE.........RG....................................
HGL_H00000340017-2  .IT........HKVLRISVC.D.......ED.........KL....................................
HGL_H00000362080    .LQ........HMCLELTVW.D.......RE.........PL....................................
HGL_H00000409572    .--........-ALVRFVVE.D.......YD.........AS....................................
HGL_H00000413254-2  .LA........KKTLEVTVW.D.......YD.........IG....................................
HGL_H00000305355    .-K........DRRLSVEIW.D.......WD.........LT....................................
HGL_H00000260323    .--........-DRIKVRVW.D.......ED.........DDiksrvkqhf...........................
HGL_H00000347538    .LE........NASLVFTVF.G.......HN.........MK....................................
HGL_H00000380006    .--........-DRIKVRVW.D.......ED.........DDiksrvkqrl...........................
HGL_H00000262940    .--........-EVLCVEAW.D.......WD.........LV....................................
HGL_H00000402861    .--........-AMIRFVVL.D.......DD.........YI....................................
HGL_H00000308957    .--........-GIIDITAW.D.......KD.........AG....................................
HGL_H00000255224    .IQ........ELALHFTIL.S.......FD.........RF....................................
HGL_H00000377520    .LQ........DLSLRVTVA.E.......SS.........SD....................................
HGL_H00000377612    .--........-QELEVEVF.D.......KD.........LD....................................
HGL_H00000347538    .-Q........RRTLLLTVV.D.......FD.........KF....................................
HGL_H00000371394    .LP........SATLQVQVL.D.......FK.........RF....................................
HGL_H00000395220    .IN........SVCLELTIW.D.......KE.........AF....................................
HGL_H00000308957    .--........-SVLEVTVY.D.......ED.........RD....................................
HGL_H00000350377    .--........-DILEVTVF.D.......ED.........GD....................................
HGL_H00000361021-2  .--........--------F.-.......--.........--....................................
HGL_H00000396185-1  .--........-ATLRFVVK.D.......YD.........WK....................................
HGL_H00000264839    .FR........ERMLEITVW.D.......QP.........RV....................................
HGL_H00000285094    .--........-AMVRFVVL.D.......DD.........YI....................................
HGL_H00000374218    .--........-QDLEVDLY.D.......ED.........TD....................................
HGL_H00000228567-1  .MD........QVSLTIAVM.D.......YD.........RE....................................
HGL_H00000402784    .--........-QELEIELF.D.......ED.........PD....................................
HGL_H00000374218    .VK........KRSLDVAVK.N.......SR.........PL....................................
HGL_H00000350377    .--........-QKLRVKVY.D.......RD.........LT....................................
HGL_H00000361021-3  .--........---------.-.......--.........-G....................................
HGL_H00000400409    .--........-DRIKVRVW.D.......EDddiksrvkqRF....................................
HGL_H00000266505    .--........-ALLRFVVE.N.......SG.........LI....................................
HGL_H00000358200    .PE........KYILFLIVM.H.......RS.........LV....................................
HGL_H00000308957    .--........-EPLYIKVF.D.......YD.........FG....................................
HGL_H00000345988    .--........-ALVRFLVW.D.......HD.........PI....................................
HGL_H00000346265    .--........---------.-.......--.........--....................................
HGL_H00000324419-2  .--........-DQIHSSIA.V.......GD.........YV....................................
HGL_H00000371394    .VQ........NVDLVLAVW.-.......--.........--....................................
HGL_H00000347244    .--........QDVLCLTMF.D.......RD.........QF....................................
HGL_H00000334105    .--........-AVLRIAVY.D.......--.........--....................................
HGL_H00000367747    .--........-ALVRFLVW.D.......HD.........PI....................................
HGL_H00000388756    .LQ........DEPLQITVL.D.......HD.........TY....................................
HGL_H00000400409    .--........-LGLTVEVW.N.......KG.........LI....................................
HGL_H00000377612    .VL........RRKLDVSVK.S.......SS.........SF....................................
HGL_H00000386881    aEQ........PPSIVVELY.D.......HD.........TY....................................
HGL_H00000377612    .--........-QEIEVEVF.D.......KD.........PD....................................
HGL_H00000261729    .--........PAPLRVELW.D.......WD.........MV....................................
HGL_H00000356155    .LQ........QRELQLSVL.S.......EQ.........GF....................................
HGL_H00000256832    .--........-HRLLFEVF.D.......EN.........RL....................................
HGL_H00000370719    .--........-EVLCITVF.E.......RD.........QF....................................
HGL_H00000020926    .LR........ASSVELEVL.S.......QD.........EA....................................
HGL_H00000400398    .--........-PELTVAVF.D.......HD.........LV....................................
HGL_H00000306124-2  .--........-RKIELAVF.H.......DA.........PI....................................
HGL_H00000244751    .DY........DRTIKVEVY.D.......WD.........RD....................................
HGL_H00000290472    .-V........KNVLELGIY.D.......ED.........LI....................................
HGL_H00000338185    .--........-ACLRIAVY.E.......--.........--....................................
HGL_H00000316464    .LR........QACAELSLW.D.......HE.........AL....................................
HGL_H00000331602    .--........-RVIQIVLM.R.......A-.........--....................................
HGL_H00000265970    .LR........QRELQLSVL.S.......AE.........SL....................................
HGL_H00000362369    .--........-AFLRFVVY.E.......ED.........MF....................................
HGL_H00000329127    .--........-GHLELAVF.H.......ET.........PL....................................
HGL_H00000361768-2  .--........GKVLQIIVWgD.......YG.........RM....................................
HGL_H00000389039    .LS........DVTLILSVY.N.......KR.........SM....................................
HGL_H00000363443    .-T........QRVLQFSVY.H.......VD.........RQ....................................
HGL_H00000381982    .--........-SLLSILIY.D.......HD.........MI....................................
HGL_H00000373343    .DY........DRTVKIDVY.D.......WD.........RD....................................
HGL_H00000385255    .-M........ESMLTVAVY.D.......WD.........LV....................................
HGL_H00000386881    .DQ........GSELHVVVK.D.......HE.........TM....................................
HGL_H00000262650    .--........-SKLHFRVW.S.......HQ.........TL....................................
HGL_H00000374195    .--........-RHLSFYIF.D.......RD.........VF....................................
HGL_H00000374195    .VD........KLEIRVDLW.N.......AS.........NL....................................
HGL_H00000356436    .--........-NILEITLM.D.......AN.........YV....................................
HGL_H00000324510    .RR........GACVLFTVM.D.......HD.........WL....................................
HGL_H00000352336    .--........-AFLRFVVY.E.......ED.........IF....................................
HGL_H00000279230    .--........LASLRIAAF.E.......--.........--....................................
HGL_H00000382434    .-V........KNVLELSVC.D.......ED.........PI....................................
HGL_H00000394700    .LS........DVTLMISIY.N.......RR.........TM....................................
HGL_H00000264839    .--........GKVLQVIVWgD.......YG.........RM....................................
HGL_H00000352208    .--........-KDLKISVY.D.......YD.........AF....................................
HGL_H00000352065    .LM........EACVELTVW.D.......HY.........KL....................................
HGL_H00000324510    .--........-DQLHLDIW.D.......HD.........DDvslaeacrklneviglkgmsryfkqivksarangtp
HGL_H00000377612    .--........-QELDVQVK.D.......D-.........--....................................
HGL_H00000361942-1  .--........-HSLQILLF.S.......NG.........GK....................................
HGL_H00000259406    .--........QKRLLLTVW.N.......RA.........SK....................................
HGL_H00000020926    .LR........TAALTLTLR.T.......CD.........RF....................................
HGL_H00000386881    .-L........EKDLKITLY.D.......YD.........LL....................................
HGL_H00000263125    .--........-RVMQIIVK.G.......KN.........MD....................................
HGL_H00000261729    .--........-HHLAFYVL.D.......ED.........TV....................................
HGL_H00000258098    .--........ACQLVLTTM.H.......RS.........LI....................................
HGL_H00000380006    .PE........TYELQICVK.D.......YC.........FA....................................
HGL_H00000400843    .-V........KNVLELTLY.D.......KD.........VL....................................
HGL_H00000340017-1  .AG........RKTLRLCVC.E.......DP.........RL....................................
HGL_H00000198765    .DM........DKTIKVECY.D.......YD.........SD....................................
HGL_H00000388091    .-L........EKDLQIQLY.D.......FD.........LF....................................
HGL_H00000361768-1  .--........GKVLQVIVWgD.......YG.........RM....................................
HGL_H00000260323    .PA........AYELHLAVK.D.......YC.........FA....................................
HGL_H00000352208    lQN........PPKVIIEHF.D.......ND.........QV....................................
HGL_H00000290776    .--........-QKLKFALF.D.......QD.........KSsm..................................
HGL_H00000352208    .DF........SSSLEIIVK.D.......FE.........TI....................................
HGL_H00000388093    .KD........GACLLLTVL.D.......HD.........TL....................................
HGL_H00000388093    .--........-ASFHLDMW.D.......MD.........TVesvrqklgeltdlhglrrifkeark...........
HGL_H00000381982    .LF........DKIIKISVF.H.......HK.........LL....................................
HGL_H00000371646    .--........-DSFYLEIF.D.......ER.........AF....................................
HGL_H00000402784    .--........-QDLEVEVK.D.......E-.........--....................................
