SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Concanavalin A-like lectins/glucanases alignments in Sus scrofa 76_10.2

These alignments are sequences aligned to the 0044555 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1ux6a1               ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000015013  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000014796  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000014907  ykapvptgevyfadsfdrgtlsgwilskakkddtddeiakydgkwevdemketklpgdkglvllsrakhhaistklnk
ENSSSCP00000005280  hrrfeykysfkgphlvqsdgtvpfwayagnaipssdqiriapslksqrgsvwtkakaafenwevevtfrvtgrgriga
ENSSSCP00000024403  wkkatlhavdvtldpdtahphlflyedsksvrledsrqklpekperfdswpcvlgretftsgrh..............
ENSSSCP00000001201  wkkatlhavdvtldpdtahphlflyedsksvrledsrqklpekperfdswpcvlgretftsgrh..............
ENSSSCP00000029440  wkkatlhavdvtldpdtahphlflyedsksvrledsrqklpekperfdswpcvlgretftsgrh..............
ENSSSCP00000001416  rkilkqliadvtldpetahpnlvlsedrksvkfvetrlrdlpdtprrftfypcvlategftsgrhywevevgdkthwa
ENSSSCP00000029869  rkilkqliadvtldpetahpnlvlsedrksvkfvetrlrdlpdtprrftfypcvlategftsgrhywevevgdkthwa
ENSSSCP00000030828  rkilkqliadvtldpetahpnlvlsedrksvkfvetrlrdlpdtprrftfypcvlategftsgrhywevevgdkthwa
ENSSSCP00000026179  ktpqplgevyftetfdsgrlagwvlskakkddtdaeisiydgrweieelkenrvpgdrgl..................
ENSSSCP00000014929  hlkrehslikpyqgvgssstlfwdfqgstiltsqylrltpderskegsiwnhlpcflkdwemhvhfkvhgagkknlhg
ENSSSCP00000029385  lreaqlysvdvtldpdtaypslilsdnlrqvrysylqqdlpdnperfnlfpcvlgspcfiagrhywevevgdkakwti
ENSSSCP00000001288  lreaqlysvdvtldpdtaypslilsdnlrqvrysylqqdlpdnperfnlfpcvlgspcfiagrhywevevgdkakwti
ENSSSCP00000024192  ikpqrgvgtgssslwnlmgnamvmtqyirltpdmqskqgalwnrvpcflrdwelqvhfrihgqgkknlhgdglaiwyt
ENSSSCP00000015699  krmlrsyavhitldpltaspwlvlsenrrqvrlgetrqevpeneerfdtypmvlgaqhfnsgkhywevdvagkeawdl
ENSSSCP00000001200  wrrsllhaadvvldpdtahpelflsedrrrvrrgpsrqsvpdnperfdcqpcvlglesfssgrhywevevenvmvwav
ENSSSCP00000008754  eylkrehslskpyqgvgtgssslwnlmgnamvmtqyirltpdmqskqgalwnrvpcflrdwelqvhfrihgqgkknlh
ENSSSCP00000015688  reilktfaadvrldpdtaysrlivsedrngvrygdtkqklpdnperfyrynivlgsqcissgrhywevevgdrsewgl
ENSSSCP00000029029  wrkeffqavtitldpdtahpslvlsegnrrvtwgeksqdlpenpqrfysfpcv.........................
ENSSSCP00000014840  mremlrkfqvdikldpatahpsllltadlrsvqdgelwkdvpnnperfdtwpcvlglqnfssgrhywevvvgeraewg
ENSSSCP00000021212  parldqlldmpaaglavqlrhawnpedrslnvfvkdddrltfhrhpvaqstdgirgkvgharglhawqihwparqrgt
ENSSSCP00000014732  atiyfqeefldgerwrnrwvqssndsqfghfrlssgkfyghkekdkglqttqnsrfyaisarfkpfsnkgknliiqyt
ENSSSCP00000003582  prirklqvdvtldadtankqliisedlktvhcgllkqkkeacperfsdtlcvlglprftsgrhywevdvessrewdvg
ENSSSCP00000005042  lspltldpktahpnlvlsknrtsvwhgdikqvmpddperfdssvavlgskgftsgkwywevev...............
ENSSSCP00000009237  rkeefeaanvtldeatahpallvsergrrvtwqetcqdlpsstqrfnsipcvlgqlrinsgraywevevgdmqswdlg
ENSSSCP00000006271  wrdaplypanvtldeatahpallvsergrrvtwqetcqdlprstqrfnsipcvlgqlrinsgraywevevgdmqswdl
ENSSSCP00000006272  wrkevfeaanvtldeatahpallmseggrrvtwqetcqdlpnstqrfnsipcvlgqlrinsgraywevevgdmqswdl
ENSSSCP00000009236  rkeefeaanvtldeatahpallvsergrqvtwqetcqdlpsstqrfnsipcvlgqlrinsgrahwevevgdmqswdlg
ENSSSCP00000007533  tnvtldeatahpallvsergrrvtwqetcqdlprstqrfnsipcvlgqlrinsgraywevevgdmqswdlgicrdnv.
ENSSSCP00000014615  tiyfkeqfldgdgwtdrwieskhkpdfgrfvlssgkfygdqekdkglqtsqdarfyals...................
ENSSSCP00000022095  wrsarlhfvavtldpdtahpklilsgdrrcvklgdtrqpvldnpqrfdfvvsilgsehftagchywevsvadkskwal
ENSSSCP00000027530  rkeefkavnvildaatahpalllskngrrvtwkgtgqdlprstqrfnsipyvlghlsicsgkshwevevgnascwdlg
ENSSSCP00000024940  wraaqqyavevtldpgs.............................................................
ENSSSCP00000002077  qrrfeyklsfkgprlalpgagipfwshhgdailgleevrlapsmrnrsgavwsrtpvlfpawevevqmrvtgpgrlga
ENSSSCP00000023787  qrrfeyklsfkgprlalpgagipfwshhgdailgleevrlapsmrnrsgavwsrtpvlfpawevevqmrvtgpgrlga
ENSSSCP00000004776  sdeylkfweditldpatansflvfsedlrsiqygkiyqnlmedpqrfdywagvlgtpcfvsgchywevevgegnewal
ENSSSCP00000021310  sdeylkfweditldpatansflvfsedlrsiqygkiyqnlmedpqrfdywagvlgtpcfvsgchywevevgegnewal
ENSSSCP00000004184  dgwkkqwveskhrpdygkfqlvqedfygdeekdkglqtsedakfyalstfsnenetlvvqfsvkyeqgid........
ENSSSCP00000003925  dihpvpaaltldpgtahqrlilsddctivaygnlhpqplqdspkrfdvevsvlgseafssgvhywevvvaektqwvig
ENSSSCP00000027015  tpqplypdlscpegleellsapppdlgaqrrhgwnpkdcsenievkegglcferrpvaqstdgvrgkrgysrglhawe
ENSSSCP00000008227  rkvlpapeslkldpttahpllelskgntvvqcgllaqrrasqperfdystcvlasrgfscgrhywevvvgsksdwrlg
ENSSSCP00000005767  rslflkyartptlepdtmharlrlsadrltvrcglfgrlgptptlcfdslwqvlgrdcfaagrhywevdvqeagigww
ENSSSCP00000024925  vkvildyntahnkvalsqnftvasaadtsqdyqphpqrftycsqvlglhcykkgihywevelqknnfcgvgvcygsmp
ENSSSCP00000018810  pymnpmvpftgmiqgglqdglqitingtvlmssgsrftvnl.....................................
ENSSSCP00000014885  evlknfqedvmpdpttaypylllyesrqrrylstpvdgtacgkdrflaypcvvgqetfssgrhywevgmnltgdalwa
ENSSSCP00000028656  td............................................................................
ENSSSCP00000030393  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfidsgrhywevvi........
ENSSSCP00000030993  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfidsgrhywevvi........
ENSSSCP00000012889  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfidsgrhywevvi........
ENSSSCP00000029279  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfidsgrhywevvi........
ENSSSCP00000030659  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfidsgrhywevvi........
ENSSSCP00000005403  hfnstynarikafnktgvsqysktlvlqtsevawfafdpgsahsdiifsndnltvtcssyddrvvlgktgfskgvhyw
ENSSSCP00000001314  vtldpltaspslvlsedrksvrytrqkqnlpdsplrfeglpvvlgspgfssgrhrwqvevqlgegggctvgvvgeevr
ENSSSCP00000009454  kiaqkftedvildpetahpnllvsedrksatfmrmrqmvlkagrfrlepavlgsvgfghgrrywevrvdgat......
ENSSSCP00000001560  wrkeqfkamavtldpntahrnlslsengksftenvppngdtpalqdqgasedilnvlgqecpsagrhywevevkaktd
ENSSSCP00000001564  wrkeqfkamavtldpntahrnlslsengksftenvppngdtpalqdqgasedilnvlgqecpsagrhywevevkaktd
ENSSSCP00000023159  thvqcyweditldpfnlnlnlvlsedqrqvisvpiwpvkcynygvlgsqyfssgkhy.....................
ENSSSCP00000028586  wrkeqfkamavtldpntahrnlslsengksftenvppngdtpalqdqgasedilnvlgqecpsagrhywevevkaktd
ENSSSCP00000021328  veimnmdm......................................................................
ENSSSCP00000021030  thvqcyweditldpfnlnl...........................................................
ENSSSCP00000001553  wrtekfqprpvtldpgsaasslvvthektsvtrkntgvnpgdmdsvlgfedissgrwyweveikdgdgcewa......
ENSSSCP00000015601  thvqcyweditldpfnlnlnlvlsedqrqvisvpiwpvkcynygvlgsqyfssgkhy.....................
ENSSSCP00000001716  dntchfedekicgytqdltdnfdwtrqnaltqnpkrspntgpptdisgtpegyymfietsrprelgdrarlvsplyna
ENSSSCP00000019609  ilxlsldlksvrlgqraqdlpshprrfdtntrvlascgfssgrhhwevevgskdgwafgvaresvrrkgltpftpeeg
ENSSSCP00000022993  ilxlsldlksvrlgqraqdlpshprrfdtntrvlascgfssgrhhwevevgskdgwafgvaresvrrkgltpftpeeg
ENSSSCP00000001312  epahisldpqtshpklllsednqqarfsykwqnspdnpqrfdratcvlahsgftegrhtwvv................
ENSSSCP00000029343  mlerlnnfqvdvtlddkiqnchvaliedmrrlrcrpdhgdtprnpasseytpswgaqtftsgkhywevdvglscnwii
ENSSSCP00000015849  mldmlnnfraenvlsqkmsihsvrlsedeasvvfeddpqgasseppseerfvawgaqaftsgrhywevdvtrssnwil
ENSSSCP00000005434  nvpydlplpggvmprmlitilgtvkpnanrla..............................................
ENSSSCP00000030635  nvpydlplpggvmprmlitilgtvkpnanrla..............................................
ENSSSCP00000019990  gyryilaepdphapdpekleldcwagkpipgdlyraclyervllalhdrapqlkisddrltvvgekgysmvrashgvr
ENSSSCP00000021698  hetplprswspkdkynyiglsqgnlrvhykghgknhkdaasvrathpipaacgiyyfevkivskgrdgymgig.....
ENSSSCP00000025036  avawfafdpgsahsdiifsndnltvtcssyddrvvlgktgfskgvhyweltvdrydnhpdpafgvaridvm.......
ENSSSCP00000018810  pipffasipgglypsksimvsgtilpsaqsfyinlrsgsdiafhlnprfkenavvrntqigsswgpeerglprkmpfs
ENSSSCP00000015851  mldmlnnfraenvlsqkmsihsvrlsedeasvvfeddpqgasseppseerfvawgaqaftsgrhywevdvtrssnwil
ENSSSCP00000013361  rlktnsqpfkldpkmthkklkisndglqmekdesslkkshtperfsgtgcygaagnifidsgchywevvmgsstwyai
ENSSSCP00000009456  kmittfqeyltldagtahnslfitkdrktatfqrmklncfynpqaftshpavlgsegfnagrhfwqvegrglgewslg
ENSSSCP00000018791  faqwaisptfdlgslscslevsedhrtvtvshypqsypwsperfascqvlgsqgfssgqrywevdtqrcshwavgvas
ENSSSCP00000010821  iynpiipyvgtiseqlepgtlivlrghvpsdsdrfqvdlqcgnsvkpradvafhfnprfkrancivcntlknek....
ENSSSCP00000000129  vasnlnlkpgeclkvrgevapdaksfvlnlgkdsnnlclhfnprfdmhgdintivcnskdggawga............
ENSSSCP00000011201  vcqclpgfggpecekllsvnfvdrdtylqftdlqnwpranitlqvstaedngillyng....................
ENSSSCP00000015852  nvhevdvtlddkiqnchvaliedmrrlrcrpdhgdtprnpasseytpswgaqtftsgkhywevdvglscnwiiglcke
ENSSSCP00000017851  pcahggscrprkegyecdcplgfeglhcqkaiteaieipqfigrsyltydnpailkrvsgsrsnafmrfkttakdgll
ENSSSCP00000009455  kmistfqdhltldaetahrslvisqdgktatfqtrgpnrarkskaftshpsvlgsegfdagrhfwqvegrglgewslg
ENSSSCP00000012112  ggfrcqcpaggafegprcevaarsfppssfvmfrglrqrfhltlslsfatvqpsgllfyngrlnekhdflalelvagq
ENSSSCP00000006826  tdmigkafvfpkesensyvsltarltkpltaftvclrvytdlnrdyslfsyatktqyneillfrgktavysisvggad
ENSSSCP00000029570  tdmigkafvfpkesensyvsltarltkpltaftvclrvytdlnrdyslfsyatktqyneillfrgktavysisvggad
ENSSSCP00000018163  qltfplrtnymyakvkkslpe.........................................................
ENSSSCP00000005380  efhcgfedgniclftqddtdnfdwtkqstatrntkytpntgpnadrsgskegfymyietsrprlegekarllspvfsi
ENSSSCP00000000853  idvltelelgesttgvrqvpglhngtkaflfqdtprsikastataeqffqklrnkheftvlvtlkqthlnsgvilsih
ENSSSCP00000009453  kmistfqeyltldaetahgslilsqdgktatfqslepnhvhnpkaftshpavlgsegfdagrhfwqvegrglgelslg
ENSSSCP00000008124  ktlpelyafticlwlrssaspgigtpfsyavpgqaneivliewgnnpiellindkvaqlplfvsdgkwhhicvt....
ENSSSCP00000025878  istfqeyltldaetahcsliisqdgktatfqglepnsvhkskaftshpavlgsegfnagrhfwqvegrglvewslgvc
ENSSSCP00000026387  gfsmphktlladgirvgtvmrirgvvpdqagrfyvnllcgeepgseaalhfnprldessvvfnslehgaw........
ENSSSCP00000019654  dlhkkafvfpqesdnsyvslkaqlkkplkaftvclhiyselastrgysvfsyatkkqpneilifwskgrgyilgvrgt
ENSSSCP00000024906  tcrchlgrsgrrceegvtvttpsmsgtgsylalpaltnthhelrldvefkplapdgilvfsggqsgpvedfvslamvg
ENSSSCP00000015599  tdvrrywvhvtlnnlkiksdvtisvdrrqvryarkfglsstcpngdfedcsvlgyplissgkhywevdvsgkrawilg
ENSSSCP00000024988  mdwlhqfqvyfasdketvtrhvpvfedlqrwlsgpdrpgvdntptrlkyflawgaesftsgqhywevnmagccnw...
ENSSSCP00000024616  mdwlhqfqvyfasdketvtrhvpvfedlqrwlsgpdrpgvdntptrlkyflawgaesftsgqhywevnmagccnw...
ENSSSCP00000021918  mdwlhqfqvyfasdketvtrhvpvfedlqrwlsgpdrpgvdntptrlkyflawgaesftsgqhywevnmagccnw...
ENSSSCP00000009325  icqclpgyqgekceklvsvnfvnkesylqipsakvrpqtnitlqiatdedsgillykgdkdhiavelyrgrvrasy..
ENSSSCP00000022455  pcahggscrprkegyecdcplgfeglhcqkecgnyclntiteaieipqfigrsyltydnpailkrvsgsrsnafmrfk
ENSSSCP00000010821  qftlpfvarlnspmgpgrtivikgevntnakgfnvdllsg......................................
ENSSSCP00000001973  fhlnehtchpwltisedgltvvrserrapasellssdtrftrcvavmgnlipvrgrhywevevdecldy.........
ENSSSCP00000017851  twggsrchcnlgkggescsediviqypqffghsyvtfepl......................................
ENSSSCP00000022455  twggsrchcnlgkggescsediviqypqffghsyvtfepl......................................
ENSSSCP00000013885  pvvpyvttifgglragkmvqlqgvvpldarrfqvdfqcgcslhprpdiaihfnprfhttkphvicntlqg........
ENSSSCP00000006160  padllkvldfhnlpdgitkttgfcaarrsskgpdvayrvtkdaqlsaptkqlypasafpedfsilttvkakkgsqafl
ENSSSCP00000023414  mgwleqfqvyfasdketvtrhvpvfedlqrwlsgpdcpgvdytptrlkyflawgaesftsgqhywevnvagc......
ENSSSCP00000029303  fralmpamqeltfdpstahpslvlsasgrrvecseqkappagedprqfdkavavvthqllsegehywevevgdkprwa
ENSSSCP00000008285  fralmpamqeltfdpstahpslvlsasgrrvecseqkappagedprqfdkavavvthqllsegehywevevgdkprwa
ENSSSCP00000024906  rclcppgfsgprcqqgsvhgiaesdwhlegsggndapgqygayfyddgflalpgrvfsrslpevpetielevrtstas
ENSSSCP00000005158  svfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavraekgflllaslrqmkktrgtlla
ENSSSCP00000029039  spvdvlralrfpslpdgvrrtrgicpadvayrvsrpaqlsaptrqlfpggfpkdfslltavrtrpglqaplltlysaq
ENSSSCP00000018428  aryirivplawnprgkiglrlgiygcpyksdvlyfdgddaisyrfprgvsrslwdvfafsfkteekdglllhaegaqg
ENSSSCP00000006832  kdlrgkvfifpeesntahvslvprvnnplknftlclkaftdltrpyslfsyntrstdnelllfvnkvgeyily.....
