SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Ecotin, trypsin inhibitor alignments

These alignments are sequences aligned to the 0053579 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                  10        20        30        40        50        
                                                   |         |         |         |         |        
d1ezsa_                              .....PYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGAAA
E4O_gi|501680575|ref|YP_008000401.1| ledtaPYPKAEDGFTRQVIHLPKQQHEDRYKVEILAGKTLTVDCNLQRLGGKLLEKNLEGWGY


                                     60        70        80        90       100       110       120 
                                      |         |         |         |         |         |         | 
d1ezsa_                              AYYVFDKVSSPVSTRMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKA
E4O_gi|501680575|ref|YP_008000401.1| PYYRLDQVSGPISTRMACPDGKTREDFV-PVTGDGFVLRYNSKLPIVIYAPKDVEVRYRLWSA


                                           130  
                                             |  
d1ezsa_                              EEKIDNAVV-r
E4O_gi|501680575|ref|YP_008000401.1| ADKTENAR--q


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053579 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Caenorhabditis japonica
NoYes   Sorghum bicolor - Sorghum
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechococcus sp. CC9311
NoYes   Pedobacter saltans DSM 12145
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Sulfurovum sp. NBC37-1
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Herminiimonas arsenicoxydans
NoYes   Janthinobacterium sp. Marseille
NoYes   Methylobacillus flagellatus KT
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Cyanobium gracile PCC 6307
NoYes   Synechococcus sp. WH 7803
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Sorangium cellulosum So0157-2
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Rickettsia bellii RML369-C
NoYes   Rickettsia canadensis str. CA410
NoYes   Rickettsia slovaca str. D-CWPP
NoYes   Rickettsia massiliae str. AZT80
NoYes   Rickettsia rickettsii str. Arizona
NoYes   Rickettsia rickettsii str. Brazil
NoYes   Rickettsia rickettsii str. Hauke
NoYes   Rickettsia rickettsii str. Colombia
NoYes   Rickettsia rickettsii str. Hlp#2
NoYes   Rickettsia rickettsii str. Hino
NoYes   Rickettsia rickettsii str. Iowa
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Alcanivorax dieselolei B5
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_050719N (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]