HGL_H00000290776    .DM........NKPIQVTCY.D.......YD.........ND....................................
HGL_H00000360108    .--........---------.-.......--.........--....................................
HGL_H00000394700    .VA........SCAVRFRLY.A.......AR.........KM....................................
HGL_H00000361942-2  .--........GKVLQVIVW.Gn......YG.........RM....................................
HGL_H00000260402    .--........-ASLRVAVM.E.......--.........--....................................
HGL_H00000262435    .--........-DSVTISVW.N.......HK.........KI....................................
HGL_H00000352208    .--........CEKIKLTVF.D.......WD.........RL....................................
HGL_H00000354621-1  .--........-DSITISVW.N.......HK.........KI....................................
HGL_H00000316746    .--........GGPLRVQVW.D.......AD.........NG....................................
HGL_H00000262940    .--........-HDVAFYVM.D.......ED.........AL....................................
HGL_H00000244751    .--........-QNLRFDLY.D.......VD.........SKsp..................................
HGL_H00000373343    .--........-QNLRFDVY.N.......VD.........SRt...................................
HGL_H00000385255    .--........CKRMKVQIR.D.......CD.........KV....................................
HGL_H00000360431    .--........-VFVRFAVV.E.......N-.........--....................................
HGL_H00000377612    .--........-ESLELQVR.G.......EG.........TG....................................
HGL_H00000389039    .IG........NYAVRFRLY.G.......VH.........RM....................................
HGL_H00000265428    .--........-TTLEFRVW.S.......HH.........TL....................................
HGL_H00000386881    .LF........DEPIFITVV.D.......SR.........SL....................................
HGL_H00000381982    .--........CRRVKIQVW.D.......EG.........SM....................................
HGL_H00000352208    .LM........DEIISIRVY.N.......SH.........SL....................................
HGL_H00000350377    .--........-GILDIEVW.G.......KD.........GK....................................
HGL_H00000314499    .--........---------.-.......--.........--....................................
HGL_H00000262940    .--........-HDVAFYVM.D.......ED.........AL....................................
HGL_H00000400398    qQE........PPLVVINVF.D.......HN.........KF....................................
HGL_H00000198765    .--........-QKLKFGIY.D.......ID.........NKtv..................................
HGL_H00000381982    .KT........PAVLVLQVW.D.......FE.........RL....................................
HGL_H00000216775    .DV........HRPLKFLVY.D.......YD.........SS....................................
HGL_H00000385255    .-D........PPITVIEIY.D.......QD.........SM....................................
HGL_H00000388091    .KF........PARLIIQIW.D.......ND.........IF....................................
HGL_H00000386881    .KI........PARVVFQIW.D.......ND.........KF....................................
HGL_H00000386881    .--........CEKMRIRVI.D.......WD.........RL....................................
HGL_H00000385255    .MF........DKIIKISVI.H.......SK.........NL....................................
HGL_H00000352208    .RV........PPRLIIQIW.D.......ND.........KF....................................
HGL_H00000216775    .--........-QPLQFHVF.D.......AEdg.......AT....................................
HGL_H00000317214    .--........-IPIIVQVW.N.......RQ.........KF....................................
HGL_H00000400398    .RQ........PAVLVLQVW.D.......YD.........RI....................................
HGL_H00000377520    .LE........EKSLRFSVF.G.......ID.........ED....................................
HGL_H00000274376    .--........-NRFEITLS.N.......KT.........KK....................................
HGL_H00000317257    .--........-QKLRFGIY.D.......IE.........NKtp..................................
HGL_H00000264554    .VR........KLSLRIKVV.N.......KG.........SS....................................
HGL_H00000374218    .--........-EQLCLKVL.D.......D-.........--....................................
HGL_H00000400398    .LQ........DSLLEITAF.H.......SQ.........TL....................................
HGL_H00000360642    .IQ........SKGIKFEIF.H.......KG.........SF....................................
HGL_H00000398577    .LQ........QKTLRVDLC.S.......VS.........KH....................................
HGL_H00000387882    .-K........DIVFLFKLY.S.......RS.........SV....................................
HGL_H00000385255    .KI........PARLTLQIW.D.......AD.........HF....................................
HGL_H00000388091    rES........PPLVVLELW.Q.......CD.........AL....................................
HGL_H00000313731    .--........-ALVRFVVE.D.......YD.........TA....................................
HGL_H00000331342    .--........-ATLQLTVL.H.......RA.........LL....................................
HGL_H00000380006    .--........-LGLSVEVW.N.......KG.........LI....................................
HGL_H00000348283    .--........-SHLDLKVW.S.......CH.........TL....................................
HGL_H00000303507    .--........-QTLRILCY.E.......KC.........YNktkiaked............................
HGL_H00000387882    .--........-QTVRLVFK.I.......QT.........QT....................................
HGL_H00000400398    .--........TRGLSLQLR.D.......DA.........PL....................................
HGL_H00000261729    .--........-HHLAFYVL.D.......ED.........TV....................................
HGL_H00000266497    .-Q........GHVLMLIVK.-.......--.........--....................................
HGL_H00000370242    .LA........VKSLQLYVC.S.......VN.........PQ....................................
HGL_H00000388091    .--........SSYIKFRAL.D.......CS.........RS....................................
HGL_H00000386881    .LY........CPPIVVKVI.D.......NR.........QF....................................
HGL_H00000356621    .--........-HSITVHIY.Kdvek...KK.........KK....................................
HGL_H00000381982    .LL........HPPLSICVV.D.......WR.........AF....................................
HGL_H00000381845    .--........---------.-.......--.........--....................................
HGL_H00000388091    .EN........DSFLQVILR.D.......MG.........SK....................................
HGL_H00000352208    .LY........MPPLVIKVI.D.......HR.........QF....................................
HGL_H00000297239    .LR........QASLELTVW.D.......QA.........IF....................................
HGL_H00000377473    .LH........QKTLRVDVC.T.......TD.........QS....................................
HGL_H00000386183    .--........-RTVTVHLY.Retdk...KK.........KK....................................
HGL_H00000303909    .--........-QSLRILCY.E.......KC.........YD....................................
HGL_H00000313601    .LQ........TKGIKFEVV.H.......KG.........GL....................................
HGL_H00000325012    .AG........QEDVVLKVV.D.......NK.........--....................................
HGL_H00000369853    .--........-RELYLQIL.E.......EG.........RP....................................
HGL_H00000343325-2  .--........-RELELAVF.W.......RD.........QR....................................
HGL_H00000381982    aEA........PPLVVVELY.D.......SD.........AV....................................
HGL_H00000385255    .LL........HPPLNIRVV.D.......CR.........AF....................................
HGL_H00000334379    .DP........QQTLVFKVW.H.......KG.........--....................................
HGL_H00000350649-2  .--........-QRLRFEVH.Dissn...HN.........GL....................................
HGL_H00000379227    .--........-DVLEIEVK.Dkfa....KS.........RP....................................
HGL_H00000363443    .LD........TTSLSLTV-.-.......--.........--....................................
HGL_H00000260983    .--........-DVLEIEIK.Dkfa....KS.........RP....................................
HGL_H00000266497    .PR........ESMLTIKVF.G.......IG.........CT....................................
HGL_H00000340594    .--........-QHLKLVVF.S.......WE.........PT....................................
HGL_H00000350649-2  .DP........DRRLKL---.-.......--.........--....................................
HGL_H00000388091    .VY........SEPLVLKVL.D.......NQ.........DF....................................
HGL_H00000388091    .KF........FDEI-----.-.......--.........--....................................
HGL_H00000400409    .--........---------.-.......--.........--....................................
HGL_H00000317257    .DY........NTSIQVRCS.D.......YD.........SD....................................
HGL_H00000303058    .LQ........RTPIKLQCF.A.......LD.........PV....................................
HGL_H00000291906    .--........-RELEIGVH.W.......RD.........--....................................
HGL_H00000262992    .YE........ETSIKLTVY.D.......VK.........DKshdtvrtrvlsehnkdsp..................
HGL_H00000074304    .NQ........MTQIKLSVY.D.......VK.........DR....................................
HGL_H00000400398    .-P........GENLSVQVV.N.......CS.........HV....................................
HGL_H00000385255    .DR........NEMLEIQIF.N.......YS.........KV....................................
HGL_H00000400398    .YL........QPPLSILVI.E.......HR.........AF....................................
HGL_H00000334379    .LK........NNVMIIETW.N.......KV.........RS....................................
HGL_H00000354087    .--........-QPITVQV-.-.......--.........--....................................
HGL_H00000338885    .--........-RELTLKVL.R.......SS.........SC....................................
HGL_H00000398391    .DYssaslqsvKDDVFINIF.D.......EV.........LCdvleddrergsgih......................
HGL_H00000334379    .--........EERLEIQVW.RaygsdsvER.........PH....................................
HGL_H00000348455-2  .--........---------.-.......--.........--....................................


                                 110                 120             130       140                  
                                   |                   |               |         |                  
d1v27a_               ...REEESE...FLGEILIELE..........TALLDD......EPHWYKLQTHDS-----gpssg............
HGL_H00000418143    ...------...----------..........------......-----------------vldkvktkkstktinps
HGL_H00000369257    ...---DYE...TIAACQLRFH..........KILEKSgr....IFYTAS-----------lvgtkgdipnfgtveyw
HGL_H00000356236    ...--SKHD...IIGEVKVPMN..........TVDLGQp.....IEEWRDLQ---------g................