ENSSSCP00000006161  padllkvldfhnlpdgitkttgfcaarrsskgpdvayrvtkdaqlsaptkqlypasafpedfsilttvkakkgsqafl
ENSSSCP00000018218  rrklwqnyrnltfdpisanrhlylsqqdqqvkhcrkpqgpdgpdsfelwqvqcaqsfqagrhywevrasshsvtlgv.
ENSSSCP00000018024  tcrcppgfagprceklitvnfvgkdsyvelasakvrpqanislqvatdkdngillykgdndp................
ENSSSCP00000001598  spvdvlralrfpslpdgvrrtrgicpadvayrvsrpaqlsaptrqlfpggfpkdfslltavrtrpglqaplltlysaq
ENSSSCP00000030976  spvdvlralrfpslpdgvrrtrgicpadvayrvsrpaqlsaptrqlfpggfpkdfslltavrtrpglqaplltlysaq
ENSSSCP00000011839  tygfncefgwgshktfchwehdshvqlkwsvltsktgpiqdhtagdgnfiys..........................
ENSSSCP00000030667  eelkaaltpvtldaasahpdliisqdlktvtldpvpqsrcaeptdparfhpfrcvlglpglssgcqtweaelegpegg
ENSSSCP00000001317  eelkaaltpvtldaasahpdliisqdlktvtldpvpqsrcaeptdparfhpfrcvlglpglssgcqtweaelegpegg
ENSSSCP00000003232  ytkhvslpvgssvt................................................................
ENSSSCP00000013851  ymdqckdgditycelnarfglraivadpvtfksrssylalatlqayasmhlffqfkttapdglllfnsgngndfivie
ENSSSCP00000023132  syeclcpggfsglhcekglieksagdldalafdgrtyveylnavtesekalqsnhfelslrteatqglvlwsgkater
ENSSSCP00000016666  rfirfvplewnpsgkigmrvevygcsyksdvadfdgrssllyrfnqklmstlkdvislkfksmqgdgvlfhgegqrgd
ENSSSCP00000004335  tafdlfsvsninrktigakqfrgpdpsvpayrfvrfdyippvgaeplgriaeamrrkegffltaslkqdrksrgtlla
ENSSSCP00000019848  yngvdiidlakqqnpqiiimgnvsfscsqpqsvpvtflsprsylalpgasredevsatfqfrtwnkaglllfselqlv
ENSSSCP00000010319  cvesvpfsfdpntaagwlsvsddltsvtnhdyrvqvenperfpsapcllgscvlsqgshawevdlgtlpswrvgvvrw
ENSSSCP00000022089  nmlhrltadltldpgtahrrllvsadrrsvrlappgtpvppdgparfdqlpavlgaqgfgagrhcwevetadaasgds
ENSSSCP00000007459  ekytcvcpggkfgqcpgsssvtftgnsfvkyrlmenenklemkltmrlrtysshavvmyargtdysileihsgrlqyk
ENSSSCP00000001326  eelkaaltpvtldaasahpdliisqdlktvtldpvpqsrcaeptdparfhpfrcvlglpglssgcqtweaelegpegg
ENSSSCP00000001327  nmlhrltadltldpgtahrrllvsadrrsvrlappgtpvppdgparfdqlpavlgaqgfgagrhcwevetadaasgds
ENSSSCP00000005851  sfnldfevsgiygyvmldgvlpslhavtctfwmkssdinnygtpisyalengsdntflltdyngwvlyvngkeki...
ENSSSCP00000010214  cscpgqreeaegrepeqdilpcvpfnvaksvkslylgrmfsgtpvirlrfkrl.........................
ENSSSCP00000025497  hldlteligvplpssvsfvtgyggfpaysfgpganvgrpartlipptffrdfaisvtvkpssarggvlfaitdafqkv
ENSSSCP00000030716  tygfncefgwgshktfchwehdshvqlkwsvltsktgpiqdhtgdgnf..............................
ENSSSCP00000029973  tygfncefgwgshktfchwehdshvqlkwsvltsktgpiqdhtgdgnf..............................
ENSSSCP00000004541  srnshiaiafddtkvknrltiefevrteaesgllfymarinhadfatvqlrnglpyfsydlgsgdtn...........
ENSSSCP00000026569  idlckngdidycelkarfglrniiadpvtfktkssylslatlqaytsmhlffqfkttsadgfil..............
ENSSSCP00000000431  vsfkleektahsslalfksdtgvkygmvgleptklalnverfrewavvladtaitsgrhywevtvkrsqqfrigvadv
ENSSSCP00000020796  vsfkleektahsslalfksdtgvkygmvgleptklalnverfrewavvladtaitsgrhywevtvkrsqqfrigvadv
ENSSSCP00000012801  incnfedgfcfwiqdlnddneweriqgttfppftgpnfdhtfgnas................................
ENSSSCP00000016666  yngvniidlakrrkhqiytvgnvtfscsepqivpitfvnssssylllpgtpqldglsvsfqfrtwnqdglllstmlse
ENSSSCP00000023132  gaftcscpagrggtfceealplsrpafggrsflafptlrayhtlrlalefralepeglllyngnargkdflalallgg
ENSSSCP00000019848  vyscalgsevvdldgkssllyrfdqkslspikdiislkfkttqsygvllhweglngdhitlelrr.............
ENSSSCP00000006241  evscnferdtcswhtdhltdahwrrvesqgprfdhttgrgyfmlldpteppaqgpsahlltqpqaptapqeclsf...
ENSSSCP00000020492  mdwlnhfkvkisfsnevsnqhirvfddvrslkyrddglyvsldaspskyfaawgtraftsgkqywevdvdsswdwavg
ENSSSCP00000008085  lqfeafyagglapgwnllvqghsdsgedkfeinflseagdivfhikpr..............................
ENSSSCP00000018239  rktllqcycnlsfdpttaseelflfkethsvlnlgillepfaaggpfpgfkqwpqvlcsrglaagrhyweaevsnswv
ENSSSCP00000021088  rktllqcycnlsfdpttaseelflfkethsvlnlgillepfaaggpfpgfkqwpqvlcsrglaagrhyweaevsnswv
ENSSSCP00000003894  agctfeeasdpavpceysqaqyddfqweqvrihpgtrapadlphgsylmvnasqhapgqrahvifqslsendthcvqf
ENSSSCP00000020352  ivpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllrnscisgergeeqsaip
ENSSSCP00000024007  ivpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllrnscisgergeeqsaip
ENSSSCP00000012140  ldhtggfeglllvdddllgvighsnfgtirsttcvykgkwvyevlissqglmqigwcti...................
ENSSSCP00000015856  cqcppgklgecsghtslsfagnsyikyrlsenskeedfklalrlrtlqsngiimytranpciilkivdgklwfqldcg
ENSSSCP00000000096  nymyarvrkalpelyaftvcmwlrsrsggtgqgtpfsysvpeqaneivlleaghdpmellindkvaqlpllkd.....
ENSSSCP00000022990  vldhtggfeglllvdddllgvighsnfgtirsttcvykgkwvyevlissqglmqigw.....................
ENSSSCP00000009188  iqivyetlkdqqegkkgkttiktgasvlnkwqmnpydrgsafdpaigsdglccqsrevkewhgcratkgltkgkhyye
ENSSSCP00000030087  kmqcfsltergsffpgtgfalysldyartspdigaetfweveavarirpatdtgvllalvggdqavvlsvalvdyhst
ENSSSCP00000012497  cetailfpmrskkifasvhpatpmkleafsaciwvkatdvlnktilfsygtkrnpyeiqlylsyqstvlvvggeenrl
ENSSSCP00000031041  fkmmelfglvekdfssvegvsmepgtfnvypcyhlhkdalvsqptkylhpeglpsdytisflfrvlpdtpeepfalwe
ENSSSCP00000004838  pgfkmleaynlteknfasvqgvslesgsfpsysayrlqknafvnqptaelhpnglppsytiillfrllpetpsdpfai
ENSSSCP00000025331  sgiwprhavkllsvlnqmpqrhgpdtffnfpgcsaaaialppiakwpyqngftlntwfrmdplnninvdkdkpylycf
ENSSSCP00000006405  fkmmelfglvekdfssvegvsmepgtfnvypcyhlhkdalvsqptkylhpeglpsdytisflfrvlpdtpeepfalwe
ENSSSCP00000013851  lsfrcedvaaldpvtfespeafvalprwsakrtgsisldfrttepnglllfsqgrragagasshstaqradyfamell
ENSSSCP00000005821  tsigsrppavrgsrdrftgesytvlgdtaiesgqhywevkaqkdcksysvgvayktlgkfdqlgktntswcihvnnwl
ENSSSCP00000004541  qkgtyfdgtgfakavdgfkvgldllvefefrttrttgvllgissqkmdgmgiemideklmfhvdngag..........
ENSSSCP00000021819  gspqnedasfhfdgsgysvvektlratvtqiimlfstfspnglllylasngtkdflsielvhgrvkvtvdlgsgplal
ENSSSCP00000018415  pcfhggrcverysyytcdceltafdgpycnhdiggffepgtwmrynlqsalrsaarefshmlsrppgyrgpvynvtge
ENSSSCP00000013851  pcrngglcregwnrfvcdcigtgflgrvcereatvlsydgsmymkimlpnamhteaedvslrfmsqrayglmmattsr
ENSSSCP00000010214  kmqcfsltergsffpgtgfalysldyartspdigaetfweveavarirpatdtgvllalvggdqavvlsvalvdyhst
ENSSSCP00000011618  ngqhgfsclcppgytgslcetvttlsfegngfvwvpsgsvaakdsgcdvalrfqtvqptalllfrgdgdtflalells
ENSSSCP00000008984  ggcfllclsllllgcwaelgnglefpgaegqwtrfpkwnaccesemsfqlktrsarglvlyfddegfcdfleliltrg
ENSSSCP00000004615  pgfdlisqfqidkaasrraiqrvvgstalqvayklgknvdfriptrqlypsglpeeysflttfrmtgstleknwsiwq
ENSSSCP00000030087  fsgtpvirlrfkrl................................................................
ENSSSCP00000004918  enlpiqevsfdpekaqccivengqilthgsggkgyglastgvtsgcyqwkfyivkenrgnegtcvgvsrwpvhdfnhr
ENSSSCP00000007532  swdlgicrdnvtreg...............................................................
ENSSSCP00000004775  svtpcfegpmetgtyfsteggyvvldesfniglkfeiafevrprsssgifvhghsvngeylnvhmkngqvivkvnngi
ENSSSCP00000008985  iatfkgseyfcydlsqnpiqsssdeitlsfktlqrnglmlhtgksadyvnlalkngavslvinlgsgafealvepvng
ENSSSCP00000018428  niadlavrrhsritfegkvafrcldpvphpinfggphnfvqvpgfprrgrlavsfrfrtwdltglllfsslgdglghv
ENSSSCP00000004775  praiahayqyggtansrqefehlkgdfgeksqfsirlktrsshgmifyvsdpeendfmtlflahgrlvfmfnvghkkl
ENSSSCP00000008158  ellkrfqvpvnpaldtahpklvfsqegrymkngaaaagswplttawsylagwrshq......................
ENSSSCP00000013851  fvatfkgneffcydlshnpiqsstdeitlafrtlqrnglmlhtgksadyvnlslksgavwlvinlgsgafealvepvn
ENSSSCP00000026169  ellkrfqvpvnpaldtahpklvfsqegrymkngaaaagswplttawsylagwrshq......................
ENSSSCP00000023415  lprqvalvhdpdvgpayefdgisgvgqaalslvprtffrdfsllmrvrpasagagvlfavtdaaqavvlvgvklaaar
ENSSSCP00000027051  pvdvlkaldfhnspegiskttgfctnrknskgsdtayrvskqaqlsaptkqlfsggtfpedfsilftvkpkkgiqsfl
ENSSSCP00000026077  lclglefmglpnqwarylrwdastrsdlsfqfktnvst........................................
ENSSSCP00000004541  segtiqfdgegyalvsrpirwfpnistvmfkfrtfsssallmylatrdlkdfmsveltdghikvsydlgsgmasvvsn
ENSSSCP00000027650  dtlvaidtyncdlhfkvardrssgypltiegfaylwsgarasygvrrgrvcfemkineeisvkhlpstepdphvvrig
ENSSSCP00000019848  cglegncidsqyscncdadrnewtndtgflsykehlpvtkivitdthrphseaayklgpllcrgdrlfwnsasfntea
ENSSSCP00000023361  tdvrrywvhvtlnnlkiksdvtisvdrrqvryarkfglsstcpngdfedcsvlgyplissgkhxawilgvygrklsnc
ENSSSCP00000026213  yngvdiidlakqqnpqiiimgnvsfscsqpqsvpvtflsprsylalpgasredevsatfqfrtwnkaglllfs.....
ENSSSCP00000023132  eaqcecprgrggslcqtaserddamqpfladfnsfsylelkglhtferdlgekmelevvfl.................
ENSSSCP00000008195  qcdfednahpfcdwvqasqdggywrqgnkntfiqpagpfgislnge................................
ENSSSCP00000006241  pascdfeaglcgwhhlpwpglggyswdwssgatpsryrqppvdhtlgtekghfalfetgv..................
ENSSSCP00000025417  gaftcscpagrggtfceealplsrpafggrsflafptlrafralepeglllyngnargkdflpehllppsrfdtgsgp
ENSSSCP00000016447  eaetvspqgglpvlyfsgrrerlllrpevladipreaftveawvkpeggqnspaiiagvfdncshtisdkgwalgirs
ENSSSCP00000021819  cvlepirsvsflrggyvelpprslspesellatfatknssgiilaalgqdsekqshqqayepffsivlieglievhvn
ENSSSCP00000006241  tpfschfeqdfcgwrdistsgyswlreragaapggpgprsdhtlgtdlgwyaavgthrgkeaataa............
ENSSSCP00000019848  chhggkcrekpsgfscdctssaytgpfcsdeisayfgsgasiiynfqenyslsknssshaasfqgdvklsretikfsf
ENSSSCP00000021829  dpavptgsfmmvnssgrasgqkahlllptlkendthcidfhyyfssrdrsspgalnvyvkvn................
ENSSSCP00000020853  wnsasfntetsylhfptfrgelsadvsfffkttassgvfvenlgitdfirlelrapaevtfsfdvgngpcevtvpspt
ENSSSCP00000013851  gglefgg.......................................................................
ENSSSCP00000016390  cgiernctdpryycncdadykqwrkdagflsykdhlpvsqvvvgdtdrqgseaklsvgplrcqgdrnywnaasfpnps
ENSSSCP00000004039  scdfelenvcgmiqssedsadwqrvsqvpegpesdhsnmgqckgsgffmhfssssvnvgdtavlesrklypkrgfqcl
ENSSSCP00000014354  grdrftaesytvlgdtlinggeqywevryepdskafgvgvayrslgrfeqlgktaaswc...................
ENSSSCP00000020506  dhcafekanicgmiqgtrddadwvhedsaqpgqvdhtlggqctgagyfmhfdtssgaveeaallesrilypkrkqqcl
ENSSSCP00000001881  dhcafekanicgmiqgtrddadwvhedsaqpgqvdhtlggqctgagyfmhfdtssgaveeaallesrilypkrkqqcl
ENSSSCP00000013851  canqgvclqqwdgftcdctmtsyggpvcndpgttyifgkggalitytwppndrpstrmdrlavgfsthqrsavlvrvd
ENSSSCP00000016666  chnggkcvekhsgyfcdcttspyegpfckkevsavfeagtsvtyvfqepypvtknlslsssaiyvdaapsrenialsf
ENSSSCP00000005883  edvdvlqrlglswtkaaggrsppppgvipfqsgfiftqrarlqapttavipatlgpelalvlslcshrvnhaflfavr
ENSSSCP00000004543  pqgsymivdssdhdpgekarlqlptmkendthcidfsyllysqkglnpgtlnilvrvnkgplanpiwnvtgftgrdwl
ENSSSCP00000003039  nsiramlnsndvseylkisphglearcdassfesvrctfcvdagvwyyevtvvtsgvmqigwatrdskflnhegygig
ENSSSCP00000018415  rcygdrnswntisfhtgaalrfppiranhsldvsfyfrtsapsgvflenmggphcqwrrpyvrvelntsrdvvfafdv
ENSSSCP00000027862  srsksppppeeeakdeeedqtlvnldtytsdlhfqvskdryggqplfsekfptlwsgarstygvtkgkvcfeakvtqn
ENSSSCP00000004541  cslenvytvsfpkpgfvelspvpidvgteinlsfstknesgiillgsggtpapprrkrrqtgqayyaiflnkgrlevh
ENSSSCP00000018099  rlerncscngtaarfsgqsfwryslpkaqnwhirfrlttlqsqaillfsnktawlslklvdge...............
ENSSSCP00000012904  svdcsf........................................................................
ENSSSCP00000030031  svdcsf........................................................................
ENSSSCP00000004614  ktcfklgssllirdtikvfpkglpehfamvamfrvrrstkkerwflwqvlnqqnmpqvsividggkkvvefmfra...
ENSSSCP00000027678  myieashmvygqkaqllsrplrgvagrhcltff.............................................
ENSSSCP00000017907  pasfygesyvelsitevsselslqltfqtskpqgllflaagksdyfiiellagnlrvrvnlgageqvllseqrlrmdd
ENSSSCP00000027979  lrfgdsptshllfilpqelpkprsqfavdvqttssrglvfytgtktsfmalylskgrlvfal................
ENSSSCP00000004016  lrfgdsptshllfilpqelpkprsqfavdvqttssrglvfytgtktsfmalylskgrlvfal................
ENSSSCP00000003680  gslnwtvglptdnghdsdqvfefngtqavripdgvvsvdpkepftisvwmrhgpfgrkketvlcssdktdmnrhhysl
ENSSSCP00000001127  mgiglsaqgvnmnrlpgwdkhsygyhgddghsfcssgtgqpygptfttg.............................
ENSSSCP00000006241  pkrcsfedsacgfstggqglwtrqtnatghaawgphadhttetaqghymvvdmspqalp...................
ENSSSCP00000001629  fdillglgvkkkakkriqlsptkikgyevtskvdlsestsnvfpeglppsyvfvstqrfkvkkmwdlwriltmdg...
ENSSSCP00000005988  alrfgertadraarlrkplpalgaltacahvqwdaaspdtaalfslavpalanalqlrafaepggavhlalvvrghha
ENSSSCP00000024916  alrfgertadraarlrkplpalgaltacahvqwdaaspdtaalfslavpalanalqlrafaepggavhlalvvrghha
ENSSSCP00000021132  hagkllsvlkhmpqkygpdaffnfpgksaaaialppiakwpyqngftfhtwlrmdpvnninvdkdkpyly........