HGL_H00000391056    ...--SKHD...IIGEFKVPMN..........TVDFGHv.....TEEWRDLQS--------ae...............
HGL_H00000391056    ...--GKND...AIGKVFVGYNstgaelrhwsDMLA--......-----------------nprrpiaqwhtlq....
HGL_H00000353766    ...------...----------..........------......-----------------vvekakkarstkkkskk
HGL_H00000263846    ...--SRND...PIGEVSIPLN..........KVDLTQm.....QTFWKDLKPCS------dg...............
HGL_H00000382895    ...------...----------..........------......-----------------sslflhylqgasaqldl
HGL_H00000263967    ...------...----------..........------......-----------------rkgakeehcplawgnin
HGL_H00000358558    ...--GHNE...IIGVCRVGIH..........AEGLGR......-DHWN------------emlayprkpiahwhslv
HGL_H00000346265    ...--SRND...AIGEVRVPMS..........SVDLGRp.....VQAWQELQ---------aapr.............
HGL_H00000356236    ...--GKNE...AIGKIFVGSNatgtelrhwsDMLANPrrp...IAQWHSL----------kp...............
HGL_H00000324419-1  ...--GHNE...IIGVCQVGNE..........AERLGR......-DHWSEMLS--------yprkpiahwhsl.....
HGL_H00000228567-2  ...--GHNE...VIGVCRTGLDaeglgrdhwnEMLAYHrkp...ITHWHPL----------l................
HGL_H00000361021-1  ...------...----------..........------......-----------------qnkmlkkdkmfhfwvnt
HGL_H00000171887    ...------...----------..........------......-----------------ipgdsqtsicitiepgl
HGL_H00000413254-1  ...--KSND...YIGGCQLGIS..........AK---Ger....LKHWYECLKNKDKKI--erwhqlq..........
HGL_H00000369257    ...--QENI...YIGKVNVPLI..........SLAHDRc.....ISGIFELTDHQK-----hpagtihvilkwkf...
HGL_H00000358558    ...--SRHD...MIGEVILD--..........------......-----------------nlfeasdlsretsiwkd
HGL_H00000324419-1  ...--SRHD...LIGQVVVD--..........------......-----------------hf...............
HGL_H00000340914    ...--SRHD...LIGQVVLD--..........------......-----------------n................
HGL_H00000228567-2  ...--SRHD...MIGEVILD--..........------......-----------------n................
HGL_H00000263431    ...--SRND...FMGAMSFGVS..........ELLKAP......VDGWYKLLNQEE-----ge...............
HGL_H00000419260    ...------...----------..........------......-----------------pfteeiyggkapgqsgk
HGL_H00000381854    ...------...----------..........------......-----------------igpespsriciaiepaq
HGL_H00000319756    ...--GTDR...T---------..........------......-----------------lvfrvqfhtctihgprl
HGL_H00000263846    ...--SRND...VIGKV-----..........------......-----------------gaarppglpccipgtsw
HGL_H00000316464    ...--GRNI...FLGEVEVPLD..........TWNWDS......GPTWLPLQPR-------ap...............
HGL_H00000284384    ...--TRND...FMGSLSFGVS..........ELMKMP......ASGWYKLLNQEE-----ge...............
HGL_H00000357307    ...--TKNE...VVGRLILGAH..........SVTAGG......AEHWQEVCESPR-----kpvakwhsl........
HGL_H00000413254-1  ...--GHNE...FIGETRFSLK..........KLKPNQr.....K----------------nfnicl...........
HGL_H00000413254-2  ...--RHNE...FIGETRVPLK..........KLKPNHt.....KTFSICLEK--------qlpv.............
HGL_H00000369257    ...--QENI...YIGKVNVPLI..........SLAHDR......-----------------cisgtkgdipnfgtvey
HGL_H00000395220    ...--GHNS...FLGEVEIPFD..........SWNFENp.....CDEWFVLQP--------.................
HGL_H00000352065    ...--KRNS...FLGEVELDLE..........TWDWDNkqnk..QLKWYPLK---------q................
HGL_H00000340017-1  ...--TADD...FIGGVQLS--..........SQASGEr.....LHHWRECLGRSDCR---lelwhpl..........
HGL_H00000382895    ...--EPGS...YLGRVQVPLL..........PLAQNNp.....IKGDFNLIDP-------aekpngsiqlkldwk..
HGL_H00000340017-2  ...--KSND...FIGGVSLGPG..........A-----......-----------------rgearrhwsaclqqpda
HGL_H00000362080    ...--GRNT...FLGEAEVHMD..........SWKLDKk.....LDHCLPLH---------g................
HGL_H00000340914    ...--GHNE...VIGVCRVGPE..........AADPHG......REHWAEMLANPR-----kpvehwhqlv.......
HGL_H00000356155    ...------...----------..........------......-----------------alpipppgssseankqr
HGL_H00000265970    ...------...----------..........------......-----------------lnqssgsspdsnkqrkg
HGL_H00000228567-1  ...--SRHD...MIGEVILD--..........------......-----------------n................
HGL_H00000357307    ...--SRDD...VIGEVMVPLA..........GVDPS-......-----------------tgkvq............
HGL_H00000297239    ...--ARRV...FLGEVIVPLA..........TWDFEDsatq..SFHWYPL----------ra...............
HGL_H00000255224    ...--SRNE...IIGRLILGAS..........AEGTGG......-EHW-------------keicdfprrqiakwhml
HGL_H00000340017-2  ...--SHNE...FIGEIRVPLR..........RLKPSQk.....KHFNIC-----------lerqvp...........
HGL_H00000362080    ...--TSND...FLGGVRLGVG..........SGISNGe.....LVDW-------------md...............
HGL_H00000409572    ...--SKND...FIGQSTIPWH..........SLKQG-......-YRHIHLLSKN------gdqhpsatlfvkitl..
HGL_H00000413254-2  ...--KSND...FIGGVVLGIN..........A---KGer....LKHWFDCLKNKDKRI--erwhtl...........
HGL_H00000305355    ...----ND...FMGSLSFGIS..........ELQKAG......VDGWFKLLSQE------e................
HGL_H00000260323    ...KKESDD...FLGQTIVEVR..........TLSGE-......MDVWYNLEKRTD-----ksavsgairlkinveik
HGL_H00000347538    ...--SSND...FIGRIVIGQY..........SSGPSE......SNHWRRMLNTHR-----taveqwhslrs......
HGL_H00000380006    ...KRESDD...FLGQTIIEVR..........TLSGE-......MDVWYNLEKRTD-----ksavsgairlqisveik
HGL_H00000262940    ...--SRND...FLGKVVVNVQ..........RVRAAEq.....EEGWFRLQPD-------q................
HGL_H00000402861    ...---GDE...FIGQYTIPFE..........CLQPG-......-YRHVPL----------rsfvgdimehvtlfvhi
HGL_H00000308957    ...--KRDD...FIGRCQVDLS..........ALSREQt.....HKLELQLEEGE------gh...............
HGL_H00000255224    ...--SRDD...IIGEVLIPLS..........GIELS-......-----------------dgk..............
HGL_H00000377520    ...--SRGD...NVGHVIIGPA..........AS----......-----------------gmgtthwnqmlatlr..
HGL_H00000377612    ...---KDD...FLGRCKVSLT..........TVLNSGf.....LDEWLTLED--------vlsgrlhlrler.....
HGL_H00000347538    ...--SRHC...VIGKVSVPLC..........EVDLVKg.....GHWWKALIPSS------qn...............
HGL_H00000371394    ...--SEHE...PLGDLCLPLG..........TLDPQHv.....MECWYQLGP--------p................
HGL_H00000395220    ...--SSNI...FLGGVRLNCG..........SGVSHG......-----------------knvdwmd..........
HGL_H00000308957    ...--RSAD...FLGKVAIPLL..........SIQNGEqkay..VLKNKQL----------tgptkgviyleid....
HGL_H00000350377    ...--KPPD...FLGKVAIPLL..........SIRDGEln....C----------------yvlknkdleqafkgviy
HGL_H00000361021-2  ...------...----------..........------......-----------------hkqnkmlkkdklfhfwv
HGL_H00000396185-1  ...--SRNE...FIGQFTLPWT..........CMKQG-......-YRHIHLLSRDG-----islhpasifvyisi...
HGL_H00000264839    ...QEEESE...FLGEILIELE..........TALLDD......EPHWYKLQTH-------d................
HGL_H00000285094    ...---GDE...FIGQYTIPFE..........CLQTG-......-YRHVPLQSLT------gevlahaslfvhvai..
HGL_H00000374218    ...---KDD...FLGSLQICLG..........DVMTNRv.....VDEWFVLNDTTSGR---lhlrlewls........
HGL_H00000228567-1  ...--GHH-...----------..........------......-----------------t................
HGL_H00000402784    ...---KDD...FLGSLMIDLT..........EVEKERl.....LDEWFTLDEVP------rgklhlklewl......
HGL_H00000374218    ...GSHRRK...ELGKVLIDLS..........KEDLIKg.....FSQWYELTPD-------g................
HGL_H00000350377    ...---TSD...FMGSAFVILS..........DLELNRt.....TEHILKLEDPNS-----leddmgvivlnlnl...
HGL_H00000361021-3  ...------...----------..........------......-----------------strredklmyfefpqll
HGL_H00000400409    ...KRESDD...FLGQTIIEVR..........TLSGE-......MDVWYNLDKRTD-----ksavsgairlhisveik
HGL_H00000266505    ...--AGNE...FLGQYTLPVL..........CMSKG-......-YRRVPLFSRSGE----slepaslfvyvwyv...
HGL_H00000358200    ...--GLDK...FLGQVAINLN..........DIFEDKqrr...KTEWFRLESKQGKRV--ksrgeikvniqfmrnnm
HGL_H00000308957    ...--LQDD...FMGSAFLDLT..........QLELNRp.....TDVTLTLKDP-------hypdhdlgiilllvvlt
HGL_H00000345988    ...---GRD...FVGQRTVTFS..........SLVPG-......-YRH-------------vyleglteasi......
HGL_H00000346265    ...------...----------..........------......-----------------dqv..............
HGL_H00000324419-2  ...--GHNE...IISVCQVGNE..........AER---......-----------------lgrvhwseilsyprksm
HGL_H00000371394    ...--LRAE...PVGKVLLGP-..........------......-----------------rasgqplqhwadmlaha
HGL_H00000347244    ...--SPDD...FLGRTEVPLA..........KIRTEQesk...G----------------pttrrlllhevstgevw
HGL_H00000334105    ...--DNNK...LIGQRILPLD..........GLQAG-......-YRHISLRNEGNK----plslptifcniv.....
HGL_H00000367747    ...---GRD...FIGQRTLAFS..........SMMPG-......-YRHV------------ylegmmeesi.......
HGL_H00000388756    ...--SAND...AIGKVYIDID..........PLLYSEaatv..ISGWFPIYD--------tihg.............
HGL_H00000400409    ...---WDT...MVGTVWIPLR..........TIRQSNeeg...PGEWLTLDS--------qvimadseicgtkdptf
HGL_H00000377612    ...MSRERE...LLGKVQLDLA..........EIDLSQg.....AAQWYDLMDDK------d................
HGL_H00000386881    ...--GADE...FMGRCICQPS..........LERMP-......RLAWFPLTKGSQ-----ptgellasfe.......
HGL_H00000377612    ...---KDD...FLGRMKLDVG..........KVLQAGv.....LDDWYPLQGGKGQ----vhlrlewl.........
HGL_H00000261729    ...--GKND...FLGMVEFPAQ..........VLQHKP......PNGWFRLQP--------fpsae............
HGL_H00000356155    ...--WENV...LLGEVHIRLR..........ELDLAHe.....KTGWFALGSR-------s................
HGL_H00000256832    ...--TRDD...FLGQVDVPLS..........HLPTEDpt....MERPYT-----------fkdfllrprshksrvkg
HGL_H00000370719    ...--SPDD...FLGRTEIRVA..........DIKKDQgpk...G----------------pvtkclllhevptgeiv
HGL_H00000020926    ...--GQSC...TLGHCSLGLH..........TSGSER......-SHWEEMLKN-------prr..............
HGL_H00000400398    ...--GSDD...LIGETHIDLE..........NRFYSH......-----------------hrancglasqydvdgyn
HGL_H00000306124-2  ...--GYDD...FVANCTIQFE..........ELLQNGsrh...FEDW-------------vspapp...........
HGL_H00000244751    ...--GSHD...FIGEFTTSYR..........ELARGQs.....QFNIYEVINPKKK----mk...............
HGL_H00000290472    ...--TKDD...ICFKVFYDIS..........EVLPGKl.....LQKTFFLGPQGQE----eldvef...........
HGL_H00000338185    ...--EGGK...FIGHRILPVQ..........AIRPG-......-YHYICLRNER------nqpltlpavfvyiev..
HGL_H00000316464    ...---ASR...QLGGTRLSLG..........TGSSYG......-----------------lqvpwmdstp.......
HGL_H00000331602    ...---AEE...PMSEVTVGVS..........VLAERCkknngkAEFWLDLQPEA------kvlmsvqyfl.......
HGL_H00000265970    ...--RENF...FLGGITLPLK..........DFNLSKe.....TVKWYQL----------t................
HGL_H00000362369    ...--SDQN...FLAQATFPVK..........GLKTG-......-YRAVPLKNNYS-----edlelasllikid....
HGL_H00000329127    ...--GYDH...FVANCTLQFQ..........ELLRTTgtsdt.FEGWVDLEPEGKVF---vvitltg..........
HGL_H00000361768-2  ...--DHKS...FMGVAQILLD..........ELELSNm.....VIGWFKLFPPS------s................
HGL_H00000389039    ...--KRKE...MIGWISLGLN..........SSGEEE......LSHWTEMKESKGQQ---vcrwhal..........
HGL_H00000363443    ...--RRHQ...LLGQVLFPLK..........------......-----------------s................
HGL_H00000381982    ...--GTDD...LIGETKIDLE..........NRFYSK......HRAICGLQ---------sqyevegynawrd....
HGL_H00000373343    ...--GSHD...FIGEFTTSYR..........ELSKAQn.....QFTVYEVLNPRK-----kc...............
HGL_H00000385255    ...--GTDD...LIGETKIDLE..........NRFYSK......-----------------hratcgvaqtysthgyn
HGL_H00000386881    ...--GRNR...FLGEAKVPLR..........EVLATSsls...ASFNAPLLDT-------kqqptggslvlqvsytp
HGL_H00000262650    ...--KSDV...LLGTAAVDIY..........ETLKSNnmkleeVVVSLQ-----------ligdkeptetigdlsvc
HGL_H00000374195    ...--RRDS...IIGKVAIRKE..........DLQKYHn.....RDTWFQLQH--------vdadsevqgkvhlelrl
HGL_H00000374195    ...K-FGDE...FLGELRIPLK..........VLRQSSc.....YEAWYFLQPRDN-----skspkpddlgslrlnvv
HGL_H00000356436    ...---MDE...TLGTATFPVS..........SMKVGEk.....K----------------evpfifnqvtemilels
HGL_H00000324510    ...--STND...FAGEAALGLS..........G-----......-----------------v................
HGL_H00000352336    ...--SDPN...FLAHATYPIK..........GIKSG-......-FRSVPLKNGYS-----edielasllvf......
HGL_H00000279230    ...--EGGK...FVGHRILPVS..........AIRSG-......-YHYVCLRNE-------anqplclpalliy....
HGL_H00000382434    ...--TPND...HLLIVLYDLS..........KLCFRKk.....VHVKFPLNPEG------leelevefl........
HGL_H00000394700    ...--KRKE...MIGWIALGQN..........SSGEEE......QDHWEEMKEIKG-----qqvcrwhtll.......
HGL_H00000264839    ...--DHKC...FMGVAQILLE..........ELDLSSm.....VIGWYKLFPPS------s................
HGL_H00000352208    ...--TRDE...KVGETIIDLE..........NRFL--......-----------------s................
HGL_H00000352065    ...---TNQ...FLGGLRIGFG..........TG----......-----------------ksygtevdwmd......
HGL_H00000324510    gptEDHTDD...FLGCLNIPVR..........EVPVAG......TDRWFKLEPRSS-----asrvqgdchlvl.....
HGL_H00000377612    ...--SRAL...TLGALTLPLA..........RLLTASelt...LDQWFQLSGSG------pnsrlymklvmrilyld
HGL_H00000361942-1  ...F-MKKT...LIGEACIWLD..........KVDLRKr.....IVSWHKLLAS-------pt...............
HGL_H00000259406    ...T-RQRA...LIGCMSFGVR..........SLLTPSkd....ISGWYYLLG--------e................
HGL_H00000020926    ...--SRHS...VAGELRLALD..........GVSVPLg.....AAQWGELK---------tsv..............
HGL_H00000386881    ...--SKDE...KIGETVIDLE..........NRLLS-......-----------------kfga.............
HGL_H00000263125    ...------...LISETTVELY..........SLAERCrknngrTEIWLELKPQGR-----mlmnaryfl........
HGL_H00000261729    ...--GHDD...VIGKISLSKE..........AI----......-----------------tadpr............
HGL_H00000258098    ...--GVDK...FLGQATVALD..........EVFGAGraq...HTQWYKLHSKAG-----kkekergeiqvtiqftr
HGL_H00000380006    ...--REDH...VLGLAVMPLR..........DVTAKGs.....CACWCPL----------g................
HGL_H00000400843    ...---SSD...QLSLLLFDLR..........SLKPGQp.....HRHTFSLTQQGSQ----elqvefv..........
HGL_H00000340017-1  ...--RRRRqapPLGELRVPLK..........KLVPNR......-----------------arsfd............
HGL_H00000198765    ...--GSHD...LIGTFQTTMT..........KLKEASrn....SPIEYECINEKKKQ---kkk..............
HGL_H00000388091    ...--SFDD...EIGSTFIDLE..........NRLLSG......-----------------fgarcglsksycqsgpf
HGL_H00000361768-1  ...--DHKC...FMGMAQIMLD..........ELDLSAv.....VTGWYKLFPT-------s................
HGL_H00000260323    ...--REDR...VIGMTVIQLQ..........TIEEKGs.....HGAWYPLL---------r................
HGL_H00000352208    ...--GKDE...FLGRSICPPL..........VKLNSEmditp.KLLWHPVMNGDKA----cgdvlvtae........