ENSSSCP00000017907  inffssrsyvafpewkmpghgllefalqtetqqalllfqsgqegdfialeiakgllkahvgrnknntelss.......
ENSSSCP00000005893  sppsralyfsgrgeqlrlradlelprdaftlqvwlraeggqrspavitglydkcsyasrdrgwvvgihtvsdqgnrdp
ENSSSCP00000029807  trgtllaverkdhsgqvfsvvsngkagtldlsltvqgkq.......................................
ENSSSCP00000011596  ddtvvcldtyncdlhfkisrdrlsassltmesfaflwaggrasygvskgkvcfemkvtekip................
ENSSSCP00000002048  dvalgfsgphslaafpawgtqdegileftlttrsrqaplafqaggrhgdfiyvdif......................
ENSSSCP00000001310  scmvgvardsvkrkgdlslrpedgvwalrlsssgiwantrpeaelfpaqr............................
ENSSSCP00000028578  scmvgvardsvkrkgdlslrpedgvwalrlsssgiwantrpeaelfpaqr............................
ENSSSCP00000012112  erwggfscdcpvgfggkdcrltmahphhfrgngtlswdfgndmavsvpwylglafrtratqgvlmqvqagphstllcq
ENSSSCP00000018222  rdyflkfayivdldsdtadkflqlfgtkgvkrvlcpinypesptrfthceqvlgegaldrgtyyweveiiegwvsvgv
ENSSSCP00000029355  rdyflkfayivdldsdtadkflqlfgtkgvkrvlcpinypesptrfthceqvlgegaldrgtyyweveiiegwvsvgv
ENSSSCP00000003233  lrwsvslavgwmvkikadllhpsrkspefkadffvcpeeggniafhfrnavvmssfqeggwreakra...........
ENSSSCP00000023342  ptynptlpyykpipgglrvgmsvyiqgvanehmkrgasnpgtgrgpgsslhfsfsssdgdkcwrqtrregrwgaetta
ENSSSCP00000023857  gslnwtvglptdnghdsdqvfefngtqavripdgvvsvdpkepftisvwmrhgpfgrkketvlcssdktdmnrhhysl
ENSSSCP00000026405  ycdgkrgfklaqdqksceavpvclplnldknyellylaeqfvgvvlylkfrlpeitrfsaefdfrtydsegvilyaes
ENSSSCP00000023656  kirnpkgplilrlgatsvtqptrrvfprglpgefalvltlllkkhthqkhvvfvqvtdgdgtrsislevnsqerslel
ENSSSCP00000001565  rdcnlitleqeafssgrhywevdikdtdewtlgiyempmqgegkcndlpkk...........................
ENSSSCP00000003907  kirnpkgplilrlgatsvtqptrrvfprglpgefalvltlllkkhthqkhvvfvqvtdgdgtrsislevnsqerslel
ENSSSCP00000012436  iidllpspstatnwtagllvdssemifkfdgrqgakipdgvvpknltdqftitmwmkhgpspgvrae...........
ENSSSCP00000001558  rdcnlitleqeafssgrhywevdikdtdewtlgiyempmqgegkcndlpkk...........................
ENSSSCP00000004775  syffdgssyavvrditrrgkfgqvtrfdievrtpadnglvl.....................................
ENSSSCP00000010407  satvdivegkvnkgiylkgekgitllyfgeykpscifnpaqcspegvtfsffwkiqgeqsrsapfayggqvisnlfkv
ENSSSCP00000027979  kgiyfsqegghvilansvflgpefklvfsirprsltgilihigsqpgehlcvyleagkvtasvsseaggiltsvtpkq
ENSSSCP00000004016  kgiyfsqegghvilansvflgpefklvfsirprsltgilihigsqpgehlcvyleagkvtasvsseaggiltsvtpkq
ENSSSCP00000026273  vftgqsseivfrsngnitrdltnitfgfrtrdanmtilqaekepeflhvsiresrllfqlqsgngvhmlslaslqpvn
ENSSSCP00000027979  krcsedwklvrsasfsrg............................................................
ENSSSCP00000004016  krcsedwklvrsasfsrg............................................................
ENSSSCP00000015120  ppapvfsflfdekcgynnehlllnlkrdrvesragfnlllaaeriqvgyytsldyiigdvgitkgkhfwafrvepysy
ENSSSCP00000029926  ppapvfsflfdekcgynnehlllnlkrdrvesragfnlllaaeriqvgyytsldyiigdvgitkgkhfwafrvepysy
ENSSSCP00000019261  pppgvipfqsgfiftqrarlqapttaviptvipatlgpelalvlslcshrvnhaflfalglqflpgktvvhlgprrsv
ENSSSCP00000027979  pcrrrkdesdknyfegtgyariptqsnaanpfftqiiqttvdsgllffaenqdcfmsl....................
ENSSSCP00000004016  pcrrrkdesdknyfegtgyariptqsnaanpfftqiiqttvdsgllffaenqdcfmsl....................
ENSSSCP00000019207  mwlyraysgnlyhngeqtltlssftqgd..................................................
ENSSSCP00000025417  gasyeclcpggfsglhcekgeccphraaaggdldalafdgrtyveylnavslfpseltneipapeapesgaphsekal
ENSSSCP00000024968  ddvalgfsgphslaafpawgtqdegileftlttrsrqaplafqaggrhgdfi..........................
ENSSSCP00000001308  clvgvaresvvrrgflsftpeegfwtlqlssagvcictslep....................................
ENSSSCP00000004775  dslisrrayfngqsfiasvqkisffdg...................................................
ENSSSCP00000025895  ddvalgfsgphslaafpawgtqdegileftlttrsrqaplafqaggrhgdfi..........................
ENSSSCP00000022922  ddvalgfsgphslaafpawgtqdegileftlttrsrqaplafqaggrhgdfi..........................
ENSSSCP00000002048  chtasffgenhlevplatalpdidlqlefstsqpeallllaagpvdhlllqlysgrlqvr..................
ENSSSCP00000000712  gevdllpmpgpnanwta.............................................................
ENSSSCP00000022455  iclcplgfrgrhcedaftltipqfreslrsyaatpwpleprhylsfmefemtfrpdsedgvllys.............
ENSSSCP00000001310  rdleyktvsvtldpqsasgylqlsedwkcvtysgly..........................................
ENSSSCP00000028578  rdleyktvsvtldpqsasgylqlsedwkcvtysgly..........................................
ENSSSCP00000016392  gpiyghtsvttgsllddhhwhsvvierqgrsinltldrsmqh....................................
ENSSSCP00000008559  dcrcgeededfdwvwddlnkssatllsc..................................................
ENSSSCP00000021819  rrgkvaflwdlgsgsarvefpdfpiddsrwhsiyvtrfgntgslsvkemsasqkppprtskspgtanvldvnn.....
ENSSSCP00000003203  syavqsgrwyfefeavttgemrvgwarpelrpdvelgadelayvfnghrgqrwhlgse....................
ENSSSCP00000010021  mpavqldtqhmgtdvvivkngrricgtggclasaplhqnksyfefkiqstgiwgigvatqkvnlnqiplgrdvhslvm
ENSSSCP00000010815  yavkagrwyfefeavtagdmrvgwsrpgcqpdqelgsderafafd.................................
ENSSSCP00000020574  slevkfrtrsen..................................................................
ENSSSCP00000016666  fwnavsfyteasylhfptfhaefsadisfffkttalsgvflenlgikdfirleisxkkkifxlvdvfqgpplylvgsp
ENSSSCP00000022958  keevwcvgtngkryqaqssteqtllspsekprrfgvyl........................................
ENSSSCP00000005978  cdcprpysgptcadevpaatfglggtlssasfllnqlpgpnltvsfllrtrepaglllqfandsaagltvflsegqir
ENSSSCP00000017851  iclcplgfrgrhcedaftltipqfreslrsyaatpwpleprhylsfmefe............................
ENSSSCP00000021247  sgfncnfdfpeepcgwvydhakwlrstwtsssspsdrtfpddrnflrlqsdgrregqyarlisppvhlprspvcmef.
ENSSSCP00000012777  lalvsgntvpfalslvdsateklqdivvsvenveiarikalslcsslqsllemrvsvnslelltqfekrrissedyq.
ENSSSCP00000006241  latdfemglglwnhsegwarnhstgrpqhpawprgdhsrnsaqgsflvstaeps........................
ENSSSCP00000028807  iynpiipyvgtiseqlepgtlivlrghv..................................................
ENSSSCP00000013885  evpcsralprglwpgqviivrglvlpepkdftlrlrdeaahvpvtlrasfadrtlawvsrw.................
ENSSSCP00000025417  xdgkgdfvslalhnrllefrydlgkgaavirskepvalgvwtrv..................................
ENSSSCP00000004775  qvsmmfdgqsavegppqasmddlktftslslymkpppvkqpklagtadfilylgskhakkeymglaikndnlvyvynl
ENSSSCP00000024968  chtasffgenhlevplatalpdidlqlefstsqpeallllaagpvdhlllqlysgr......................
ENSSSCP00000000277  dvglaqarhplstrshyfeveivdpgekcyialglarkdypknrhpgwsrgsvayh......................
ENSSSCP00000027978  gevdllpmpgpnanwtaglyssliywfngtqavqvplggtaglgsgpqdslsdhlslsfwmkhgvtpnkgkkeeetiv
ENSSSCP00000005978  hctcpanftgptcaqqlwcpgqpclppatceevpdgfvcvaeatfregppaefsghnassgralsglslafrtrdpea
ENSSSCP00000014530  qinltdgrwhrvavsvngrtatlvadcepqspvlvqgprfistaglt...............................
ENSSSCP00000023947  aggqyltvsaakgpagraarlllplghllhsgdlclsfrhkvtglhsgtlqvfvkkisahga................
ENSSSCP00000025895  kasffgenhlevplatalpdidlqlefstsqpeallllaagpvdhlllqlysgrl.......................
ENSSSCP00000022922  kasffgenhlevplatalpdidlqlefstsqpeallllaagpvdhlllqlysgrl.......................
ENSSSCP00000005978  tcrcppgthgplcgqnttfsvvagnpvravvpaggplglalrfrttvtsgplatrsdtqdslelalvgamlqatlrsr
ENSSSCP00000026588  tgdhtsgfgyyllantkftsqpgyigrlygpslpgnlqyclrfyya................................
ENSSSCP00000001308  rdleyktmrislnsqtangylsvspngksmvftglwmnkyq.....................................
ENSSSCP00000000277  ilvdgdtlsyhgnsgevgcyvasrpltkdsnyfevsivdsgvrgtiavglvpqy........................
ENSSSCP00000004471  vsvaksvsipelraftlcfeankigkednewtafsysdasfsqllsfgktksgyflyisgskcslnsvlpvkdkddif
ENSSSCP00000004541  rkgkvsflwdvgsgvgrveypdltiddsywyrieasrtgrngtisvraldg...........................
ENSSSCP00000020853  crnggrcrekhrgitcdctssaydgpfceneisayfgtgssviynfqehyyht.........................
ENSSSCP00000006241  cgttdfedpsaggwedasvgrlqwmrvsa.................................................
ENSSSCP00000026906  rflrfiplewnpkgrigmrievfgcayrsevvdldgkssllyrfdqkslspikdii......................
ENSSSCP00000016389  gaffeegmwlrynfqapgvnakesgsfsttkapcillyvsslttdflavlvkpt........................
ENSSSCP00000006954  tsrerlaiskdqravrsvpglplllaaerlltgchlsvdvlgdvavtqgrsywacavkptsylvkvgvglenklqesf
ENSSSCP00000015012  lnpsvlqpil....................................................................
ENSSSCP00000016392  ynginitdlarrkklepsnvgnlsfscvepytvpvffnatsylevpgrlnqdlfsvsf....................
ENSSSCP00000027979  aipmrfngksgvevrlpndledlkgytslslflqrpesaehgstenmfvmylgnkdasrdyigmavvdgqlmcvynlg
ENSSSCP00000004016  aipmrfngksgvevrlpndledlkgytslslflqrpesaehgstenmfvmylgnkdasrdyigmavvdgqlmcvynlg
ENSSSCP00000020473  angqphsvnitrhektiilkldhypsvsyhlpsssdtl........................................
ENSSSCP00000008195  fsfpggfymlldpknakprqrsallspliqssgclslsfqytqrgqasgatlmvyasvlgsirkhtlfs.........
ENSSSCP00000030974  fhyrlagnkvgklrvfvknsnsa.......................................................
ENSSSCP00000019430  ksvketaliellfadmnrhhyslcifllrqdpseekkykpaefhwklhqvcdeewhhyvlnvdipsvvlyvdga....
ENSSSCP00000022637  qgkigvvfnigtvdisikeertpvndgkyhvv..............................................
ENSSSCP00000014907  lepfkmtpfsaiglelwsmtsdif......................................................
ENSSSCP00000017077  yfnlshsmagisvpsiqkwpgsafsfnawfcldqdqltlgsankggkrkqlysfftgsgmgfeafithsgtlvvavc.
ENSSSCP00000010815  kwyyelmvdhtepfvtaeathlrvgwastegyspypgggeewggngvgddlfsygfdglhlwsgciartvssp.....
ENSSSCP00000009337  vwftvslwlyllhyckanlcgilyfvdsnemygtpsvflteeghlhiqmhlvkgddlavktkftiplkewlrldisfn
ENSSSCP00000019007  erllfhpncgqkaaithegrtalrphatddfnhgvvlssralrdgevfqvridkmvdkwagsieigvtthnpaylqlp
ENSSSCP00000024991  lndgqwhevrflakenfailt.........................................................
ENSSSCP00000009843  sgerffpppsglsysswfciehfssppnnhpvrlltivrrassseqhyvclavvlsakdrslivstkeellqnyvddf
ENSSSCP00000019007  rlvslsacgrtarrqqpgqefnhglvlsreplrdgrvftvridrkvnswsgsieigvtaldpsvldfpssatglkggs
ENSSSCP00000023477  agatyifgksgg..................................................................
ENSSSCP00000009452  hkmistfqenltldaktahgslilsqd...................................................
ENSSSCP00000003203  thlrvgwaltegyspypgggegwggngvgddlysygfdglhlwtghvprlvtspgqhll...................
ENSSSCP00000003203  yyysvrvfagqepscvwvgwvtpdyhqhdmnfdltkvravtvtmgdeqgnihss........................
ENSSSCP00000022093  sshsvlqpsfqgcmqliqvddq........................................................
ENSSSCP00000027047  inkpeslfkptngfletkvy..........................................................
ENSSSCP00000006952  tagdiyllstfrlppkqggvlfglysrqdntrwleasv........................................
ENSSSCP00000011072  gtgaarsfpppggltfscwflisrhsavteghplrfltlvrhlsrteqpfvcfsvslcpedlslvvsteekefqpld.
ENSSSCP00000023964  gtgaarsfpppggltfscwflisrhsavteghplrfltlvrhlsrteqpfvcfsvslcpedlslvvsteekefqpld.


                                                                                                    
                                                                                                    
d1ux6a1               ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000015013  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000014796  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000014907  pfifdtkplivqyevnfqngiecggayvkllsk.............................................
ENSSSCP00000005280  dglaiwyten....................................................................
ENSSSCP00000024403  ..............................................................................
ENSSSCP00000001201  ..............................................................................
ENSSSCP00000029440  ..............................................................................
ENSSSCP00000001416  vgvcr.........................................................................
ENSSSCP00000029869  vgvcr.........................................................................
ENSSSCP00000030828  vgvcr.........................................................................
ENSSSCP00000026179  ..............................................................................
ENSSSCP00000014929  dgialwytrdrmvpgpvfgskdnfhglaifldtypndettervfpyisvmvnng........................
ENSSSCP00000029385  gvcedsvcrkggvtsa..............................................................
ENSSSCP00000001288  gvcedsvcrkggvtsa..............................................................
ENSSSCP00000024192  kdrmqpgpvfgn..................................................................
ENSSSCP00000015699  gvcrdsvkrkghfllnp.............................................................
ENSSSCP00000001200  gvcrnsverkgei.................................................................
ENSSSCP00000008754  gdglaiwytkdrmqp...............................................................
ENSSSCP00000015688  gvcresvdrkevvyls..............................................................
ENSSSCP00000029029  ..............................................................................
ENSSSCP00000014840  lgvcqdtvsrkgettpspengvwal.....................................................
ENSSSCP00000021212  havvgvataraplhsvgytalvgsdaeswgwdlgrsrlyhdgknrpgva.............................
ENSSSCP00000014732  vkheqkmdcgggyikifpadvdqknlngksqyyimfgpdicgfdikkvhvilyfknqyhsnkksirckvdgfthlytl
ENSSSCP00000003582  vckesvhrqgmiq.................................................................
ENSSSCP00000005042  ..............................................................................
ENSSSCP00000009237  icrdnvtrkg....................................................................
ENSSSCP00000006271  gicrdnv.......................................................................
ENSSSCP00000006272  gicrdnvtrkg...................................................................
ENSSSCP00000009236  icrenvtrkga...................................................................
ENSSSCP00000007533  ..............................................................................
ENSSSCP00000014615  ..............................................................................
ENSSSCP00000022095  gvcsesvnrkgkvtaspa............................................................
ENSSSCP00000027530  icrdnvtkkeef..................................................................
ENSSSCP00000024940  ..............................................................................
ENSSSCP00000002077  qgmavwytrgrgqvssvlgaldsgdsigil................................................
ENSSSCP00000023787  qgmavwytrgrgqvssvlgaldsgdsigil................................................
ENSSSCP00000004776  gvckmsvnrkr...................................................................
ENSSSCP00000021310  gvckmsvnrkr...................................................................
ENSSSCP00000004184  ..............................................................................
ENSSSCP00000003925  laheaasrkg....................................................................
ENSSSCP00000027015  iswpreqrgthavvgvatalaplqadhyaallgsnseswgw.....................................
ENSSSCP00000008227  vikgtasrkgklnkspehgvwliglkegrv................................................
ENSSSCP00000005767  vgaaygslrrrgasaaarlgcnrqswclkryd..............................................
ENSSSCP00000024925  rhgpesrlgr....................................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000014885  lgvc..........................................................................
ENSSSCP00000028656  ..............................................................................
ENSSSCP00000030393  ..............................................................................
ENSSSCP00000030993  ..............................................................................
ENSSSCP00000012889  ..............................................................................
ENSSSCP00000029279  ..............................................................................
ENSSSCP00000030659  ..............................................................................
ENSSSCP00000005403  eltvdrydnhpdp.................................................................
ENSSSCP00000001314  rkgeqg........................................................................
ENSSSCP00000009454  ..............................................................................
ENSSSCP00000001560  dgsgtkwalgvcsktawrkgwfves.....................................................
ENSSSCP00000001564  dgsgtkwalgvcsktawrkgwfves.....................................................
ENSSSCP00000023159  ..............................................................................
ENSSSCP00000028586  dgsgtkwalgvcsktawrkgwfves.....................................................
ENSSSCP00000021328  ..............................................................................
ENSSSCP00000021030  ..............................................................................
ENSSSCP00000001553  ..............................................................................
ENSSSCP00000015601  ..............................................................................
ENSSSCP00000001716  sakfy.........................................................................
ENSSSCP00000019609  ..............................................................................
ENSSSCP00000022993  ..............................................................................
ENSSSCP00000001312  ..............................................................................
ENSSSCP00000029343  glckeswtsrndmllnsed...........................................................
ENSSSCP00000015849  gvckdiwtsdtdisv...............................................................
ENSSSCP00000005434  ..............................................................................
ENSSSCP00000030635  ..............................................................................
ENSSSCP00000019990  kgawyfeitvdemppdtaarlgwsqplgnlqaplgydkfsys....................................
ENSSSCP00000021698  ..............................................................................
ENSSSCP00000025036  ..............................................................................
ENSSSCP00000018810  rgqsflvwilceshcfkvavdgqh......................................................
ENSSSCP00000015851  gvckdiwtsdtdisvd..............................................................
ENSSSCP00000013361  giayksapknewigknassw..........................................................
ENSSSCP00000009456  vckesfprnvpi..................................................................
ENSSSCP00000018791  rgmrrdqilgr...................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000000129  ..............................................................................
ENSSSCP00000011201  ..............................................................................
ENSSSCP00000015852  swtsrndmllnsedi...............................................................
ENSSSCP00000017851  mwrgdspm......................................................................
ENSSSCP00000009455  vckesfprnvpkpptpd.............................................................
ENSSSCP00000012112  vrltystgesntvvsptvpgglsdgqwhtvhlryynkprtdalgga................................
ENSSSCP00000006826  vifkphqssepmhfcmtwestsgite....................................................
ENSSSCP00000029570  vifkphqssepmhfcmtwestsgite....................................................
ENSSSCP00000018163  ..............................................................................
ENSSSCP00000005380  apknpygp......................................................................
ENSSSCP00000000853  hldhrylelessghrnevrlhyr.......................................................
ENSSSCP00000009453  vckesfprnvpipptp..............................................................
ENSSSCP00000008124  ..............................................................................
ENSSSCP00000025878  kesfprnvpippt.................................................................
ENSSSCP00000026387  ..............................................................................
ENSSSCP00000019654  evlfkspentaapthicaswesasgiae..................................................
ENSSSCP00000024906  ghlefryelg....................................................................
ENSSSCP00000015599  vygrklsnclfcfsksnqhpy.........................................................
ENSSSCP00000024988  ..............................................................................
ENSSSCP00000024616  ..............................................................................
ENSSSCP00000021918  ..............................................................................
ENSSSCP00000009325  ..............................................................................
ENSSSCP00000022455  ttakdgllmwrgdspm..............................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000001973  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000006160  vsiyneqgiqqiglemgrspvflyedh...................................................
ENSSSCP00000023414  ..............................................................................
ENSSSCP00000029303  lgvigaqagrrgrlhavpsqglwllglregkileahveake.....................................
ENSSSCP00000008285  lgvigaqagrrgrlhavpsqglwllglregkileahveake.....................................
ENSSSCP00000024906  glllwqgvevgesgrgkdfislglqdghlvfsyqlgsgearlvsedpindgewhrv......................
ENSSSCP00000005158  verkdhs.......................................................................
ENSSSCP00000029039  gvrqlglelgrpirflyedqtgrpqppaqpvfr.............................................
ENSSSCP00000018428  dyvtlelqga....................................................................
ENSSSCP00000006832  ..............................................................................
ENSSSCP00000006161  vsiyneqgiqqiglemgrspvflyedh...................................................
ENSSSCP00000018218  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000001598  gvrqlglelgrpirflyedqtgrpqppaqpvfr.............................................
ENSSSCP00000030976  gvrqlglelgrpirflyedqtgrpqppaqpvfr.............................................
ENSSSCP00000011839  ..............................................................................
ENSSSCP00000030667  ..............................................................................
ENSSSCP00000001317  ..............................................................................
ENSSSCP00000003232  ..............................................................................
ENSSSCP00000013851  lvkg..........................................................................
ENSSSCP00000023132  ad............................................................................
ENSSSCP00000016666  qitle.........................................................................
ENSSSCP00000004335  legpgatrrqfeivsn..............................................................
ENSSSCP00000019848  s.............................................................................
ENSSSCP00000010319  rqdagsegr.....................................................................
ENSSSCP00000022089  sgededdgeslyavgaagesvrrkgrvglcpa..............................................
ENSSSCP00000007459  fdcgsgpgivsvqsiqvndgl.........................................................
ENSSSCP00000001326  gclvgvaselvtrrgplmiepltgf.....................................................
ENSSSCP00000001327  sgededdgeslyavgaagesvrrkgrvglcpa..............................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000025497  iylglrlsa.....................................................................
ENSSSCP00000030716  ..............................................................................
ENSSSCP00000029973  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000026569  ..............................................................................
ENSSSCP00000000431  dmsrds........................................................................
ENSSSCP00000020796  dmsrds........................................................................
ENSSSCP00000012801  ..............................................................................
ENSSSCP00000016666  gsgtlllsleggrlrlviqkmteraaeiltgrnlndgl........................................
ENSSSCP00000023132  rvqlrfdtgs....................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000020492  vcrdswl.......................................................................
ENSSSCP00000008085  ..............................................................................
ENSSSCP00000018239  clgvtyrrspplsgrprrnivyllgrn...................................................
ENSSSCP00000021088  clgvtyrrspplsgrprrnivyllgrn...................................................
ENSSSCP00000003894  syflys........................................................................
ENSSSCP00000020352  yfpf..........................................................................
ENSSSCP00000024007  yfpf..........................................................................
ENSSSCP00000012140  ..............................................................................
ENSSSCP00000015856  sgpgil........................................................................
ENSSSCP00000000096  ..............................................................................
ENSSSCP00000022990  ..............................................................................
ENSSSCP00000009188  vs............................................................................
ENSSSCP00000030087  kklk..........................................................................
ENSSSCP00000012497  vantvispgtwth.................................................................
ENSSSCP00000031041  ilnknsdplvgvildnggk...........................................................
ENSSSCP00000004838  wqitdrdykpqvgviadpssktlsff....................................................
ENSSSCP00000025331  rtskgvgysahfvgnclivtslkskgkgfqhcvkydf.........................................
ENSSSCP00000006405  ilnknsdplvgvildnggk...........................................................
ENSSSCP00000013851  dgylyllldmgsggiklrassrkvnd....................................................
ENSSSCP00000005821  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000021819  itdrrynng.....................................................................
ENSSSCP00000018415  evsfsfsthsapavllyvss..........................................................
ENSSSCP00000013851  esadtlrleldggqmkltvnld........................................................
ENSSSCP00000010214  kklk..........................................................................
ENSSSCP00000011618  gyvhvsvqvghqp.................................................................
ENSSSCP00000008984  grlqlsfsifcaepa...............................................................
ENSSSCP00000004615  iqdssgkeqvgvking..............................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000004918  ttsd..........................................................................
ENSSSCP00000007532  ..............................................................................
ENSSSCP00000004775  rdf...........................................................................
ENSSSCP00000008985  kfn...........................................................................
ENSSSCP00000018428  elilsegqvnvsivqtgrkklqfaa.....................................................
ENSSSCP00000004775  kirsqek.......................................................................
ENSSSCP00000008158  ..............................................................................
ENSSSCP00000013851  gk............................................................................
ENSSSCP00000026169  ..............................................................................
ENSSSCP00000023415  ggqqqvq.......................................................................
ENSSSCP00000027051  lsiy..........................................................................
ENSSSCP00000026077  ..............................................................................
ENSSSCP00000004541  qnhndgkwksftlsriqkqani........................................................
ENSSSCP00000027650  ..............................................................................
ENSSSCP00000019848  sylhfptfhgelsadvsfff..........................................................
ENSSSCP00000023361  lfcfsksnqhp...................................................................
ENSSSCP00000026213  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000025417  avltssvpvqpgrwhrlelsrh........................................................
ENSSSCP00000016447  gkdvgrrdarfffslrtdrvkkatvvmghsryq.............................................
ENSSSCP00000021819  agdgts........................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000019848  rttrtpslllyvssfykeylsv........................................................
ENSSSCP00000021829  ..............................................................................
ENSSSCP00000020853  pfndnrwhhvkaernikeasl.........................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016390  sylhfstfqgetsad...............................................................
ENSSSCP00000004039  qfflynsghendqld...............................................................
ENSSSCP00000014354  ..............................................................................
ENSSSCP00000020506  qffykmtgsssdrlvvwvrrdd........................................................
ENSSSCP00000001881  qffykmtgsssdrlvvwvrrdd........................................................
ENSSSCP00000013851  sasglgdylqlhidq...............................................................
ENSSSCP00000016666  vtaqvpglllyvnsssqdsl..........................................................
ENSSSCP00000005883  srkhklqlglqflpgktvvhlgprrsva..................................................
ENSSSCP00000004543  raelavstfwpn..................................................................
ENSSSCP00000003039  ddeyscaydgc...................................................................
ENSSSCP00000018415  gngdenltvhsddfefnddewhlvraeinvkqarlrvdhrp.....................................
ENSSSCP00000027862  l.............................................................................
ENSSSCP00000004541  lstgartmrki...................................................................
ENSSSCP00000018099  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000004614  ..............................................................................
ENSSSCP00000027678  ..............................................................................
ENSSSCP00000017907  lvwhfve.......................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000003680  yihgcrlifllrqdps..............................................................
ENSSSCP00000001127  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000001629  ..............................................................................
ENSSSCP00000005988  pfraafradghwhhvcatw...........................................................
ENSSSCP00000024916  pfraafradghwhhvcatw...........................................................
ENSSSCP00000021132  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000005893  ryffsl........................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000011596  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000012112  ldrgllsvtvtkgsgraahllldev.....................................................
ENSSSCP00000018222  ..............................................................................
ENSSSCP00000029355  ..............................................................................
ENSSSCP00000003233  ..............................................................................
ENSSSCP00000023342  s.............................................................................
ENSSSCP00000023857  yihgcrlifllrqdpseekkykpa......................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000023656  rargq.........................................................................
ENSSSCP00000001565  ..............................................................................
ENSSSCP00000003907  rargq.........................................................................
ENSSSCP00000012436  ..............................................................................
ENSSSCP00000001558  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000010407  csrggkgsvelythdnsmtw..........................................................
ENSSSCP00000027979  slcdgqwhsvavti................................................................
ENSSSCP00000004016  slcdgqwhsvavti................................................................
ENSSSCP00000026273  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000015120  lvkvgvassdklqewlrsprdavspryeqdsghdsgsedacfdssqpftlvtigmkkffipksptssnepenrvlpmp
ENSSSCP00000029926  lvkvgvassdklqewlrsprdavspryeqdsghdsgsedacfdssqpftlvtigmkkffipksptssnepenrvlpmp
ENSSSCP00000019261  afdldvhdg.....................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000019207  ..............................................................................
ENSSSCP00000025417  qsnhfelslrteatqglvlwsgkateradyialai...........................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000000712  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000008559  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000010021  rndg..........................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000020574  ..............................................................................
ENSSSCP00000016666  lsl...........................................................................
ENSSSCP00000022958  ..............................................................................
ENSSSCP00000005978  aevlgspal.....................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000021247  ..............................................................................
ENSSSCP00000012777  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000028807  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000004775  gtkdveipldskpvsswpahfsivkiervgkhgkvfltvps.....................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000027978  cntvqnedgfshysltvh............................................................
ENSSSCP00000005978  gllraedapatiwlavrngslaagvrsgpslpgavlpa........................................
ENSSSCP00000014530  ..............................................................................
ENSSSCP00000023947  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000005978  gnnvl.........................................................................
ENSSSCP00000026588  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000004471  tenfeq........................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000026906  ..............................................................................
ENSSSCP00000016389  ..............................................................................
ENSSSCP00000006954  qgapdvisprydpds...............................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000027979  eqeaelqvdqtl..................................................................
ENSSSCP00000004016  eqeaelqvdqtl..................................................................
ENSSSCP00000020473  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000030974  ..............................................................................
ENSSSCP00000019430  ..............................................................................
ENSSSCP00000022637  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000017077  ..............................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000009337  ggqivvtassgqd.................................................................
ENSSSCP00000019007  stmtnlrsgtwmmtgngvm...........................................................
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  seessfyeilpccarfrcgelivegqwhhlvlvmskgml.......................................
ENSSSCP00000019007  wvvsgcsv......................................................................
ENSSSCP00000023477  ..............................................................................
ENSSSCP00000009452  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000022093  ..............................................................................
ENSSSCP00000027047  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000011072  ..............................................................................
ENSSSCP00000023964  ..............................................................................


                                                                                                    
                                                                                                    
d1ux6a1               ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000015013  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000014796  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000005280  ..............................................................................
ENSSSCP00000024403  ..............................................................................
ENSSSCP00000001201  ..............................................................................
ENSSSCP00000029440  ..............................................................................
ENSSSCP00000001416  ..............................................................................
ENSSSCP00000029869  ..............................................................................
ENSSSCP00000030828  ..............................................................................
ENSSSCP00000026179  ..............................................................................
ENSSSCP00000014929  ..............................................................................
ENSSSCP00000029385  ..............................................................................
ENSSSCP00000001288  ..............................................................................
ENSSSCP00000024192  ..............................................................................
ENSSSCP00000015699  ..............................................................................
ENSSSCP00000001200  ..............................................................................
ENSSSCP00000008754  ..............................................................................
ENSSSCP00000015688  ..............................................................................
ENSSSCP00000029029  ..............................................................................
ENSSSCP00000014840  ..............................................................................
ENSSSCP00000021212  ..............................................................................
ENSSSCP00000014732  ilrpdltyevkidgqsiesgsieydwqltslkkmemasaeskdwdqatekpqdwekhfldagaskpsdwnseldgdwq
ENSSSCP00000003582  ..............................................................................
ENSSSCP00000005042  ..............................................................................
ENSSSCP00000009237  ..............................................................................
ENSSSCP00000006271  ..............................................................................
ENSSSCP00000006272  ..............................................................................
ENSSSCP00000009236  ..............................................................................
ENSSSCP00000007533  ..............................................................................
ENSSSCP00000014615  ..............................................................................
ENSSSCP00000022095  ..............................................................................
ENSSSCP00000027530  ..............................................................................
ENSSSCP00000024940  ..............................................................................
ENSSSCP00000002077  ..............................................................................
ENSSSCP00000023787  ..............................................................................
ENSSSCP00000004776  ..............................................................................
ENSSSCP00000021310  ..............................................................................
ENSSSCP00000004184  ..............................................................................
ENSSSCP00000003925  ..............................................................................
ENSSSCP00000027015  ..............................................................................
ENSSSCP00000008227  ..............................................................................
ENSSSCP00000005767  ..............................................................................
ENSSSCP00000024925  ..............................................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000014885  ..............................................................................
ENSSSCP00000028656  ..............................................................................
ENSSSCP00000030393  ..............................................................................
ENSSSCP00000030993  ..............................................................................
ENSSSCP00000012889  ..............................................................................
ENSSSCP00000029279  ..............................................................................
ENSSSCP00000030659  ..............................................................................
ENSSSCP00000005403  ..............................................................................
ENSSSCP00000001314  ..............................................................................
ENSSSCP00000009454  ..............................................................................
ENSSSCP00000001560  ..............................................................................
ENSSSCP00000001564  ..............................................................................
ENSSSCP00000023159  ..............................................................................
ENSSSCP00000028586  ..............................................................................
ENSSSCP00000021328  ..............................................................................
ENSSSCP00000021030  ..............................................................................
ENSSSCP00000001553  ..............................................................................
ENSSSCP00000015601  ..............................................................................
ENSSSCP00000001716  ..............................................................................
ENSSSCP00000019609  ..............................................................................
ENSSSCP00000022993  ..............................................................................
ENSSSCP00000001312  ..............................................................................
ENSSSCP00000029343  ..............................................................................
ENSSSCP00000015849  ..............................................................................
ENSSSCP00000005434  ..............................................................................
ENSSSCP00000030635  ..............................................................................
ENSSSCP00000019990  ..............................................................................
ENSSSCP00000021698  ..............................................................................
ENSSSCP00000025036  ..............................................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000015851  ..............................................................................
ENSSSCP00000013361  ..............................................................................
ENSSSCP00000009456  ..............................................................................
ENSSSCP00000018791  ..............................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000000129  ..............................................................................
ENSSSCP00000011201  ..............................................................................
ENSSSCP00000015852  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000009455  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000006826  ..............................................................................
ENSSSCP00000029570  ..............................................................................
ENSSSCP00000018163  ..............................................................................
ENSSSCP00000005380  ..............................................................................
ENSSSCP00000000853  ..............................................................................
ENSSSCP00000009453  ..............................................................................
ENSSSCP00000008124  ..............................................................................
ENSSSCP00000025878  ..............................................................................
ENSSSCP00000026387  ..............................................................................
ENSSSCP00000019654  ..............................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000015599  ..............................................................................
ENSSSCP00000024988  ..............................................................................
ENSSSCP00000024616  ..............................................................................
ENSSSCP00000021918  ..............................................................................
ENSSSCP00000009325  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000001973  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000006160  ..............................................................................
ENSSSCP00000023414  ..............................................................................
ENSSSCP00000029303  ..............................................................................
ENSSSCP00000008285  ..............................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000029039  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000006832  ..............................................................................
ENSSSCP00000006161  ..............................................................................
ENSSSCP00000018218  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000001598  ..............................................................................
ENSSSCP00000030976  ..............................................................................
ENSSSCP00000011839  ..............................................................................
ENSSSCP00000030667  ..............................................................................
ENSSSCP00000001317  ..............................................................................
ENSSSCP00000003232  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000010319  ..............................................................................
ENSSSCP00000022089  ..............................................................................