HGL_H00000290776    ...QLDEHD...FLGQFSCSLG..........TIVSSKk.....ITRPLLLMNDK------pagk.............
HGL_H00000352208    ...--GQNK...LIGTATVALK..........DLTGNQs.....RSLPYKLI---------slinekgqdtgat....
HGL_H00000388093    ...--GAND...LEGEAFLPLC..........------......-----------------av...............
HGL_H00000388093    ...DRGQDD...FLGNVVLRLQ..........DLRCRE......-DQWYPLEPRT------et...............
HGL_H00000381982    ...---GNV...LIGSFKVDLG..........TVYNQPghqf..CDKWALLTDPGDI----rtgakgylkcdihvtgk
HGL_H00000371646    ...--SMDD...RIAWTHITIP..........ESLKQGqv....EDEWYSLSGRQ------gddkegminlvmsytsl
HGL_H00000402784    ...--QHQC...SLGSLRISLS..........QLLTSEdmt...VNQRFQLSNSG------pnstlkmkialrvlhle
HGL_H00000290776    ...--GGHD...FIGEFQTTVS..........QMCEARng....VPLELECINPKKQR---kk...............
HGL_H00000360108    ...------...----------..........------......-----------------ctefermkeyrvqdgki
HGL_H00000394700    ...--TRER...MMGEKLFYLS..........HLHPEGe.....MKVTLVLEPRS------n................
HGL_H00000361942-2  ...--ERKQ...FMGVARVLLE..........ELDLTSl.....AVGWYKLFPT-------s................
HGL_H00000260402    ...--EGNK...FLGHRIIPIN..........ALNSG-......-YHHLCLHNESN-----maltmpalfvfle....
HGL_H00000262435    ...--HKKQgagFLGCVRLLSN..........AI----......-----------------nrlkdtgyqrldlcklg
HGL_H00000352208    ...--TKND...VVGTTYLYLS..........KIAAS-......-----------------g................
HGL_H00000354621-1  ...--HKKQgagFLGCVRLLSN..........A-----......-----------------isrlkdtgyqrldlckl
HGL_H00000316746    ...--WDDD...LLGSC-----..........------......-----------------drsp.............
HGL_H00000262940    ...--SRDD...VIGKVCLTRD..........TLASLPkg....FTGWAHLT---------evdpdeevqgeihlrle
HGL_H00000244751    ...DLSKHD...FLGQAFCTLG..........EIVGSS......-----------------gsrlekplt........
HGL_H00000373343    ...NISKPD...FLGQAFLALG..........EVIGGQg.....SRVERPLKGVP------gkkcgtill........
HGL_H00000385255    ...---NDV...AIGTHFIDLR..........KISNDG......-----------------dkgflptlgpawvnmy.
HGL_H00000360431    ...--NSSA...VTAQRIIPLK..........ALKRG-......-YRHLQLRN--------lhnevleisslfin...
HGL_H00000377612    ...------...TLGSLSLPFS..........ELLEADrlc...LDRWFVLTNGQGQ----vllkaql..........
HGL_H00000389039    ...--KKEK...IVGEKIFYLT..........KLNLQGk.....MSLPVTLEPSY------nh...............
HGL_H00000265428    ...--KADA...LLGRATIDLK..........QALL--......-----------------mhnrklervkeqlklsl
HGL_H00000386881    ...--RTDA...LIGEFRMDVG..........TIYREPrhay..LRKWLLLSDPDD-----fsagargylkaslcvlg
HGL_H00000381982    ...---NDV...ALATHFIDLK..........TISNE-......-----------------qd...............
HGL_H00000352208    ...--RADC...LMGEFKIDVG..........FVYDEPghav..MRKWLLLNDPED-----assgakgymkvsmfvlg
HGL_H00000350377    ...--KHEE...RLGTCKVDIA..........ALPLKQa.....NCLELPLE---------sclgallllitlrpcvg
HGL_H00000314499    ...------...----------..........------......-----------------sqeydrmkefkiedgka
HGL_H00000262940    ...------...----------..........------......-----------------s................
HGL_H00000400398    ...--GPAV...FLGRALAAPR..........VKLTEDpyqrp.ELQFFPLKK--------gargageliatfeli..
HGL_H00000198765    ...ELSDDD...FLRECECTLR..........QIVSSKk.....LTQPLVLKNDKPA----wkgnimis.........
HGL_H00000381982    ...--SSDD...FLGSLEMNLN..........SFPR--......-----------------aaksakacd........
HGL_H00000216775    ...--GKHD...FIGEFTSTFQ..........EMQEGTakpg..Q----------------emqwdcinp........
HGL_H00000385255    ...--GKAD...FMGRTF----..........------......-----------------akplvkmadeaycpprf
HGL_H00000388091    ...--SSDD...FLGVLELDLS..........DMPRPArha...KQC--------------slrmldakpkw......
HGL_H00000386881    ...--SFDD...FLGFLQLDLN..........RMP---......-----------------kpak.............
HGL_H00000386881    ...--THND...IVSTTYLSMS..........KI----......-----------------sa...............
HGL_H00000385255    ...L-RSGT...LVGSFKMDVG..........TVYSQPehqf..HHKWAILSDPDD-----isaglkgyvkcdi....
HGL_H00000352208    ...--SLDD...YLGFLELDLH..........H-----......-----------------tii..............
HGL_H00000216775    ...SPSNDT...FLGSTECTLG..........QIVSQTk.....VTKPLLLKNGK------tag..............
HGL_H00000317214    ...---CDH...FLGQVTLDAN..........PSDCHE......-----------------lkslylrkkggptakvk
HGL_H00000400398    ...--SAND...FLGSLELQLP..........DMVRGA......-----------------rdpaqcsvrl.......
HGL_H00000377520    ...--ERNI...STGVVELKLSvl........DLPLQP......FSGWLYLQDQN------k................
HGL_H00000274376    ...--SKDP...DILFMRCQLS..........RLQKGHa.....TDEWFLLSS--------hvplkgiepgslrvrar
HGL_H00000317257    ...GLGDDD...FLGGAECSLG..........QIVSSQi.....LTLPLMLKPG-------kp...............
HGL_H00000264554    ...L-KRDT...LLGEKELPLT..........SL----......-----------------l................
HGL_H00000374218    ...--DQEC...ALGVLEFPLC..........QILPYAdlt...LEQRFQLDHS-------gldslismrlvlrflrv
HGL_H00000400398    ...P-FMAT...RIGTFRMDLG..........IAFDQPdglf..YQKWAPLHDPRD-----thagikgfvkvtlsvka
HGL_H00000360642    ...F-RSDK...LVGTAHLKLE..........QLENECe.....IREIVEV----------ldgrkptggklevkvrl
HGL_H00000398577    ...--RREE...CLAGTQISLA..........DLPFSNei....FTVWYNLLPSKQV----pck..............
HGL_H00000387882    ...--RRKH...FVGQVWISED..........SNSIEA......VNQWKETIANPE-----kvvtkwhkln.......
HGL_H00000385255    ...--SADD...FLGAIELDLN..........RFPRGA......-----------------ktakqcsmematgevdv
HGL_H00000388091    ...--GKES...LWGRSMWPPV..........VWLDPQdwmlp.PLRWHPLVKERG-----eeegeilascel.....
HGL_H00000313731    ...--SPND...FVGQFTLPLS..........SLKYRH......-----------------ihllakdgaplspatlf
HGL_H00000331342    ...--GLDK...FLGRAEVDLR..........ELHRDQgrr...KTQWYALKSKPGK----kekergeievdiqfmrn
HGL_H00000380006    ...---WDT...MVGTVWIALK..........TIRQSDeeg...PGEWSTL----------eaetlmkddeicgtknp
HGL_H00000348283    ...---RNE...LLGTASVNLS..........NVLKNNggkmenTQLTLNLQTEN------kgsvvsggelti.....
HGL_H00000303507    ...GESTDR...LMGKGQVQLD..........PQTLQD......RDWQRTVIS--------mngievklsvkftsr..
HGL_H00000387882    ...--PKKK...TIGECSLSLR..........TLSTQE......MDYSLDIIPPSK-----is...............
HGL_H00000400398    ...---ADV...ALATHVLDLR..........QISH--......-----------------pgr..............
HGL_H00000261729    ...--GHDD...VIGKISLSKE..........AITADPrg....IDSWINLS---------rvnpdaevqgevrlavq
HGL_H00000266497    ...--SKTV...FVGAINIQLC..........SVLLNE......-EKWYPLG---------n................
HGL_H00000370242    ...--MQEE...LLGIAQINLA..........NYDSSSdm....QLRWYPV----------qv...............
HGL_H00000388091    ...--DCWA...EIGTASLSLG..........HISSSG......-----------------eei..............
HGL_H00000386881    ...--GRRP...VVGQCTIR--..........------......-----------------slesffcdp........
HGL_H00000356621    ...--DKNN...YVGLVNIPTA..........SVTGRQf.....VEKWYPVSTPT------pnkgktg..........
HGL_H00000381982    ...--GRST...LVGTYTINC-..........------......-----------------lkqflckpre.......
HGL_H00000381845    ...------...----------..........------......-----------------gkplalpvrtsykafst
HGL_H00000388091    ...--KKER...FIGLATVLLK..........PLVKK-......-----------------prev.............