ENSSSCP00000007459  ..............................................................................
ENSSSCP00000001326  ..............................................................................
ENSSSCP00000001327  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000025497  ..............................................................................
ENSSSCP00000030716  ..............................................................................
ENSSSCP00000029973  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000026569  ..............................................................................
ENSSSCP00000000431  ..............................................................................
ENSSSCP00000020796  ..............................................................................
ENSSSCP00000012801  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000020492  ..............................................................................
ENSSSCP00000008085  ..............................................................................
ENSSSCP00000018239  ..............................................................................
ENSSSCP00000021088  ..............................................................................
ENSSSCP00000003894  ..............................................................................
ENSSSCP00000020352  ..............................................................................
ENSSSCP00000024007  ..............................................................................
ENSSSCP00000012140  ..............................................................................
ENSSSCP00000015856  ..............................................................................
ENSSSCP00000000096  ..............................................................................
ENSSSCP00000022990  ..............................................................................
ENSSSCP00000009188  ..............................................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000012497  ..............................................................................
ENSSSCP00000031041  ..............................................................................
ENSSSCP00000004838  ..............................................................................
ENSSSCP00000025331  ..............................................................................
ENSSSCP00000006405  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000005821  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000008984  ..............................................................................
ENSSSCP00000004615  ..............................................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000004918  ..............................................................................
ENSSSCP00000007532  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008985  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008158  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000026169  ..............................................................................
ENSSSCP00000023415  ..............................................................................
ENSSSCP00000027051  ..............................................................................
ENSSSCP00000026077  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000027650  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000023361  ..............................................................................
ENSSSCP00000026213  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000016447  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000021829  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016390  ..............................................................................
ENSSSCP00000004039  ..............................................................................
ENSSSCP00000014354  ..............................................................................
ENSSSCP00000020506  ..............................................................................
ENSSSCP00000001881  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000005883  ..............................................................................
ENSSSCP00000004543  ..............................................................................
ENSSSCP00000003039  ..............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000027862  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000018099  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000004614  ..............................................................................
ENSSSCP00000027678  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000003680  ..............................................................................
ENSSSCP00000001127  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000001629  ..............................................................................
ENSSSCP00000005988  ..............................................................................
ENSSSCP00000024916  ..............................................................................
ENSSSCP00000021132  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000005893  ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000011596  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000018222  ..............................................................................
ENSSSCP00000029355  ..............................................................................
ENSSSCP00000003233  ..............................................................................
ENSSSCP00000023342  ..............................................................................
ENSSSCP00000023857  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000023656  ..............................................................................
ENSSSCP00000001565  ..............................................................................
ENSSSCP00000003907  ..............................................................................
ENSSSCP00000012436  ..............................................................................
ENSSSCP00000001558  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000010407  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000026273  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000015120  tsigvfl.......................................................................
ENSSSCP00000029926  tsigvfl.......................................................................
ENSSSCP00000019261  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000019207  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000000712  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000008559  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000010021  ..............................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000020574  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000022958  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000021247  ..............................................................................
ENSSSCP00000012777  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000028807  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000027978  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000014530  ..............................................................................
ENSSSCP00000023947  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000026588  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000004471  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000026906  ..............................................................................
ENSSSCP00000016389  ..............................................................................
ENSSSCP00000006954  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000020473  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000030974  ..............................................................................
ENSSSCP00000019430  ..............................................................................
ENSSSCP00000022637  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000017077  ..............................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000009337  ..............................................................................
ENSSSCP00000019007  ..............................................................................
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  ..............................................................................
ENSSSCP00000019007  ..............................................................................
ENSSSCP00000023477  ..............................................................................
ENSSSCP00000009452  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000022093  ..............................................................................
ENSSSCP00000027047  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000011072  ..............................................................................
ENSSSCP00000023964  ..............................................................................


                                                           10        20        30        40        5
                                                            |         |         |         |         
d1ux6a1               .............................TDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNSDPGLAVGYDEF
ENSSSCP00000029807  .............................TDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEF
ENSSSCP00000005158  .............................TDFRRFQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEF
ENSSSCP00000015013  .............................TDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAF
ENSSSCP00000015012  .............................TDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAF
ENSSSCP00000014796  .............................TDFRAFQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAF
ENSSSCP00000006952  .............................TDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAF
ENSSSCP00000004335  .............................TDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEF
ENSSSCP00000014907  .............................-------------------------------------------------
ENSSSCP00000005280  .............................-------------------------------------------------
ENSSSCP00000024403  .............................-------------------------------------------------
ENSSSCP00000001201  .............................-------------------------------------------------
ENSSSCP00000029440  .............................-------------------------------------------------
ENSSSCP00000001416  .............................-------------------------------------------------
ENSSSCP00000029869  .............................-------------------------------------------------
ENSSSCP00000030828  .............................-------------------------------------------------
ENSSSCP00000026179  .............................-------------------------------------------------
ENSSSCP00000014929  .............................-------------------------------------------------
ENSSSCP00000029385  .............................-------------------------------------------------
ENSSSCP00000001288  .............................-------------------------------------------------
ENSSSCP00000024192  .............................-------------------------------------------------
ENSSSCP00000015699  .............................-------------------------------------------------
ENSSSCP00000001200  .............................-------------------------------------------------
ENSSSCP00000008754  .............................-------------------------------------------------
ENSSSCP00000015688  .............................-------------------------------------------------
ENSSSCP00000029029  .............................-------------------------------------------------
ENSSSCP00000014840  .............................-------------------------------------------------
ENSSSCP00000021212  .............................-------------------------------------------------
ENSSSCP00000014732  apmlqkppyqdglkpegidkdiwlhqkmk-------------------------------------------------
ENSSSCP00000003582  .............................-------------------------------------------------
ENSSSCP00000005042  .............................-------------------------------------------------
ENSSSCP00000009237  .............................-------------------------------------------------
ENSSSCP00000006271  .............................-------------------------------------------------
ENSSSCP00000006272  .............................-------------------------------------------------
ENSSSCP00000009236  .............................-------------------------------------------------
ENSSSCP00000007533  .............................-------------------------------------------------
ENSSSCP00000014615  .............................-------------------------------------------------
ENSSSCP00000022095  .............................-------------------N-----------------------------
ENSSSCP00000027530  .............................-------------------------------------------------
ENSSSCP00000024940  .............................------------------AHPSLEVSEDGKRVSS-RRMAPGLAAGHHQ-
ENSSSCP00000002077  .............................-------------------------------------------------
ENSSSCP00000023787  .............................-------------------------------------------------
ENSSSCP00000004776  .............................------------PSGFSSDHGFWI-------------------------
ENSSSCP00000021310  .............................------------PSGFSSDHGFWI-------------------------
ENSSSCP00000004184  .............................-------------------------------------------------
ENSSSCP00000003925  .............................-------------------------------------------------
ENSSSCP00000027015  .............................-------------------------------------------------
ENSSSCP00000008227  .............................-------------------------------------------------
ENSSSCP00000005767  .............................-------------------------------------------------
ENSSSCP00000024925  .............................-------------------------------------------------
ENSSSCP00000018810  .............................-------------------------------------------------
ENSSSCP00000014885  .............................-------------------------------------------------
ENSSSCP00000028656  .............................-------------------------------------------------
ENSSSCP00000030393  .............................-------------------------------------------------
ENSSSCP00000030993  .............................-------------------------------------------------
ENSSSCP00000012889  .............................-------------------------------------------------
ENSSSCP00000029279  .............................-------------------------------------------------
ENSSSCP00000030659  .............................-------------------------------------------------
ENSSSCP00000005403  .............................-------------------------------------------------
ENSSSCP00000001314  .............................---------------L---------------------------------
ENSSSCP00000009454  .............................-------------------------------------------------
ENSSSCP00000001560  .............................-------------------------------------------------
ENSSSCP00000001564  .............................-------------------------------------------------
ENSSSCP00000023159  .............................-------------------------------------------------
ENSSSCP00000028586  .............................-------------------------------------------------
ENSSSCP00000021328  .............................-------------------------------------------------
ENSSSCP00000021030  .............................-------------------------------------------------
ENSSSCP00000001553  .............................-------------------------------------------------
ENSSSCP00000015601  .............................-------------------------------------------------
ENSSSCP00000001716  .............................-------------------------------------------------
ENSSSCP00000019609  .............................-------------------------------------------------
ENSSSCP00000022993  .............................-------------------------------------------------
ENSSSCP00000001312  .............................-------------------------S-----------------------
ENSSSCP00000029343  .............................-------------------------------------------------
ENSSSCP00000015849  .............................-------------------------------------------------
ENSSSCP00000005434  .............................-------------------------------------------------
ENSSSCP00000030635  .............................-------------------------------------------------
ENSSSCP00000019990  .............................-------------------------------------------------
ENSSSCP00000021698  .............................-------------------------------------------------
ENSSSCP00000025036  .............................-------------------------------------------------
ENSSSCP00000018810  .............................-------------------------------------------------
ENSSSCP00000015851  .............................-------------------------------------------------
ENSSSCP00000013361  .............................-------------------------------------------------
ENSSSCP00000009456  .............................-------------------------------------------------
ENSSSCP00000018791  .............................-------------------------------------------------
ENSSSCP00000010821  .............................-------------------------------------------------
ENSSSCP00000000129  .............................-------------------------------------------------
ENSSSCP00000011201  .............................-------------------------------------------------
ENSSSCP00000015852  .............................-------------------------------------------------
ENSSSCP00000017851  .............................-------------------------------------------------
ENSSSCP00000009455  .............................-------------------------------------------------
ENSSSCP00000012112  .............................-------------------------------------------------
ENSSSCP00000006826  .............................-------------------------------------------------
ENSSSCP00000029570  .............................-------------------------------------------------
ENSSSCP00000018163  .............................-------------------------------------------------
ENSSSCP00000005380  .............................-------------------------------------------------
ENSSSCP00000000853  .............................-------------------------------------------------
ENSSSCP00000009453  .............................-------------------------------------------------
ENSSSCP00000008124  .............................---------------W---------------------------------
ENSSSCP00000025878  .............................-------------------------------------------------
ENSSSCP00000026387  .............................-------------------------------------------------
ENSSSCP00000019654  .............................-------------------------------------------------
ENSSSCP00000024906  .............................---------------------------S---------------------
ENSSSCP00000015599  .............................-------------------------------------------------
ENSSSCP00000024988  .............................-------------------------------------------------
ENSSSCP00000024616  .............................-------------------------------------------------
ENSSSCP00000021918  .............................-------------------------------------------------
ENSSSCP00000009325  .............................-------------------------------------------------
ENSSSCP00000022455  .............................-------------------------------------------------
ENSSSCP00000010821  .............................-------------------------------------------------
ENSSSCP00000001973  .............................-------------------------------------------------
ENSSSCP00000017851  .............................-------------------------------------------------
ENSSSCP00000022455  .............................-------------------------------------------------
ENSSSCP00000013885  .............................-------------------------------------------------
ENSSSCP00000006160  .............................-------------------------------------------------
ENSSSCP00000023414  .............................-------------------------------------------------
ENSSSCP00000029303  .............................-------------------------------------------------
ENSSSCP00000008285  .............................-------------------------------------------------
ENSSSCP00000024906  .............................------T------------------------------------------
ENSSSCP00000005158  .............................-------------------------------------------------
ENSSSCP00000029039  .............................-------------------------------------------------
ENSSSCP00000018428  .............................-------------------------------------------------
ENSSSCP00000006832  .............................-------------------------------------------------
ENSSSCP00000006161  .............................-------------------------------------------------
ENSSSCP00000018218  .............................-------------------------------------------------
ENSSSCP00000018024  .............................-------------------------------------------------
ENSSSCP00000001598  .............................-------------------------------------------------
ENSSSCP00000030976  .............................-------------------------------------------------
ENSSSCP00000011839  .............................-------------------------------------------------
ENSSSCP00000030667  .............................-------------------------------------------------
ENSSSCP00000001317  .............................-------------------------------------------------
ENSSSCP00000003232  .............................-----------------------------------IRGKPAVCFSKNPE
ENSSSCP00000013851  .............................-------------------------------------------------
ENSSSCP00000023132  .............................-------------------------------------------------
ENSSSCP00000016666  .............................-------------------------------------------------
ENSSSCP00000004335  .............................-------------------------------------------------
ENSSSCP00000019848  .............................-------------------------------------------------
ENSSSCP00000010319  .............................-------------------------------------------------
ENSSSCP00000022089  .............................-------------------GAVWAVEGRGGRLWALTAPEPTLL------
ENSSSCP00000007459  .............................-------------------------------------------------
ENSSSCP00000001326  .............................----------------------W--------------------------
ENSSSCP00000001327  .............................-------------------GAVWAVEGRGGRLWALTAPEPTLL------
ENSSSCP00000005851  .............................---------------------------------T---------------
ENSSSCP00000010214  .............................--------------------------------------QPTRLVAEFDF
ENSSSCP00000025497  .............................-------------------------------------------------
ENSSSCP00000030716  .............................-------------------------------------------------
ENSSSCP00000029973  .............................-------------------------------------------------
ENSSSCP00000004541  .............................-------------------------------------------------
ENSSSCP00000026569  .............................-------------------------------------------------
ENSSSCP00000000431  .............................-------------------------------------------------
ENSSSCP00000020796  .............................-------------------------------------------------
ENSSSCP00000012801  .............................-------------------------------------------------
ENSSSCP00000016666  .............................-------------------------------------------------
ENSSSCP00000023132  .............................-------------------------------------------------
ENSSSCP00000019848  .............................-------------------------------------------------
ENSSSCP00000006241  .............................-------------------------------------------------
ENSSSCP00000020492  .............................-------------------------------------------------
ENSSSCP00000008085  .............................-------------------------------------------------
ENSSSCP00000018239  .............................-------------------------------------------------
ENSSSCP00000021088  .............................-------------------------------------------------
ENSSSCP00000003894  .............................-------------------------------------------------
ENSSSCP00000020352  .............................-------------------------------------------------
ENSSSCP00000024007  .............................-------------------------------------------------
ENSSSCP00000012140  .............................-------------------------------------------------
ENSSSCP00000015856  .............................-------------------------------------------------
ENSSSCP00000000096  .............................-------------S-----------------------------------
ENSSSCP00000022990  .............................-------------------------------------------------
ENSSSCP00000009188  .............................-------------------------------------------------
ENSSSCP00000030087  .............................-------------------------------------------------
ENSSSCP00000012497  .............................-------------------------------------------------
ENSSSCP00000031041  .............................-------------------------------T-----------------
ENSSSCP00000004838  .............................-------------------------------------------------
ENSSSCP00000025331  .............................-------------------------------------------------
ENSSSCP00000006405  .............................-------------------------------T-----------------
ENSSSCP00000013851  .............................-------------------------------------------------
ENSSSCP00000005821  .............................-------------------------------------------------