HGL_H00000352208    ...--GRKP...VVGQCTIDRL..........D-----......-----------------rfrcdpya.........
HGL_H00000297239    ...GM-NDR...LLGGARLG--..........------......-----------------skg..............
HGL_H00000377473    ...--HVEE...SLGGAQISLA..........EVCRSGer....STRWYNLLSY-------kylk.............
HGL_H00000386183    ...--ERNS...YLGLVSLPAA..........SVAGRQf.....VEKWYPVVTPNP-----kggkgpgpmirikaryq
HGL_H00000303909    ...------...----------..........------......-----------------ktkvnkdnneivdkimg
HGL_H00000313601    ...F-KTDR...VLGTAQLKLD..........MLETA-......-----------------cevheilev........
HGL_H00000325012    ...---KK-...----------..........------......-----------------eellsygipikylrvfh
HGL_H00000369853    ...---SEG...PVAMVPLDLF..........RKQPSG......-PQSFTLTSG-------pglgstvlgsvtaefsy
HGL_H00000343325-2  ...-----G...LCALKFLKLE..........DFLDNEr.....HEVQLDMEPQ-------gcllaevtfhn......
HGL_H00000381982    ...--GKPE...YLGAT-----..........------......-----------------va...............
HGL_H00000385255    ...--GRYT...LVGSHAV---..........------......-----------------sslrrf...........
HGL_H00000334379    ...--DEER...VIGFASVDLS..........PLLSGFqf....ICGWYNITDFS------gecqgqikv........
HGL_H00000350649-2  ...--KEAD...FLGGMECTLG..........QIVSQR......-----------------klsksllkqgntagkss
HGL_H00000379227    ...--IIKR...FLGKLSMPVQ..........RLL---......-----------------er...............
HGL_H00000363443    ...------...----------..........------......-----------------lp...............
HGL_H00000260983    ...--IIKR...FLGKLTIPVQ..........RLLER-......-----------------q................
HGL_H00000266497    ...S-NSAE...LLAWTCLPLF..........PKEKS-......-----------------ilgsmlfsmtlqneppi
HGL_H00000340594    ...P-RKNR...VCCHGTVVLP..........------......-----------------tlfrvtrthqlavklep
HGL_H00000350649-2  ...------...----------..........------......-----------------l................
HGL_H00000388091    ...--GRQI...VLGQASVDFL..........------......-----------------qpyfcdpwardylppql
HGL_H00000388091    ...------...----------..........------......-----------------ilvqtdigfvyhspght
HGL_H00000400409    ...------...----------..........------......-----------------q................
HGL_H00000317257    ...--GSHD...LIGTFYTSLA..........QLQAVP......-----------------aefecihpekqqkkksy
HGL_H00000303058    ...S-SAKE...TVGYIVLDLR..........TAQETKq.....APKWHQLLSNK------ytkfkseiqisitletd
HGL_H00000291906    ...---WRQ...LCGVAFLRLE..........DFLDNAc.....HQLSLSLVPQGRL----fvqvtfcd.........
HGL_H00000262992    ...PEVGRS...FLGYASFKVG..........ELLKSKe.....QLLSLSLRTSDG-----gkvvgtieit.......
HGL_H00000074304    ...SQGTMY...LLGSGTFIVK..........DLLQDRh.....HRLHL------------tlrs.............
HGL_H00000400398    ...--FSPR...SLGTLVISLQ..........QLQSAGh.....L----------------virealvdknlqvspiq
HGL_H00000385255    ...--FSNK...LIGTFRMVLQ..........KVVEENh.....VEVTDTLIDDNNAVI--ktslnvevryqa.....
HGL_H00000400398    ...--GRTV...LVGSHIVP--..........------......-----------------hm...............
HGL_H00000334379    ...P-GQDK...LLGLVKLPLH..........------......-----------------qf...............
HGL_H00000354087    ...------...----------..........------......-----------------.................
HGL_H00000338885    ...--RDTE...LLGQATLPVG..........SPSRPLs.....RRQVCPLTPGPG-----kalgpaat.........
HGL_H00000398391    ...TRIERH...WLGCVKIPFS..........TIYFQGr.....IDGTFK-----------idt..............
HGL_H00000334379    ...--QTDS...WIGSAYVDLA..........RLGERSartlt.VSGVYPLFGR-------nasnlsgaalrvhv...
HGL_H00000348455-2  ...------...----------..........------......-----------------sldfgimpdrl......


                                                                                                    
                                                                                                    
d1v27a_               ..............................................................................
HGL_H00000418143    kyqtirkagkvhypvawvntmvfdfkgqlrsgdiilhswssfpdeleemlnpmgtvqtnpytenatalhikfpe....
HGL_H00000369257    fqlr..........................................................................
HGL_H00000356236    ..............................................................................
HGL_H00000391056    ..............................................................................
HGL_H00000391056    ..............................................................................
HGL_H00000353766    adcpiawanimlfdyrdqlktgerrlymwpsvpggawlrreprwggvvhgnpntesaaalviflp.............
HGL_H00000263846    ..............................................................................
HGL_H00000382895    hqavasehqtlaaawicfdkvletvekvhgsamltgaggedfgvleywvrlr..........................
HGL_H00000263967    lfdytdtlvsgkmalnlwpvphgledllnpigvtgsnpnksnr...................................
HGL_H00000358558    ..............................................................................
HGL_H00000346265    ..............................................................................
HGL_H00000356236    ..............................................................................
HGL_H00000324419-1  ..............................................................................
HGL_H00000228567-2  ..............................................................................
HGL_H00000361021-1  ffipgpeetsekvengslcdqeidsicsieradndkeylvltltkndldkankdkanryfspnfkvklyftk......
HGL_H00000171887    llkgdillkcyhkkfrspsrdvifrvqfhtcaihdlgvvfgkedldeafkddrfpeygkvefifsy............
HGL_H00000413254-1  ..............................................................................
HGL_H00000369257    ..............................................................................
HGL_H00000358558    iq............................................................................
HGL_H00000324419-1  ..............................................................................
HGL_H00000340914    ..............................................................................
HGL_H00000228567-2  ..............................................................................
HGL_H00000263431    ..............................................................................
HGL_H00000419260    spaetpgsesrgkaqllyyvnlllidhrfllrhgeyvlhmwqipgkgedqgsfnadkltsatnpdkensmsisilldn
HGL_H00000381854    llkgdvmvkcyhkkhhsatrdvvfrlqfhtgavrghslvlgkeeldgacgddrfpdygkvellfsat...........
HGL_H00000319756    tfpkdqldeawaderfpfqasvefvfss..................................................
HGL_H00000263846    gprfcrhwkdmiarprqpvaqwhql.....................................................
HGL_H00000316464    ..............................................................................
HGL_H00000284384    ..............................................................................
HGL_H00000357307    ..............................................................................
HGL_H00000413254-1  ..............................................................................
HGL_H00000413254-2  ..............................................................................
HGL_H00000369257    wfqlr.........................................................................
HGL_H00000395220    ..............................................................................
HGL_H00000352065    ..............................................................................
HGL_H00000340017-1  ..............................................................................
HGL_H00000382895    ..............................................................................
HGL_H00000340017-2  plerwhtlt.....................................................................
HGL_H00000362080    ..............................................................................
HGL_H00000340914    ..............................................................................
HGL_H00000356155    rvpealgwvttplfnfrqvltcgrkllglwpatqenpsarwsapnfhqpdsvilqidfp...................
HGL_H00000265970    pealgrvslplfdfkrfltcgtkllylwtsshtnpspgtipkkgcvmerivlqvdfps....................
HGL_H00000228567-1  ..............................................................................
HGL_H00000357307    ..............................................................................
HGL_H00000297239    ..............................................................................
HGL_H00000255224    ..............................................................................
HGL_H00000340017-2  ..............................................................................
HGL_H00000362080    ..............................................................................
HGL_H00000409572    ..............................................................................
HGL_H00000413254-2  ..............................................................................
HGL_H00000305355    ..............................................................................
HGL_H00000260323    geekvapyhi....................................................................
HGL_H00000347538    ..............................................................................
HGL_H00000380006    geekvapyhv....................................................................
HGL_H00000262940    ..............................................................................
HGL_H00000402861    ai............................................................................
HGL_H00000308957    ..............................................................................
HGL_H00000255224    ..............................................................................
HGL_H00000377520    ..............................................................................
HGL_H00000377612    ..............................................................................
HGL_H00000347538    ..............................................................................
HGL_H00000371394    ..............................................................................
HGL_H00000395220    ..............................................................................
HGL_H00000308957    ..............................................................................
HGL_H00000350377    lemdl.........................................................................
HGL_H00000361021-2  nmffipgpeetsekvengslcdqeidsicsteradndkeylvltltkndldksnkdkanryfspnfkvklsftk....
HGL_H00000396185-1  ..............................................................................
HGL_H00000264839    ..............................................................................
HGL_H00000285094    ..............................................................................
HGL_H00000374218    ..............................................................................
HGL_H00000228567-1  ..............................................................................
HGL_H00000402784    ..............................................................................
HGL_H00000374218    ..............................................................................
HGL_H00000350377    ..............................................................................
HGL_H00000361021-3  pvcgdikaeffhkegkmlkkdkmfrfwvnivfitgpeetseqvengslcdqeidsicsiehtdndkeylvltltkndl
HGL_H00000400409    geekvapyhvq...................................................................
HGL_H00000266505    ..............................................................................
HGL_H00000358200    tasmfdlsmkd...................................................................
HGL_H00000308957    p.............................................................................
HGL_H00000345988    ..............................................................................
HGL_H00000346265    ..............................................................................
HGL_H00000324419-2  ahwhslv.......................................................................
HGL_H00000371394    r.............................................................................
HGL_H00000347244    vrfd..........................................................................
HGL_H00000334105    ..............................................................................
HGL_H00000367747    ..............................................................................
HGL_H00000388756    ..............................................................................
HGL_H00000400409    hrilldtrfelpldipeeearywakkleq.................................................
HGL_H00000377612    ..............................................................................
HGL_H00000386881    ..............................................................................
HGL_H00000377612    ..............................................................................
HGL_H00000261729    ..............................................................................
HGL_H00000356155    ..............................................................................
HGL_H00000256832    flrlkmaympknggqde.............................................................
HGL_H00000370719    vrld..........................................................................
HGL_H00000020926    ..............................................................................
HGL_H00000400398    awrdafrpsqilaglcqrcglpapeyraeavkvgskvfltppetlptggggpqlangtseeaqallvlrrwqempelg
HGL_H00000306124-2  ..............................................................................
HGL_H00000244751    ..............................................................................
HGL_H00000290472    ..............................................................................
HGL_H00000338185    ..............................................................................
HGL_H00000316464    ..............................................................................
HGL_H00000331602    ..............................................................................
HGL_H00000265970    ..............................................................................
HGL_H00000362369    ..............................................................................
HGL_H00000329127    ..............................................................................
HGL_H00000361768-2  ..............................................................................
HGL_H00000389039    ..............................................................................
HGL_H00000363443    ..............................................................................
HGL_H00000381982    ..............................................................................
HGL_H00000373343    ..............................................................................
HGL_H00000385255    vwr...........................................................................
HGL_H00000386881    lpgaapmf......................................................................
HGL_H00000262650    l.............................................................................
HGL_H00000374195    ..............................................................................
HGL_H00000374195    ytedhvfssdyysplrdll...........................................................
HGL_H00000356436    le............................................................................
HGL_H00000324510    ..............................................................................
HGL_H00000352336    ..............................................................................
HGL_H00000279230    ..............................................................................
HGL_H00000382434    ..............................................................................
HGL_H00000394700    ..............................................................................
HGL_H00000264839    ..............................................................................
HGL_H00000352208    ..............................................................................
HGL_H00000352065    ..............................................................................
HGL_H00000324510    ..............................................................................
HGL_H00000377612    ssqicfpa......................................................................
HGL_H00000361942-1  ..............................................................................
HGL_H00000259406    ..............................................................................
HGL_H00000020926    ..............................................................................
HGL_H00000386881    ..............................................................................
HGL_H00000263125    ..............................................................................
HGL_H00000261729    ..............................................................................
HGL_H00000258098    nnlsasmfdlsikdk...............................................................
HGL_H00000380006    ..............................................................................
HGL_H00000400843    ..............................................................................
HGL_H00000340017-1  ..............................................................................
HGL_H00000198765    ..............................................................................
HGL_H00000388091    rwrdq.........................................................................
HGL_H00000361768-1  ..............................................................................
HGL_H00000260323    ..............................................................................
HGL_H00000352208    ..............................................................................
HGL_H00000290776    ..............................................................................
HGL_H00000352208    ..............................................................................
HGL_H00000388093    ..............................................................................
HGL_H00000388093    ..............................................................................
HGL_H00000381982    gdtlqt........................................................................
HGL_H00000371646    ..............................................................................
HGL_H00000402784    mqerppnh......................................................................
HGL_H00000290776    ..............................................................................
HGL_H00000360108    fiplnitvqgdvvvsvfhlrstigsrlqakvtntqilqlqfhsgfipldttvlkftkpeldacdvpekypqlfqvtld
HGL_H00000394700    ..............................................................................
HGL_H00000361942-2  ..............................................................................
HGL_H00000260402    ..............................................................................
HGL_H00000262435    pndndtvrgqivvslq..............................................................
HGL_H00000352208    ..............................................................................
HGL_H00000354621-1  npsdtdavrgqivvslq.............................................................
HGL_H00000316746    ..............................................................................
HGL_H00000262940    llp...........................................................................
HGL_H00000244751    ..............................................................................
HGL_H00000373343    ..............................................................................
HGL_H00000385255    ..............................................................................
HGL_H00000360431    ..............................................................................
HGL_H00000377612    ..............................................................................
HGL_H00000389039    ..............................................................................
HGL_H00000265428    enkngivqtgeltvvl..............................................................
HGL_H00000386881    pgd...........................................................................
HGL_H00000381982    ..............................................................................
HGL_H00000352208    tgde..........................................................................
HGL_H00000350377    ..............................................................................
HGL_H00000314499    viplgitvqgdvliviyharstlggrlqakmasmkmfqiqfhtgfvprnattvkfakydldacdiqekypdlfqvnle
HGL_H00000262940    ..............................................................................
HGL_H00000400398    ..............................................................................
HGL_H00000198765    ..............................................................................
HGL_H00000381982    ..............................................................................
HGL_H00000216775    ..............................................................................
HGL_H00000385255    ppqleyyqiyrgnatagdllaafel.....................................................
HGL_H00000388091    ..............................................................................
HGL_H00000386881    ..............................................................................
HGL_H00000386881    ..............................................................................
HGL_H00000385255    ..............................................................................
HGL_H00000352208    ..............................................................................
HGL_H00000216775    ..............................................................................
HGL_H00000317214    qghisfkv......................................................................
HGL_H00000400398    ..............................................................................
HGL_H00000377520    ..............................................................................
HGL_H00000274376    ysmekimpeeeysefkelilq.........................................................
HGL_H00000317257    ..............................................................................
HGL_H00000264554    ..............................................................................
HGL_H00000374218    eerelgspytg...................................................................
HGL_H00000400398    rgdlppplpp....................................................................
HGL_H00000360642    ..............................................................................
HGL_H00000398577    ..............................................................................
HGL_H00000387882    ..............................................................................
HGL_H00000385255    plvsifkqkrvkgwwplla...........................................................
HGL_H00000388091    ..............................................................................
HGL_H00000313731    ihvc..........................................................................
HGL_H00000331342    nmtasmfdlsmkd.................................................................
HGL_H00000380006    tphkilldtrfelpydipeeearywtykleq...............................................
HGL_H00000348283    ..............................................................................
HGL_H00000303507    ..............................................................................
HGL_H00000387882    ..............................................................................
HGL_H00000400398    ..............................................................................
HGL_H00000261729    ll............................................................................
HGL_H00000266497    ..............................................................................
HGL_H00000370242    ..............................................................................
HGL_H00000388091    ..............................................................................
HGL_H00000386881    ..............................................................................
HGL_H00000356621    ..............................................................................
HGL_H00000381982    ..............................................................................
HGL_H00000381845    rwnmfrqgmhdlkvwpnveadgseptktpgrt..............................................
HGL_H00000388091    ..............................................................................
HGL_H00000352208    ..............................................................................
HGL_H00000297239    ..............................................................................
HGL_H00000377473    ..............................................................................
HGL_H00000386183    ..............................................................................
HGL_H00000303909    kgqi..........................................................................
HGL_H00000313601    ..............................................................................
HGL_H00000325012    py............................................................................
HGL_H00000369853    tepgepkalha...................................................................
HGL_H00000343325-2  ..............................................................................
HGL_H00000381982    ..............................................................................
HGL_H00000385255    ..............................................................................
HGL_H00000334379    ..............................................................................
HGL_H00000350649-2  i.............................................................................
HGL_H00000379227    ..............................................................................
HGL_H00000363443    ..............................................................................
HGL_H00000260983    ..............................................................................
HGL_H00000266497    emiapgvwdgsqpgpvtlqidfp.......................................................
HGL_H00000340594    rgliyvkvtlme..................................................................
HGL_H00000350649-2  ..............................................................................
HGL_H00000388091    ptlsmkkhqkvlgflyekfwfk........................................................
HGL_H00000388091    llrkwlglcqpnapssgvrgylkvticalgvg..............................................
HGL_H00000400409    ..............................................................................
HGL_H00000317257    knsgticv......................................................................
HGL_H00000303058    tkapvd........................................................................
HGL_H00000291906    ..............................................................................
HGL_H00000262992    ..............................................................................
HGL_H00000074304    ..............................................................................
HGL_H00000400398    veld..........................................................................
HGL_H00000385255    ..............................................................................
HGL_H00000400398    ..............................................................................
HGL_H00000334379    ..............................................................................
HGL_H00000354087    ..............................................................................
HGL_H00000338885    ..............................................................................
HGL_H00000398391    ..............................................................................
HGL_H00000334379    ..............................................................................
HGL_H00000348455-2  ..............................................................................


                                                        
                                                        
d1v27a_               ..................................
HGL_H00000418143    ..................................
HGL_H00000369257    ..................................
HGL_H00000356236    ..................................
HGL_H00000391056    ..................................
HGL_H00000391056    ..................................
HGL_H00000353766    ..................................
HGL_H00000263846    ..................................
HGL_H00000382895    ..................................
HGL_H00000263967    ..................................