ENSSSCP00000004541  .............................-------------------------------------------------
ENSSSCP00000021819  .............................-------------------------------------------------
ENSSSCP00000018415  .............................------------------------------------------------F
ENSSSCP00000013851  .............................---------------------------------------C---------
ENSSSCP00000010214  .............................-------------------------------------------------
ENSSSCP00000011618  .............................-------------------------------------------------
ENSSSCP00000008984  .............................-------------------------------------------------
ENSSSCP00000004615  .............................-------------------------------------------------
ENSSSCP00000030087  .............................--------------------------------------QPTRLVAEFDF
ENSSSCP00000004918  .............................-------------------------------------------------
ENSSSCP00000007532  .............................-------------------------------------------------
ENSSSCP00000004775  .............................-------------------------------------------------
ENSSSCP00000008985  .............................-------------------D-----------------------------
ENSSSCP00000018428  .............................-------------------------------------------------
ENSSSCP00000004775  .............................-------------------------------------------------
ENSSSCP00000008158  .............................-------------------------------------------------
ENSSSCP00000013851  .............................-----------------F-------------------------------
ENSSSCP00000026169  .............................-------------------------------------------------
ENSSSCP00000023415  .............................-------------------------------------------------
ENSSSCP00000027051  .............................-------------------------------------------------
ENSSSCP00000026077  .............................-------------------------------------------------
ENSSSCP00000004541  .............................-------------------------------------------------
ENSSSCP00000027650  .............................-------------------------------------------------
ENSSSCP00000019848  .............................-------------------------------------------------
ENSSSCP00000023361  .............................-------------------------------------------------
ENSSSCP00000026213  .............................-------------------------------------------------
ENSSSCP00000023132  .............................-------------------------------------------------
ENSSSCP00000008195  .............................-------------------------------------------------
ENSSSCP00000006241  .............................----------L--------------------------------------
ENSSSCP00000025417  .............................-------------------------------------------------
ENSSSCP00000016447  .............................-------------------------------------------------
ENSSSCP00000021819  .............................-------------------------------------------------
ENSSSCP00000006241  .............................-------------------------------------------------
ENSSSCP00000019848  .............................---------I---------------------------------------
ENSSSCP00000021829  .............................--------------G----------------------------------
ENSSSCP00000020853  .............................-------------------------------------------------
ENSSSCP00000013851  .............................-------------------------------------------------
ENSSSCP00000016390  .............................-------------------------------------------------
ENSSSCP00000004039  .............................-------------------------------------------I-----
ENSSSCP00000014354  .............................-------------------------------------------------
ENSSSCP00000020506  .............................-------------------------------------------------
ENSSSCP00000001881  .............................-------------------------------------------------
ENSSSCP00000013851  .............................-------------------------------------------------
ENSSSCP00000016666  .............................-------------------------------------------------
ENSSSCP00000005883  .............................-------------------------------------------------
ENSSSCP00000004543  .............................-------------------------------------------------
ENSSSCP00000003039  .............................-------------------------------------------------
ENSSSCP00000018415  .............................----------------------W--------------------------
ENSSSCP00000027862  .............................-------------------------------------------------
ENSSSCP00000004541  .............................---------V---------------------------------------
ENSSSCP00000018099  .............................-------------------------------------------------
ENSSSCP00000012904  .............................-------------------------------------------------
ENSSSCP00000030031  .............................-------------------------------------------------
ENSSSCP00000004614  .............................-------------------------------------------------
ENSSSCP00000027678  .............................-------------------------------------------------
ENSSSCP00000017907  .............................-------------------------------------------------
ENSSSCP00000027979  .............................-------------------------------------------------
ENSSSCP00000004016  .............................-------------------------------------------------
ENSSSCP00000003680  .............................-------------------------------------------------
ENSSSCP00000001127  .............................-------------------------------------------------
ENSSSCP00000006241  .............................-------------------------------------------------
ENSSSCP00000001629  .............................-------------------------------------------------
ENSSSCP00000005988  .............................-------------------------------------------------
ENSSSCP00000024916  .............................-------------------------------------------------
ENSSSCP00000021132  .............................-------------------------------------------------
ENSSSCP00000017907  .............................-------------------------------------------------
ENSSSCP00000005893  .............................----------------------------------------------K--
ENSSSCP00000029807  .............................-------------------------------------------------
ENSSSCP00000011596  .............................-------------------------------------------------
ENSSSCP00000002048  .............................-------------------------------------------------
ENSSSCP00000001310  .............................-------------------------------------------------
ENSSSCP00000028578  .............................-------------------------------------------------
ENSSSCP00000012112  .............................-------------------------------------------------
ENSSSCP00000018222  .............................-------------------------------------------------
ENSSSCP00000029355  .............................-------------------------------------------------
ENSSSCP00000003233  .............................-------------------------------------------------
ENSSSCP00000023342  .............................-------------------------------------------------
ENSSSCP00000023857  .............................-------------------------------------------------
ENSSSCP00000026405  .............................-------------------------------------------------
ENSSSCP00000023656  .............................-------------------------------------------------
ENSSSCP00000001565  .............................-------------------------------------------------
ENSSSCP00000003907  .............................-------------------------------------------------
ENSSSCP00000012436  .............................-------------------------------------------------
ENSSSCP00000001558  .............................-------------------------------------------------
ENSSSCP00000004775  .............................-------------------------------------------------
ENSSSCP00000010407  .............................-------------------------------------------------
ENSSSCP00000027979  .............................---------------------------K---------------------
ENSSSCP00000004016  .............................---------------------------K---------------------
ENSSSCP00000026273  .............................-------------------------------------------------
ENSSSCP00000027979  .............................-------------------------------------------------
ENSSSCP00000004016  .............................-------------------------------------------------
ENSSSCP00000015120  .............................-------------------------------------------------
ENSSSCP00000029926  .............................-------------------------------------------------
ENSSSCP00000019261  .............................-------------------------------------------------
ENSSSCP00000027979  .............................-------------------------------------------------
ENSSSCP00000004016  .............................-------------------------------------------------
ENSSSCP00000019207  .............................-------------------------------------------------
ENSSSCP00000025417  .............................-------------------------------------------------
ENSSSCP00000024968  .............................-------------------------------------------------
ENSSSCP00000001308  .............................-------------------------------------------------
ENSSSCP00000004775  .............................-------------------------------------------------
ENSSSCP00000025895  .............................-------------------------------------------------
ENSSSCP00000022922  .............................-------------------------------------------------
ENSSSCP00000002048  .............................-------------------------------------------------
ENSSSCP00000000712  .............................----------------------------GLSVHYSQDSSLIYWFNGTQA
ENSSSCP00000022455  .............................-------------------------------------------------
ENSSSCP00000001310  .............................-------------------------------------------------
ENSSSCP00000028578  .............................-------------------------------------------------
ENSSSCP00000016392  .............................------------------------------------------F------
ENSSSCP00000008559  .............................-------------------------------------------------
ENSSSCP00000021819  .............................--------------------------------------S----------
ENSSSCP00000003203  .............................-------------------------------------------------
ENSSSCP00000010021  .............................-----------------------------A-------------------
ENSSSCP00000010815  .............................-------------------------------------------------
ENSSSCP00000020574  .............................-------------------------------------------------
ENSSSCP00000016666  .............................-------------------------------------------------
ENSSSCP00000022958  .............................-------------------------------------------------
ENSSSCP00000005978  .............................-------------------------------------------------
ENSSSCP00000017851  .............................-------------------------------------------------
ENSSSCP00000021247  .............................-------------------------------------------------
ENSSSCP00000012777  .............................-------------------------------------------------
ENSSSCP00000006241  .............................-------------------------------------------------
ENSSSCP00000028807  .............................-------------------------------------------------
ENSSSCP00000013885  .............................---------------------------G---------------------
ENSSSCP00000025417  .............................-------------------------------------------------
ENSSSCP00000004775  .............................-------------------------------------------------
ENSSSCP00000024968  .............................-------------------------------------------------
ENSSSCP00000000277  .............................-------------------------------------------------
ENSSSCP00000027978  .............................-------------------------------------------------
ENSSSCP00000005978  .............................-------------------------------------------------
ENSSSCP00000014530  .............................------------------------------------------VLGTQDL
ENSSSCP00000023947  .............................-------------------------------------------------
ENSSSCP00000025895  .............................-------------------------------------------------
ENSSSCP00000022922  .............................-------------------------------------------------
ENSSSCP00000005978  .............................-------------------------------------------------
ENSSSCP00000026588  .............................-------------------------------------------------
ENSSSCP00000001308  .............................-------------------------------------------------
ENSSSCP00000000277  .............................-------------------------------------------------
ENSSSCP00000004471  .............................-------------------------------------------------
ENSSSCP00000004541  .............................-------------------------------------------------
ENSSSCP00000020853  .............................-------------------------------------------------
ENSSSCP00000006241  .............................-------------------------------------------------
ENSSSCP00000026906  .............................-------------------------------------------------
ENSSSCP00000016389  .............................--------------G----------------------------------
ENSSSCP00000006954  .............................-------------------------------------------------
ENSSSCP00000015012  .............................-------------------------------------SDPT-------L
ENSSSCP00000016392  .............................-------------------------------------------------
ENSSSCP00000027979  .............................-------------------------------------------------
ENSSSCP00000004016  .............................-------------------------------------------------
ENSSSCP00000020473  .............................-----------------------------------F-------------
ENSSSCP00000008195  .............................-------------------------------------------------
ENSSSCP00000030974  .............................-------------------------------------------------
ENSSSCP00000019430  .............................------------------------------S------------------
ENSSSCP00000022637  .............................-------------------------------------------------
ENSSSCP00000014907  .............................-------------------------------------------------
ENSSSCP00000017077  .............................-------------------------------------------------
ENSSSCP00000010815  .............................-------------------------------------------------
ENSSSCP00000009337  .............................-------------------------------L-----------------
ENSSSCP00000019007  .............................-------------------------------------------------
ENSSSCP00000024991  .............................-------------------------------------------------
ENSSSCP00000009843  .............................-------------------------------------------------
ENSSSCP00000019007  .............................-------------------------------------------------
ENSSSCP00000023477  .............................-------------------------------------------------
ENSSSCP00000009452  .............................-------------------------------------------------
ENSSSCP00000003203  .............................-------------------------------------------------
ENSSSCP00000003203  .............................-----------------------------------L-------------
ENSSSCP00000022093  .............................-------------------------------------------------
ENSSSCP00000027047  .............................-------------------------------------------------
ENSSSCP00000006952  .............................-------------------------------------------------
ENSSSCP00000011072  .............................-------------------------------------------------
ENSSSCP00000023964  .............................-------------------------------------------------


                      0        60        70        80        90           100        110       120  
                      |         |         |         |         |             |          |         |  
d1ux6a1               NAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTN....PTR.AQGYSGLSVKVVKSTTGPGEHL
ENSSSCP00000029807  NAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTN....PTR.AQGYSGLSVKVVNSTTGPGEHL
ENSSSCP00000005158  NAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTN....PTR.AQGYSGLSVKVVNSTTGPGEHL
ENSSSCP00000015013  NGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQAT....PFR.AVAEPGIQLKAVKSKTGPGEHL
ENSSSCP00000015012  NGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQAT....PFR.AVAEPGIQLKAVKSKTGPGEHL
ENSSSCP00000014796  NGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQAN....PFR.AVAEPGIQLKAVKSSTGPGEQL
ENSSSCP00000006952  NGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQAT....PFR.AVAQPGLQLKAVTSVSGPGEHL
ENSSSCP00000004335  GSVDFSGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQ....PTR.AYGYSGVSLKVVNSTTGTGEHL
ENSSSCP00000014907  ------------------------------------------------....---.--------------T-------
ENSSSCP00000005280  -----------------------------------------Q------....---.----------------------
ENSSSCP00000024403  -------------------------------Y----------------....---.----------------------
ENSSSCP00000001201  -------------------------------Y----------------....---.----------------------
ENSSSCP00000029440  -------------------------------Y----------------....---.----------------------
ENSSSCP00000001416  ------------------------------------------------....---.----------------------
ENSSSCP00000029869  ------------------------------------------------....---.----------------------
ENSSSCP00000030828  ------------------------------------------------....---.----------------------
ENSSSCP00000026179  ------------------------------------------------....---.-------V--------------
ENSSSCP00000014929  ------------------------------------------------....---.----------------------
ENSSSCP00000029385  ------------------------------------------------....---.----------------------
ENSSSCP00000001288  ------------------------------------------------....---.----------------------
ENSSSCP00000024192  ------------------------------------------------....---.----------------------
ENSSSCP00000015699  ----------------------------S-------------------....---.----------------------
ENSSSCP00000001200  ------------------------------------------------....---.----------------------
ENSSSCP00000008754  ------------------------------------------------....---.------------------G---
ENSSSCP00000015688  ------------------------------------------------....---.----------------------
ENSSSCP00000029029  ------------------------------------------------....---.------L---------------
ENSSSCP00000014840  ------------------------------------------------....---.----------------------
ENSSSCP00000021212  ------------------------------------------------....---.----------------------
ENSSSCP00000014732  ------------------------------------------------....---.----------------------
ENSSSCP00000003582  ------------------------------------------------....---.----------------------
ENSSSCP00000005042  ------------------------------------------------....---.----------------------
ENSSSCP00000009237  ------------------------------------------------....---.----------------------
ENSSSCP00000006271  ------------------------------------------------....---.----------------------
ENSSSCP00000006272  ------------------------------------------------....---.----------------------
ENSSSCP00000009236  ------------------------------------------------....---.----------------------
ENSSSCP00000007533  ------------------------------------------------....---.----------------------
ENSSSCP00000014615  ------------------------------------------------....---.----------------------
ENSSSCP00000022095  ------------------------------------------------....---.----------------------
ENSSSCP00000027530  ------------------------------------------------....---.----------------------
ENSSSCP00000024940  ------------------------------------------------....---.----------------------
ENSSSCP00000002077  -----------------------F------------------------....---.----------------------
ENSSSCP00000023787  -----------------------F------------------------....---.----------------------
ENSSSCP00000004776  ------------------------------------------------....---.----------------------
ENSSSCP00000021310  ------------------------------------------------....---.----------------------
ENSSSCP00000004184  ------------------------------------------------....---.---C------------------
ENSSSCP00000003925  ------------------------------------------------....---.----------------------
ENSSSCP00000027015  --------------------------------D---------------....---.----------------------
ENSSSCP00000008227  ------------------------------------------------....---.----------------------
ENSSSCP00000005767  ------------------------------------------------....---.----------------------
ENSSSCP00000024925  ----------------------------N-------------------....---.----------------------
ENSSSCP00000018810  -----------QTGHRDNDIAFHFNPRFEEGGYVV-------------....---.----------------------
ENSSSCP00000014885  ------------------------------------------------....---.----------------------
ENSSSCP00000028656  ------------------------------------------------....---.----------------------
ENSSSCP00000030393  ------------------------------------------------....---.----------------------
ENSSSCP00000030993  ------------------------------------------------....---.----------------------
ENSSSCP00000012889  ------------------------------------------------....---.----------------------
ENSSSCP00000029279  ------------------------------------------------....---.----------------------
ENSSSCP00000030659  ------------------------------------------------....---.----------------------
ENSSSCP00000005403  ------------------------------------------------....---.A---------------------
ENSSSCP00000001314  ------------------------------------------------....---.----------------------
ENSSSCP00000009454  ------------------------------------------------....---.--W-------------------
ENSSSCP00000001560  ---------------------------PEKKFWVVMYKEGKVSV----....---.----------------------
ENSSSCP00000001564  ---------------------------PEKKFWVVMYKEGKVSV----....---.----------------------
ENSSSCP00000023159  ------------------------------------------------....---.----------------------
ENSSSCP00000028586  ---------------------------PEKKFWVVMYKEGKVSV----....---.----------------------
ENSSSCP00000021328  ---KVGKTLKIKGKIDDDADGFVINLGQGTDKLALHF-----------....---.----------------------
ENSSSCP00000021030  ------------------------------------------------....---.----------------------
ENSSSCP00000001553  ------------------------------------------------....---.----------------------
ENSSSCP00000015601  ------------------------------------------------....---.----------------------
ENSSSCP00000001716  ---------------------------------C--------------....---.----------------------
ENSSSCP00000019609  ------------------------------------------------....---.----------------------
ENSSSCP00000022993  ------------------------------------------------....---.----------------------
ENSSSCP00000001312  ------------------------------------------------....---.----------------------
ENSSSCP00000029343  ------------------------------------------------....---.----------------------
ENSSSCP00000015849  --------------------------DSEDAFLLFSMKVNDQY-----....---.----------------------
ENSSSCP00000005434  ----------------------------------LDFKKGNDVAFHFN....P--.----------------------
ENSSSCP00000030635  ----------------------------------LDFKKGNDVAFHFN....P--.----------------------
ENSSSCP00000019990  ------------------------------------------------....---.----------------------
ENSSSCP00000021698  -----------------------LSAQGVSMNRLPGWDK---------....---.----------------------
ENSSSCP00000025036  ------------------------------------------------....---.----------------------
ENSSSCP00000018810  ------------------------------------------------....---.----------------------
ENSSSCP00000015851  ---------------------------SEDAFLLFSMKVNDQY-----....---.----------------------
ENSSSCP00000013361  ------------------------------------------------....---.----------------------
ENSSSCP00000009456  -----------------------------------------------P....PTP.DNGCWKIQVRATTSGTG-----
ENSSSCP00000018791  ------------------------------------------------....---.---------------T------
ENSSSCP00000010821  ------------------------------------------------....---.----------------------
ENSSSCP00000000129  ------------------------------------------------....---.-------------------E--
ENSSSCP00000011201  ------------------------------------------------....---.----------------------
ENSSSCP00000015852  ------------------------------------------------....---.----------------------
ENSSSCP00000017851  ------------------------------------------------....---.----------------------
ENSSSCP00000009455  ------------------------------------------------....---.-N--------------------
ENSSSCP00000012112  ------------------------------------------------....---.---------------Q------
ENSSSCP00000006826  ------------------------------------------------....---.----------------------
ENSSSCP00000029570  ------------------------------------------------....---.----------------------
ENSSSCP00000018163  ----------------------------MYAFTVCMWLKATAAPGVGT....PFSyAVPGQANELVLIEWGNNPMEIL
ENSSSCP00000005380  ------------------------------------------------....---.----------------------
ENSSSCP00000000853  ------------------------------------------------....---.----------------------
ENSSSCP00000009453  ------------------------------------------------....---.D---------------------
ENSSSCP00000008124  ------------------------------------------------....---.----------------------
ENSSSCP00000025878  ------------------------------------------------....--P.----------------------