HGL_H00000358558    ..................................
HGL_H00000346265    ..................................
HGL_H00000356236    ..................................
HGL_H00000324419-1  ..................................
HGL_H00000228567-2  ..................................
HGL_H00000361021-1  ..................................
HGL_H00000171887    ..................................
HGL_H00000413254-1  ..................................
HGL_H00000369257    ..................................
HGL_H00000358558    ..................................
HGL_H00000324419-1  ..................................
HGL_H00000340914    ..................................
HGL_H00000228567-2  ..................................
HGL_H00000263431    ..................................
HGL_H00000419260    yc................................
HGL_H00000381854    ..................................
HGL_H00000319756    ..................................
HGL_H00000263846    ..................................
HGL_H00000316464    ..................................
HGL_H00000284384    ..................................
HGL_H00000357307    ..................................
HGL_H00000413254-1  ..................................
HGL_H00000413254-2  ..................................
HGL_H00000369257    ..................................
HGL_H00000395220    ..................................
HGL_H00000352065    ..................................
HGL_H00000340017-1  ..................................
HGL_H00000382895    ..................................
HGL_H00000340017-2  ..................................
HGL_H00000362080    ..................................
HGL_H00000340914    ..................................
HGL_H00000356155    ..................................
HGL_H00000265970    ..................................
HGL_H00000228567-1  ..................................
HGL_H00000357307    ..................................
HGL_H00000297239    ..................................
HGL_H00000255224    ..................................
HGL_H00000340017-2  ..................................
HGL_H00000362080    ..................................
HGL_H00000409572    ..................................
HGL_H00000413254-2  ..................................
HGL_H00000305355    ..................................
HGL_H00000260323    ..................................
HGL_H00000347538    ..................................
HGL_H00000380006    ..................................
HGL_H00000262940    ..................................
HGL_H00000402861    ..................................
HGL_H00000308957    ..................................
HGL_H00000255224    ..................................
HGL_H00000377520    ..................................
HGL_H00000377612    ..................................
HGL_H00000347538    ..................................
HGL_H00000371394    ..................................
HGL_H00000395220    ..................................
HGL_H00000308957    ..................................
HGL_H00000350377    ..................................
HGL_H00000361021-2  ..................................
HGL_H00000396185-1  ..................................
HGL_H00000264839    ..................................
HGL_H00000285094    ..................................
HGL_H00000374218    ..................................
HGL_H00000228567-1  ..................................
HGL_H00000402784    ..................................
HGL_H00000374218    ..................................
HGL_H00000350377    ..................................
HGL_H00000361021-3  dkankdksnqydspnfkvkpyftk..........
HGL_H00000400409    ..................................
HGL_H00000266505    ..................................
HGL_H00000358200    ..................................
HGL_H00000308957    ..................................
HGL_H00000345988    ..................................
HGL_H00000346265    ..................................
HGL_H00000324419-2  ..................................
HGL_H00000371394    ..................................
HGL_H00000347244    ..................................
HGL_H00000334105    ..................................
HGL_H00000367747    ..................................
HGL_H00000388756    ..................................
HGL_H00000400409    ..................................
HGL_H00000377612    ..................................
HGL_H00000386881    ..................................
HGL_H00000377612    ..................................
HGL_H00000261729    ..................................
HGL_H00000356155    ..................................
HGL_H00000256832    ..................................
HGL_H00000370719    ..................................
HGL_H00000020926    ..................................
HGL_H00000400398    iqlvpehvetrplyhprnpgllqgslhmwidifp
HGL_H00000306124-2  ..................................
HGL_H00000244751    ..................................
HGL_H00000290472    ..................................
HGL_H00000338185    ..................................
HGL_H00000316464    ..................................
HGL_H00000331602    ..................................
HGL_H00000265970    ..................................
HGL_H00000362369    ..................................
HGL_H00000329127    ..................................
HGL_H00000361768-2  ..................................
HGL_H00000389039    ..................................
HGL_H00000363443    ..................................
HGL_H00000381982    ..................................
HGL_H00000373343    ..................................
HGL_H00000385255    ..................................
HGL_H00000386881    ..................................
HGL_H00000262650    ..................................
HGL_H00000374195    ..................................
HGL_H00000374195    ..................................
HGL_H00000356436    ..................................
HGL_H00000324510    ..................................
HGL_H00000352336    ..................................
HGL_H00000279230    ..................................
HGL_H00000382434    ..................................
HGL_H00000394700    ..................................
HGL_H00000264839    ..................................
HGL_H00000352208    ..................................
HGL_H00000352065    ..................................
HGL_H00000324510    ..................................
HGL_H00000377612    ..................................
HGL_H00000361942-1  ..................................
HGL_H00000259406    ..................................
HGL_H00000020926    ..................................
HGL_H00000386881    ..................................
HGL_H00000263125    ..................................
HGL_H00000261729    ..................................
HGL_H00000258098    ..................................
HGL_H00000380006    ..................................
HGL_H00000400843    ..................................
HGL_H00000340017-1  ..................................
HGL_H00000198765    ..................................
HGL_H00000388091    ..................................
HGL_H00000361768-1  ..................................
HGL_H00000260323    ..................................
HGL_H00000352208    ..................................
HGL_H00000290776    ..................................
HGL_H00000352208    ..................................
HGL_H00000388093    ..................................
HGL_H00000388093    ..................................
HGL_H00000381982    ..................................
HGL_H00000371646    ..................................
HGL_H00000402784    ..................................
HGL_H00000290776    ..................................
HGL_H00000360108    ve................................
HGL_H00000394700    ..................................
HGL_H00000361942-2  ..................................
HGL_H00000260402    ..................................
HGL_H00000262435    ..................................
HGL_H00000352208    ..................................
HGL_H00000354621-1  ..................................
HGL_H00000316746    ..................................
HGL_H00000262940    ..................................
HGL_H00000244751    ..................................
HGL_H00000373343    ..................................
HGL_H00000385255    ..................................
HGL_H00000360431    ..................................
HGL_H00000377612    ..................................
HGL_H00000389039    ..................................
HGL_H00000265428    ..................................
HGL_H00000386881    ..................................
HGL_H00000381982    ..................................
HGL_H00000352208    ..................................
HGL_H00000350377    ..................................
HGL_H00000314499    v.................................
HGL_H00000262940    ..................................
HGL_H00000400398    ..................................
HGL_H00000198765    ..................................
HGL_H00000381982    ..................................
HGL_H00000216775    ..................................
HGL_H00000385255    ..................................
HGL_H00000388091    ..................................
HGL_H00000386881    ..................................
HGL_H00000386881    ..................................
HGL_H00000385255    ..................................
HGL_H00000352208    ..................................
HGL_H00000216775    ..................................
HGL_H00000317214    ..................................
HGL_H00000400398    ..................................
HGL_H00000377520    ..................................
HGL_H00000274376    ..................................
HGL_H00000317257    ..................................
HGL_H00000264554    ..................................
HGL_H00000374218    ..................................
HGL_H00000400398    ..................................
HGL_H00000360642    ..................................
HGL_H00000398577    ..................................
HGL_H00000387882    ..................................
HGL_H00000385255    ..................................
HGL_H00000388091    ..................................
HGL_H00000313731    ..................................
HGL_H00000331342    ..................................
HGL_H00000380006    ..................................
HGL_H00000348283    ..................................
HGL_H00000303507    ..................................
HGL_H00000387882    ..................................
HGL_H00000400398    ..................................
HGL_H00000261729    ..................................
HGL_H00000266497    ..................................
HGL_H00000370242    ..................................
HGL_H00000388091    ..................................
HGL_H00000386881    ..................................
HGL_H00000356621    ..................................
HGL_H00000381982    ..................................
HGL_H00000381845    ..................................
HGL_H00000388091    ..................................
HGL_H00000352208    ..................................
HGL_H00000297239    ..................................
HGL_H00000377473    ..................................
HGL_H00000386183    ..................................
HGL_H00000303909    ..................................
HGL_H00000313601    ..................................
HGL_H00000325012    ..................................
HGL_H00000369853    ..................................
HGL_H00000343325-2  ..................................
HGL_H00000381982    ..................................
HGL_H00000385255    ..................................
HGL_H00000334379    ..................................
HGL_H00000350649-2  ..................................
HGL_H00000379227    ..................................
HGL_H00000363443    ..................................
HGL_H00000260983    ..................................
HGL_H00000266497    ..................................
HGL_H00000340594    ..................................
HGL_H00000350649-2  ..................................
HGL_H00000388091    ..................................
HGL_H00000388091    ..................................
HGL_H00000400409    ..................................
HGL_H00000317257    ..................................
HGL_H00000303058    ..................................
HGL_H00000291906    ..................................
HGL_H00000262992    ..................................
HGL_H00000074304    ..................................
HGL_H00000400398    ..................................
HGL_H00000385255    ..................................
HGL_H00000400398    ..................................
HGL_H00000334379    ..................................
HGL_H00000354087    ..................................
HGL_H00000338885    ..................................
HGL_H00000398391    ..................................
HGL_H00000334379    ..................................
HGL_H00000348455-2  ..................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0044591 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Flexibacter litoralis DSM 6794
NoYes   Isosphaera pallida ATCC 43644
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Corallococcus coralloides DSM 2259
NoYes   Shewanella violacea DSS12
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Sorangium cellulosum So0157-2
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]