ENSSSCP00000026387  ------------------------------------------------....---.----------------------
ENSSSCP00000019654  ------------------------------------------------....---.----------------------
ENSSSCP00000024906  ------------------------------------------------....---.----------------------
ENSSSCP00000015599  --------------------------------------------WRYK....P--.----------------------
ENSSSCP00000024988  ------------------------------------------------....---.----------------------
ENSSSCP00000024616  ------------------------------------------------....---.----------------------
ENSSSCP00000021918  ------------------------------------------------....---.----------------------
ENSSSCP00000009325  ------------------------------------------------....---.----------------------
ENSSSCP00000022455  ------------------------------------------------....---.----------------------
ENSSSCP00000010821  ------------------------------------------------....---.--------------K-------
ENSSSCP00000001973  ------------------T-----------------------------....---.----------------------
ENSSSCP00000017851  -------------------------------------KNSYQAFQITL....EFR.AEAEDGLLLYCGENEHGRGDFM
ENSSSCP00000022455  -------------------------------------KNSYQAFQITL....EFR.AEAEDGLLLYCGENEHGRGDFM
ENSSSCP00000013885  ------------------------------------------------....---.----------------------
ENSSSCP00000006160  ------------------------------------------------....---.----------------------
ENSSSCP00000023414  ------------------------------------------------....---.----C-----------------
ENSSSCP00000029303  ------------------------------------------P-----....---.----------------------
ENSSSCP00000008285  ------------------------------------------P-----....---.----------------------
ENSSSCP00000024906  ------------------------------------------------....---.----------------------
ENSSSCP00000005158  --------------------GQVFS-----------------------....---.----------------------
ENSSSCP00000029039  ------------------------------------------------....---.-----G----------------
ENSSSCP00000018428  ------------------------------------------------....---.--H-------------------
ENSSSCP00000006832  ------------------------------------------------....---.-VGGTGVTFKVPPSPDTPAHLC
ENSSSCP00000006161  ------------------------------------------------....---.----------------------
ENSSSCP00000018218  ------------------------------------------------....---.-------A--------------
ENSSSCP00000018024  ------------------------------------------------....---.----------------------
ENSSSCP00000001598  ------------------------------------------------....---.-----G----------------
ENSSSCP00000030976  ------------------------------------------------....---.-----G----------------
ENSSSCP00000011839  ------------------------------------------------....---.----------------------
ENSSSCP00000030667  ------------------------------------------------....---.-G--------------------
ENSSSCP00000001317  ------------------------------------------------....---.-G--------------------
ENSSSCP00000003232  MQVDF----HTEADGDSDI---AFHFRVSFGLYVRMNSRQNGSW----....---.----------------------
ENSSSCP00000013851  ----------------------------------------Y-------....---.----------------------
ENSSSCP00000023132  ------------------------------------------------....---.----------------------
ENSSSCP00000016666  ------------------------------------------------....---.----------------------
ENSSSCP00000004335  ------------------------------------------------....---.----------------GPADTL
ENSSSCP00000019848  ------------------------------------------------....---.----------------------
ENSSSCP00000010319  ----------------------------------------------S-....---.----------------------
ENSSSCP00000022089  ------------------------------------------------....---.----------------------
ENSSSCP00000007459  --------------------------------------------W---....---.----------------------
ENSSSCP00000001326  ------------------------------------------------....---.----------------------
ENSSSCP00000001327  ------------------------------------------------....---.----------------------
ENSSSCP00000005851  ------------------------------------------------....---.----------------------
ENSSSCP00000010214  RTFDPEGVLFFAGGRQD-------------------------------....---.----------------------
ENSSSCP00000025497  ------------------------------------------------....---.-----------V----------
ENSSSCP00000030716  ------------------------------------------------....---.---------------------I
ENSSSCP00000029973  ------------------------------------------------....---.---------------------I
ENSSSCP00000004541  ------------------------------------------------....---.----------------------
ENSSSCP00000026569  -----------------------FNSGDGNDFIAVELVKG--------....---.----------------------
ENSSSCP00000000431  ------------------------------------------------....---.----------------------
ENSSSCP00000020796  ------------------------------------------------....---.----------------------
ENSSSCP00000012801  ------------------------------------------------....---.-----G----------------
ENSSSCP00000016666  ------------------------------------------------....---.----------------------
ENSSSCP00000023132  ------------------------------------------------....---.------------------G---
ENSSSCP00000019848  ------------------------------------------------....---.----------------------
ENSSSCP00000006241  ------------------------------------------------....---.----------------------
ENSSSCP00000020492  --R---------------------------------------------....---.----------------------
ENSSSCP00000008085  ------------------------------------------------....---.----------------------
ENSSSCP00000018239  ------------------------------------------------....---.----------------------
ENSSSCP00000021088  ------------------------------------------------....---.----------------------
ENSSSCP00000003894  -----------------------------------------------R....---.----------------------
ENSSSCP00000020352  ------------------------------------------------....---.----------------------
ENSSSCP00000024007  ------------------------------------------------....---.----------------------
ENSSSCP00000012140  ------------------------------------------------....---.----------------------
ENSSSCP00000015856  ------------------------------------------------....---.-----G----------------
ENSSSCP00000000096  ------------------------------------------------....---.----------------------
ENSSSCP00000022990  ------------------------------------------------....---.----------------------
ENSSSCP00000009188  ------------------------------------------------....---.----------------------
ENSSSCP00000030087  ------------------------------------------------....---.----------------------
ENSSSCP00000012497  ------------------------------------------------....---.----------------------
ENSSSCP00000031041  ------------------------------------------------....---.----------------------
ENSSSCP00000004838  -N----------------------------------------------....---.----------------------
ENSSSCP00000025331  ------------------------------------------------....---.----------------------
ENSSSCP00000006405  ------------------------------------------------....---.----------------------
ENSSSCP00000013851  ------------------------------------------------....---.------------------G---
ENSSSCP00000005821  ------------------------------------------------....---.----------------------
ENSSSCP00000004541  ------------------------------------------------....---.----------------------
ENSSSCP00000021819  ------------------------------------------------....---.----------------------
ENSSSCP00000018415  ------------------------------------------------....---.----------------------
ENSSSCP00000013851  ------------------------------------------------....---.----------------------
ENSSSCP00000010214  ------------------------------------------------....---.----------------------
ENSSSCP00000011618  ------------------------------------------------....---.----------------------
ENSSSCP00000008984  ------------------------------------------T-----....---.----------------------
ENSSSCP00000004615  -----------------------------------------Q------....---.----------------------
ENSSSCP00000030087  RTFDPEGVLFFAGGRQD-------------------------------....---.----------------------
ENSSSCP00000004918  ------------------------------------------------....---.----------------------
ENSSSCP00000007532  ------------------------------------------------....---.----------------------
ENSSSCP00000004775  ------------------------------------------------....---.------------S---------
ENSSSCP00000008985  ------------------------------------------------....---.----------------------
ENSSSCP00000018428  ------------------------------------------------....---.------------------G---
ENSSSCP00000004775  ------------------------------------------------....---.----------------------
ENSSSCP00000008158  ------------------------------------------------....---.----------------------
ENSSSCP00000013851  ------------------------------------------------....---.----------------------
ENSSSCP00000026169  ------------------------------------------------....---.----------------------
ENSSSCP00000023415  ------------------------------------------------....---.----------------------
ENSSSCP00000027051  ------------------------------------------------....---.----------------------
ENSSSCP00000026077  ------------------------------------------------....---.----------------------
ENSSSCP00000004541  ------------------------------------------------....---.----------------------
ENSSSCP00000027650  ------------------------------------------------....---.----------------------
ENSSSCP00000019848  ------------------------------------------------....--K.----------------------
ENSSSCP00000023361  -------------------------------------------YWRYK....PK-.----------------------
ENSSSCP00000026213  ------------------------------------------------....---.----------------------
ENSSSCP00000023132  ------------------------------------------------....---.ARGPSGLLLYNGQKTDGKGDF-
ENSSSCP00000008195  -----------------------------G------------------....---.----------------------
ENSSSCP00000006241  ------------------------------------------------....---.----------------------
ENSSSCP00000025417  ------------------------------------WRRGTLSVDDET....PV-.----------------------
ENSSSCP00000016447  ---------------------------------P--------------....---.----------------------
ENSSSCP00000021819  ------------------------------------------------....---.---------------------L
ENSSSCP00000006241  ------------------------------------------------....---.---------------------L
ENSSSCP00000019848  ------------------------------------------------....---.----------------------
ENSSSCP00000021829  ------------------------------------------------....---.----------------------
ENSSSCP00000020853  ------------------------------------------------....---.----------------------
ENSSSCP00000013851  ------------------------------------------------....---.----------------GPGQWA
ENSSSCP00000016390  ---------------------------------------------I--....---.----------------------
ENSSSCP00000004039  ------------------------------------------------....---.----------------------
ENSSSCP00000014354  ------------------------------------------------....---.----------------------
ENSSSCP00000020506  ------------------------------------------------....---.----------------G-----
ENSSSCP00000001881  ------------------------------------------------....---.----------------G-----
ENSSSCP00000013851  ------------------------------------------------....---.----------------------
ENSSSCP00000016666  -------------------A----------------------------....---.----------------------
ENSSSCP00000005883  ------------------------------------------------....---.----------------------
ENSSSCP00000004543  ------------------------------------------------....---.----------------------
ENSSSCP00000003039  ------------------------------------------------....---.----------------------
ENSSSCP00000018415  ------------------------------------------------....---.----------------------
ENSSSCP00000027862  ------------------------------------------------....---.----------------------
ENSSSCP00000004541  ------------------------------------------------....---.----------------------
ENSSSCP00000018099  ------------------------------------------------....---.----------------------
ENSSSCP00000012904  ------------------------------DHGVCDWKQDVEDDFDWN....PAD.RDNAVGYYMA------------
ENSSSCP00000030031  ------------------------------DHGVCDWKQDVEDDFDWN....PAD.RDNAVGYYMA------------
ENSSSCP00000004614  --------------AEGDVLNFIFKNRELRSLFDRQWHK---------....---.----------------------
ENSSSCP00000027678  ------------------------------------------------....---.------------YHMYGAGTGL
ENSSSCP00000017907  ------------------------------------------------....---.----------------------
ENSSSCP00000027979  ------------------------------------------------....---.--GAEGKKL-------------
ENSSSCP00000004016  ------------------------------------------------....---.--GAEGKKL-------------
ENSSSCP00000003680  ------------------------------------------------....---.----------------------
ENSSSCP00000001127  -----------------D------------------------------....---.----------------------
ENSSSCP00000006241  ------------------------------------------------....---.----------------------
ENSSSCP00000001629  -----------------------------------------------R....PQI.AVTLNGVDKTLLFTTT----SV
ENSSSCP00000005988  ------------------------------------------------....---.----------------------
ENSSSCP00000024916  ------------------------------------------------....---.----------------------
ENSSSCP00000021132  ------------------------------------------------....---.----------------------
ENSSSCP00000017907  -----------------------FSLVSDNQWHVIQFK----------....---.----------------------
ENSSSCP00000005893  ------------------------------------------------....---.----------------------
ENSSSCP00000029807  ---------------------------------------------Q--....---.----------------------
ENSSSCP00000011596  ------------------------------------------------....---.----------------------
ENSSSCP00000002048  ------------------------------------------------....---.----------------------
ENSSSCP00000001310  ------------------------------------------------....---.----------------------
ENSSSCP00000028578  ------------------------------------------------....---.----------------------
ENSSSCP00000012112  ------------------------------------------------....---.----------------------
ENSSSCP00000018222  ------------------------------------------------....---.-------M--------------
ENSSSCP00000029355  ------------------------------------------------....---.-------M--------------
ENSSSCP00000003233  ------------------------------------------------....---.----------------------
ENSSSCP00000023342  ------------------------------------------------....---.----------------------
ENSSSCP00000023857  ------------------------------------------------....---.----------------------
ENSSSCP00000026405  --------------S---------------------------------....---.----------------------
ENSSSCP00000023656  ---------------D--------------------------------....---.----------------------
ENSSSCP00000001565  --------FRVLEKKGPDYRALICSNQDISQEELVQIEKDPQ------....---.----------------------
ENSSSCP00000003907  ---------------D--------------------------------....---.----------------------
ENSSSCP00000012436  ------------------------------------------------....---.-----K----------------
ENSSSCP00000001558  --------FRVLEKKGPDYRALICSNQDISQEELVQIEKDPQ------....---.----------------------
ENSSSCP00000004775  ------------------------------------------------....---.---------LMVNGSMFFSLEM
ENSSSCP00000010407  ------------------------------------------------....---.----------------------
ENSSSCP00000027979  ------------------------------------------------....---.----------------------
ENSSSCP00000004016  ------------------------------------------------....---.----------------------
ENSSSCP00000026273  ------------------------------------------------....---.----------------------
ENSSSCP00000027979  ------------------------------------------------....---.----------------------
ENSSSCP00000004016  ------------------------------------------------....---.----------------------
ENSSSCP00000015120  ------------------------------------------------....---.----------------------
ENSSSCP00000029926  ------------------------------------------------....---.----------------------
ENSSSCP00000019261  ------------------------------------------------....---.----------------------
ENSSSCP00000027979  ------------------------------------------------....---.----------------------
ENSSSCP00000004016  ------------------------------------------------....---.----------------------
ENSSSCP00000019207  ------------------F-----------------------------....---.----------------------
ENSSSCP00000025417  ------------------------------------------------....---.----------------------
ENSSSCP00000024968  ------------------------------------------------....---.----------------------
ENSSSCP00000001308  ------------------------------------------------....---.----------------------
ENSSSCP00000004775  ----FEGGFNFRTLQPN---GLLFYYASGSDVFSISLDNGTVT-----....---.----------------------
ENSSSCP00000025895  ------------------------------------------------....---.----------------------
ENSSSCP00000022922  ------------------------------------------------....---.----------------------
ENSSSCP00000002048  ------------------------------------------------....---.----------------------
ENSSSCP00000000712  VQVPLGGTAGLGSGPQDSL---------SDHFTLSFWMKHGVTP----....---.----------------------
ENSSSCP00000022455  ------------------------------------------------....---.----------------------
ENSSSCP00000001310  -----------------------------------------Q------....---.----------------------
ENSSSCP00000028578  -----------------------------------------Q------....---.----------------------
ENSSSCP00000016392  ------------------------------------------------....---.----------------------
ENSSSCP00000008559  ------------------------------------------------....---.----------------------
ENSSSCP00000021819  ------------------------------------------------....---.----------------------
ENSSSCP00000003203  ------------------------------------------------....---.---------------------L
ENSSSCP00000010021  ------------------------------------------------....---.----------------------
ENSSSCP00000010815  ------------------------------GFKAQRWHQGNEHYG---....---.----------------------
ENSSSCP00000020574  --------------------GILIHIQESSNYTTVKIKNGKVHFTSDA....GIA.GKV-------------------
ENSSSCP00000016666  ------------------------------------------------....---.--------------------MF
ENSSSCP00000022958  ------------------------------------------------....---.----------------------
ENSSSCP00000005978  ------------------------------------------------....---.----------------------
ENSSSCP00000017851  ------------------------------------------------....---.----------------------
ENSSSCP00000021247  ------------------------------------------------....QYQ.ATGGRGVALQVVREASQESKLL
ENSSSCP00000012777  ------G-----------------------------------------....---.----------------------
ENSSSCP00000006241  -----------------D------------------------------....---.----------------------
ENSSSCP00000028807  ------------------------------------------------....---.----------------------
ENSSSCP00000013885  ------------------------------------------------....---.----------------------
ENSSSCP00000025417  ------------------------------------------------....---.----------------------
ENSSSCP00000004775  ------------------------------------------------....---.----------------------
ENSSSCP00000024968  ------------------------------------------------....---.----------------------
ENSSSCP00000000277  ------------------------------------------------....---.----------------------
ENSSSCP00000027978  ------------------------------------------------....---.------------------G---
ENSSSCP00000005978  ------------------------------------------------....---.-----------------P----
ENSSSCP00000014530  EEETFEG-----------------------------------------....---.----------------------
ENSSSCP00000023947  ------------------------------------------------....---.----------------------
ENSSSCP00000025895  ------------------------------------------------....---.----------------------
ENSSSCP00000022922  ------------------------------------------------....---.----------------------
ENSSSCP00000005978  ------------------------------------------------....---.----------------------
ENSSSCP00000026588  ------------------------------------------------....---.----------------------
ENSSSCP00000001308  ------------------------------------------H-----....---.----------------------
ENSSSCP00000000277  ------------------------------------------------....---.----------------------
ENSSSCP00000004471  ---------------------L--------------------------....---.----------------------
ENSSSCP00000004541  ------------------------------------------------....---.-----------------P----
ENSSSCP00000020853  ------------------------------------------------....---.----------------------
ENSSSCP00000006241  ------------------------------------------------....---.----------------------
ENSSSCP00000026906  ------------------------------------------------....---.----------------------
ENSSSCP00000016389  ------------------------------------------------....---.----------------------
ENSSSCP00000006954  ------------------------------------------------....---.----------------G-----
ENSSSCP00000015012  NELYVISTFKLQTKSSATIFGLYSS-ADNSKYF---------------....---.----------------------
ENSSSCP00000016392  ------------------------------------------------....---.----------------------
ENSSSCP00000027979  --------------------------------------------T---....---.----------------------
ENSSSCP00000004016  --------------------------------------------T---....---.----------------------
ENSSSCP00000020473  ------------------------------------------------....---.----------------------
ENSSSCP00000008195  ------------------------------------------------....---.-------------G--------
ENSSSCP00000030974  ------------------------------------------------....---.----------------------
ENSSSCP00000019430  ------------------------------------------------....---.----------------------
ENSSSCP00000022637  -----------------------------------R------------....---.----------------------
ENSSSCP00000014907  ------------------------------------------------....---.----------------------
ENSSSCP00000017077  --------------T---------------------------------....---.----------------------
ENSSSCP00000010815  ------------------------------------------------....---.----------------------
ENSSSCP00000009337  ------------------------------------------------....---.----------------------
ENSSSCP00000019007  ------------------------------------------------....---.----------------------
ENSSSCP00000024991  ------------------------------------------------....---.-----------I----------
ENSSSCP00000009843  -----------------------------------------K------....---.----------------------
ENSSSCP00000019007  ------------------------------------------------....---.----------------------
ENSSSCP00000023477  -------------------------------LILYTWPANDRPSTRSDrlavGFS.TTVKDGI-LVRIDSAPGLGDFL
ENSSSCP00000009452  ------------------------------------------------....---.----------------G-----
ENSSSCP00000003203  ------------------------------------------------....---.----------------------
ENSSSCP00000003203  ------------------------------------------------....---.----------------------
ENSSSCP00000022093  ------------------L-----------------------------....---.----------------------
ENSSSCP00000027047  ------------------------------------------------....---.----------------------
ENSSSCP00000006952  ------------------------------------------------....---.----------------------
ENSSSCP00000011072  ---------------------------------------------V--....---.----------------------
ENSSSCP00000023964  ---------------------------------------------V--....---.----------------------


                            130       140           150       160       170             180       19
                              |         |             |         |         |               |         
d1ux6a1               RNAL.WHTGNTPGQVRTLWHDPR....HIGWKDFTAYRWRLSHRPKTGFIRVVMYEGK.KIM.....ADSGPIYDKTY
ENSSSCP00000029807  RNAL.WHTGNTPGQVRTLWHDPR....HIGWKDFTAYRWRLSHRPKTGFIRVVMYEGK.KIM.....ADSGPIYDKTY
ENSSSCP00000005158  RNAL.WHTGNTPGQVRTLWHDPR....HIGWKDFTAYRWRLSHRPKTGFIRVVMYEGK.KIM.....ADSGPIYDKTY
ENSSSCP00000015013  RNSL.WHTGDTSDQVRLLWKDSR....NVGWKDKVSYRWFLQHRPQVGYIRVRFYEGS.ELV.....ADSGVTIDTTM
ENSSSCP00000015012  RNSL.WHTGDTSDQVRLLWKDSR....NVGWKDKVSYRWFLQHRPQVGYIRVRFYEGS.ELV.....ADSGVTIDTTM
ENSSSCP00000014796  RNAL.WHTGDTASQVRLLWKDPR....NVGWKDKTSYRWFLQHRPQVGYIRVRFYEGP.ELV.....ADSNVVLDTTM
ENSSSCP00000006952  RNAL.WHTGHTPDQVRLLWTDPR....NVGWRDKTSYRWQLLHRPQVGYIRVKLYEGP.QLV.....ADSGAIIDTSM
ENSSSCP00000004335  RNAL.WHTGNTEGQVRTLWHDPK....NIGWKDYTAYRWHLTHRPKTGYIRVLVHEGK.QVM.....ADSGPIYDQTY
ENSSSCP00000014907  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005280  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000024403  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001201  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029440  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001416  ----.------------------....-----DSVSRKGELTPLPETGYWRVRLWNGD.KYA.....ATTTPF-----
ENSSSCP00000029869  ----.------------------....-----DSVSRKGELTPLPETGYWRVRLWNGD.KYA.....ATTTPF-----
ENSSSCP00000030828  ----.------------------....-----DSVSRKGELTPLPETGYWRVRLWNGD.KYA.....ATTTPF-----
ENSSSCP00000026179  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000014929  ----.----------SLSYDHSK....DGRWTELAGCTADLRNRNHDTFLAVRYSRGR.L--.....-----------
ENSSSCP00000029385  ----.------------------....-----------------PQNGFWAVSLWYGK.EY-.....-----------
ENSSSCP00000001288  ----.------------------....-----------------PQNGFWAVSLWYGK.EY-.....-----------
ENSSSCP00000024192  --M-.------------------....-------------------------------.---.....-----------
ENSSSCP00000015699  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001200  ----.------------------....--------------L----------------.---.....-----------
ENSSSCP00000008754  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000015688  ----.------------------....-----------------PHYGFWVIRLRKGS.E--.....-----------
ENSSSCP00000029029  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000014840  ----.------------------....-------------------------W-----.---.....-----------
ENSSSCP00000021212  ----.------------------....---------Y---------------------.---.....-----------
ENSSSCP00000014732  ----.------------------....------H------------------------.---.....-----------
ENSSSCP00000003582  ----.------------------....---------------LSPDRGFWTVSLR---.---.....-----------
ENSSSCP00000005042  ---A.------------------....-------------------------------.---.....-----------
ENSSSCP00000009237  ----.------------------....------------AFIMSPQNGFWAIRLYDGD.YWA.....LT---------
ENSSSCP00000006271  ----.------------------....--------TREGVFTMSPQNGFWAIRLYDGD.YWA.....LTS--------
ENSSSCP00000006272  ----.------------------....------------AFIMSPQNGFWAIRLYDGD.YWA.....LTS--------
ENSSSCP00000009236  ----.------------------....-------------FIMSPQNGFWAIRLYDGD.YWA.....LT---------
ENSSSCP00000007533  ----.------------------....--------TREGVFTMSPQNGFWAIRLYDGD.YWA.....LTS--------
ENSSSCP00000014615  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022095  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000027530  ----.------------------....--------------TMSPQKGFWVIRLCDGD.YWA.....LTS--------
ENSSSCP00000024940  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000002077  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023787  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004776  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000021310  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004184  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003925  ----.------------------....------------SIQIQPSRGFYCIVMHDGN.QYS.....ACTEP------
ENSSSCP00000027015  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008227  ----.------------------....-------------------------------.-Y-.....-----------
ENSSSCP00000005767  ----.----------------L-....-------------------------------.---.....-----------
ENSSSCP00000024925  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000018810  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000014885  ----.------------------....----RDNVSRRGRVLKSPENGFWVVQLCKGK.RYA.....PTMSALI----
ENSSSCP00000028656  ----.------------------....------VQSYWVDVTLNPHTANLNLVLSKNR.RQVrfvgaQQSGSRLDEHY
ENSSSCP00000030393  ----.--SGSTWYAIGLAYKSAP....KHEWIGKNSASWALCRCHNTWVVR-------.---.....-----------
ENSSSCP00000030993  ----.--SGSTWYAIGLAYKSAP....KHEWIGKNSASWALCRCHNTWVVR-------.---.....-----------
ENSSSCP00000012889  ----.--SGSTWYAIGLAYKSAP....KHEWIGKNSASWALCRCHNTWVVR-------.---.....-----------
ENSSSCP00000029279  ----.--SGSTWYAIGLAYKSAP....KHEWIGKNSASWALCRCHNTWVVR-------.---.....-----------
ENSSSCP00000030659  ----.--SGSTWYAIGLAYKSAP....KHEWIGKNSASWALCRCHNTWVVR-------.---.....-----------
ENSSSCP00000005403  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001314  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000009454  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001560  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001564  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023159  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000028586  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000021328  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000021030  ----.------------------....-----------------------NLVLSEDQ.RQV.....ISVPIWPVKCY
ENSSSCP00000001553  ----.---------L--------....-------------------------------.---.....-----------
ENSSSCP00000015601  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001716  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000019609  ----.------------------....---------------------V---------.---.....-----------
ENSSSCP00000022993  ----.------------------....---------------------V---------.---.....-----------
ENSSSCP00000001312  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029343  ----.------------------....-------------------------------.---.....-----I-----
ENSSSCP00000015849  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005434  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030635  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000019990  ----.------------------....---W---------------------------.---.....-----------
ENSSSCP00000021698  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025036  ----.------------------....----------------------------K--.---.....-----------
ENSSSCP00000018810  ----.------------------....------LFEYYHRLKHLPT------------.---.....-----------
ENSSSCP00000015851  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000013361  ----.------------------....------------V------------------.---.....-----------
ENSSSCP00000009456  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000018791  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010821  ----.------------------....-WGW---------------------------.---.....-----------
ENSSSCP00000000129  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000011201  ----.------------------....------------------DNDHIAVELYQGH.VRV.....-----------
ENSSSCP00000015852  ----.------------------....-------------------------------.---.....------F----
ENSSSCP00000017851  ----.------------------....----------------RPNSDFISLGLRDG-.---.....-----------
ENSSSCP00000009455  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000012112  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006826  ----.------------L-----....-------------------------------.---.....-----------
ENSSSCP00000029570  ----.------------L-----....-------------------------------.---.....-----------
ENSSSCP00000018163  IN--.------------------....-------------------------------.---.....-----------
ENSSSCP00000005380  ----.------------------....-----T-------------------------.---.....-----------
ENSSSCP00000000853  ----.---------------S--....-------------------------------.---.....-----------
ENSSSCP00000009453  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008124  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025878  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000026387  ----.-----G------------....-------------------------------.---.....-----------
ENSSSCP00000019654  ----.------------F-----....-------------------------------.---.....-----------
ENSSSCP00000024906  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000015599  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000024988  ----.------------------....------------------A------------.---.....-----------
ENSSSCP00000024616  ----.------------------....------------------A------------.---.....-----------
ENSSSCP00000021918  ----.------------------....------------------A------------.---.....-----------
ENSSSCP00000009325  ----.------------------....-------------------------------.---.....-D---------
ENSSSCP00000022455  ----.------------------....----------------RPNSDFISLGLRDG-.---.....-----------
ENSSSCP00000010821  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001973  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000017851  ALA-.------------------....-------------------------------.---.....-----------
ENSSSCP00000022455  ALA-.------------------....-------------------------------.---.....-----------
ENSSSCP00000013885  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006160  ----.------------------....----------------T--------------.---.....-----------
ENSSSCP00000023414  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029303  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008285  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000024906  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005158  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029039  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000018428  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006832  AS--.---WESASGIAELWVNGK....PVGRK--------------------------.---.....-----------
ENSSSCP00000006161  ----.------------------....----------------T--------------.---.....-----------
ENSSSCP00000018218  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000018024  ----.------------------....----------------------LALELYQGH.V--.....-----------
ENSSSCP00000001598  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030976  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000011839  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030667  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001317  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003232  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000013851  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023132  ----.------------------....---------------------Y---------.---.....-----------
ENSSSCP00000016666  ----.------------------....-------------------------------.---.....----------L
ENSSSCP00000004335  DLTY.WVDG--------------....-------------------------------.---.....-----------
ENSSSCP00000019848  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010319  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022089  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000007459  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001326  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001327  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005851  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010214  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025497  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030716  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029973  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004541  ----.-------T----------....-------------------------------.---.....-----------
ENSSSCP00000026569  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000000431  ----.------------------....-------------------------------.C--.....-----------
ENSSSCP00000020796  ----.------------------....-------------------------------.C--.....-----------
ENSSSCP00000012801  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000016666  ----.W-----------------....-------------------------------.---.....-----------
ENSSSCP00000023132  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000019848  ----.------------------....-----------------------------G-.---.....-----------
ENSSSCP00000006241  ----.------------------....-----------WYHLHGPQIGTLRLAMRR--.---.....-----------
ENSSSCP00000020492  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008085  ----.------------------....-------------------------------.---.....FSSASIVANTF
ENSSSCP00000018239  ----.------P-----------....-------------------------------.---.....-----------
ENSSSCP00000021088  ----.------P-----------....-------------------------------.---.....-----------
ENSSSCP00000003894  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000020352  ----.--I---------------....-------------------------------.---.....-----------
ENSSSCP00000024007  ----.--I---------------....-------------------------------.---.....-----------
ENSSSCP00000012140  ----.------------------....-------N-----------------------.---.....-----------
ENSSSCP00000015856  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000000096  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022990  ----.------------------....----S--------------------------.---.....-----------
ENSSSCP00000009188  ----.-----------C------....-------------------------------.---.....-----------
ENSSSCP00000030087  ----.-------K----------....-------------------------------.---.....-----------
ENSSSCP00000012497  ----.---------L--------....-------------------------------.---.....-----------
ENSSSCP00000031041  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004838  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025331  ----.------------------....------------Q------------------.---.....-----------
ENSSSCP00000006405  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000013851  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005821  ----.------------------....--------QNTFAAKHNNKVKALDVTVPEKI.GVF.....C--------DF
ENSSSCP00000004541  ----.------------------....---W---------------------------.---.....-----------
ENSSSCP00000021819  ----.------------------....-------T-----------------------.---.....-----------
ENSSSCP00000018415  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000013851  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010214  ----.-------K----------....-------------------------------.---.....-----------
ENSSSCP00000011618  ----.------------------....------------------K------------.---.....-----------
ENSSSCP00000008984  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004615  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030087  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004918  ----.------------------....---------------------M---------.---.....-----------
ENSSSCP00000007532  ----.------------------....------------VFTMSPQNGFWAIRLYDGD.YWA.....LTS--------
ENSSSCP00000004775  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008985  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000018428  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004775  ----.------------------....---------Y---------------------.---.....-----------
ENSSSCP00000008158  ----.------------------....--------K----------------------.---.....-----------
ENSSSCP00000013851  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000026169  ----.------------------....--------K----------------------.---.....-----------
ENSSSCP00000023415  ----.-----------L------....-------------------------------.---.....-----------
ENSSSCP00000027051  ----.------------------....-------------------------------.---.....-N---------
ENSSSCP00000026077  ----.------------------....-----------------------------GL.LLY.....LDDGGVCDF--
ENSSSCP00000004541  ----.------------------....--------------------S----------.---.....-----------
ENSSSCP00000027650  ----.-------------W----....-------------------------------.---.....-----------
ENSSSCP00000019848  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023361  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000026213  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023132  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008195  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006241  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025417  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000016447  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000021819  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006241  RSPV.LHEAAPTCELRLWYH---....-------------------------------.---.....-----------
ENSSSCP00000019848  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000021829  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000020853  ----.------------------....-----QVVSFPYHLNSEPAGGIIRIGL----.---.....-----------
ENSSSCP00000013851  RYAR.WAGAASSGELSFSLR---....-------------------------------.---.....-----------
ENSSSCP00000016390  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004039  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000014354  ----.------------------....-------------L-----------------.---.....-----------
ENSSSCP00000020506  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001881  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000013851  ----.----G-------------....-------------------------------.---.....-----------
ENSSSCP00000016666  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005883  ----.------------------....-------------------------------.---.....------F----
ENSSSCP00000004543  ----.------------------....-------------------------------.---.....-EYQVIFEAEV
ENSSSCP00000003039  RQLI.WYNARSKPHLHPCWKEGD....TVGF---------------------------.---.....-----------
ENSSSCP00000018415  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000027862  ---P.------------------....-------------------------------.---.....-----------
ENSSSCP00000004541  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000018099  ----.------------------....-------------------------------.L--.....-----------
ENSSSCP00000012904  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030031  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004614  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000027678  LNVYlKKEGDTEEPLLWRRRGEQ....SISWL--------------------------.---.....-----------
ENSSSCP00000017907  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000027979  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004016  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003680  ----.------------------....E------------------------------.---.....-----------
ENSSSCP00000001127  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006241  ----.------R-----------....-------------------------------.---.....-----------
ENSSSCP00000001629  INGS.QVVTFADPRVKTLY----....DEGWHQ----------------IRLLVTEQDvTLY.....IDDQQIENKPL
ENSSSCP00000005988  ----.-------E----------....-------------------------------.---.....-----------
ENSSSCP00000024916  ----.-------E----------....-------------------------------.---.....-----------
ENSSSCP00000021132  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000017907  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005893  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029807  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000011596  V---.------------------....-------------------------------.---.....-----------
ENSSSCP00000002048  ----.------------------....----------------------------E--.---.....-----------
ENSSSCP00000001310  ----.------------------....-----------------P-------------.---.....-----------
ENSSSCP00000028578  ----.------------------....-----------------P-------------.---.....-----------
ENSSSCP00000012112  ----.------------------....-------------------------------.---.....----T------
ENSSSCP00000018222  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000029355  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003233  ----.------------------....----------S--------------------.---.....-----------
ENSSSCP00000023342  ----.------------------....-----------A-------------------.---.....-----------
ENSSSCP00000023857  ----.------------------....--------E----------------------.---.....-----------
ENSSSCP00000026405  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023656  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001565  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003907  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000012436  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001558  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004775  R---.------------------....-------------------------------.---.....-----------
ENSSSCP00000010407  ----.------------------....----E--------------------------.---.....-----------
ENSSSCP00000027979  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004016  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000026273  -D--.------------------....-------------------------------.---.....-----------
ENSSSCP00000027979  ----.----GQLSFTNLDWPSPShfqaSFGFQTFQPSGILLNHQTRSSSLQVTLEDGH.---.....-----------
ENSSSCP00000004016  ----.----GQLSFTNLDWPSPShfqaSFGFQTFQPSGILLNHQTRSSSLQVTLEDGH.---.....-----------
ENSSSCP00000015120  ----.------------------....-------------------------------.---.....---------DY
ENSSSCP00000029926  ----.------------------....-------------------------------.---.....---------DY
ENSSSCP00000019261  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000027979  ----.------------------....-------------------------------.---.....---------N-
ENSSSCP00000004016  ----.------------------....-------------------------------.---.....---------N-
ENSSSCP00000019207  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025417  ----.------------------....-------------------------------.---.....V----------
ENSSSCP00000024968  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000001308  ----.------------------....-------------------------------.---.....------F----
ENSSSCP00000004775  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025895  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022922  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000002048  ----.------------------....--------------------------L----.---.....-----------
ENSSSCP00000000712  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022455  ----.------------------....--------------------------Y----.---.....-----------
ENSSSCP00000001310  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000028578  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000016392  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008559  ----.---------------D--....-------------------------------.---.....-----------
ENSSSCP00000021819  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003203  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010021  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010815  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000020574  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000016666  KDTN.WGTVRRENNLKITYVQQT....NLG----------------------------.---.....-----------
ENSSSCP00000022958  ----.------------------....-------------------------------.---.....---------DY
ENSSSCP00000005978  ----.------------L-----....-------------------------------.---.....-----------
ENSSSCP00000017851  ----.------------------....--------------------------M----.---.....-----------
ENSSSCP00000021247  WVIR.EDQGS-------------....-------------------------------.---.....-----------
ENSSSCP00000012777  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006241  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000028807  ----.------------------....-------------------------------.---.....-----P-----
ENSSSCP00000013885  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000025417  ----.------------------....------------S------------------.---.....-----------
ENSSSCP00000004775  ----.------------------....-------------L-----------------.---.....-----------
ENSSSCP00000024968  ----.------------------....-------------------------------.L--.....-----------
ENSSSCP00000000277  ----.------------------....-------------------------------.---.....ADDGKIFHGSG
ENSSSCP00000027978  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000005978  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000014530  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023947  ----.-----------ALWGRNG....GHGWRQ-------------------------.---.....-----------
ENSSSCP00000025895  ----.------------------....-------------------------------.-Q-.....-----------
ENSSSCP00000022922  ----.------------------....-------------------------------.-Q-.....-----------
ENSSSCP00000005978  ----.--------V---------....-------------------------------.---.....-----------
ENSSSCP00000026588  ----.------------------....-------------------------------.---.....-----I-----
ENSSSCP00000001308  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000000277  ----.------------------....-----------YSLDHQPGWLP------DSV.AYH.....ADDGKLYNGRA
ENSSSCP00000004471  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004541  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000020853  ----.------------------....-------------------------------.---.....----------F
ENSSSCP00000006241  ----.------------------....-------------------Q-----------.---.....-----------
ENSSSCP00000026906  ----.------------------....SLKFKTTQSYGVLLH----------------.---.....-----------
ENSSSCP00000016389  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006954  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000015012  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000016392  ----.------------------....------------Q------------------.---.....-----------
ENSSSCP00000027979  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000004016  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000020473  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000008195  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000030974  ----.------------------....-LAWEKTRS----------------------.---.....-----------
ENSSSCP00000019430  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022637  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000014907  F---.------------------....-------------------------------.---.....-----------
ENSSSCP00000017077  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000010815  ----.------------------....------------------------------N.---.....-----------
ENSSSCP00000009337  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000019007  ----.------------------....---------------------------HN--.---.....-----------
ENSSSCP00000024991  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000009843  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000019007  ----.------------------....--------------------------L----.---.....-----------
ENSSSCP00000023477  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000009452  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000003203  ----.------------------....-------------------------------.---.....A----------
ENSSSCP00000003203  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000022093  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000027047  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000006952  ----.------------------....-V-----------------------------.---.....-----------
ENSSSCP00000011072  ----.------------------....-------------------------------.---.....-----------
ENSSSCP00000023964  ----.------------------....-------------------------------.---.....-----------


                      0       200       210                                                         
                      |         |         |                                                         
d1ux6a1               AGGRLGLFVFSQEMVFFSDLKYECRD-p..................................................
ENSSSCP00000029807  AGGRLGLFVFSQEMVFFSDLKYECRD-...................................................
ENSSSCP00000005158  AGGRLGLFVFSQEMVFFSDLKYECRD-...................................................
ENSSSCP00000015013  RGGRLGVFCFSQENIIWSNLKYRCNDT...................................................
ENSSSCP00000015012  RGGRLGVFCFSQENIIWSNLKYRCNDT...................................................
ENSSSCP00000014796  RGGRLGVFCFSQENIIWANLRYRCNDT...................................................
ENSSSCP00000006952  RGGRLGVFCFSQENIIWSNLQYRCNDT...................................................
ENSSSCP00000004335  AGGRLGLFVFSQEMVYFSDLKYECRD-...................................................
ENSSSCP00000014907  ---------------------------pelnldqfhdktpytimfgpdkcgedyklhfifrhknpktgvyeekhakrp
ENSSSCP00000005280  ---------------------------glegpvfgsadmwngvgiffdsfdndgkknnpaiviignngqiqydhqndg
ENSSSCP00000024403  ---------------------------wevevgdrtdwaigvcrenvmkkgfdpmtpengfwavelygngywaltplr
ENSSSCP00000001201  ---------------------------wevevgdrtdwaigvcrenvmkkgfdpmtpengfwavelygngywaltplr
ENSSSCP00000029440  ---------------------------wevevgdrtdwaigvcrenvmkkgfdpmtpengfwavelygngywaltplr
ENSSSCP00000001416  ---------------------------tplhikvkpkrvgifldyeagtlsfynvtdrshiytftdtfteklwplfyp
ENSSSCP00000029869  ---------------------------tplhikvkpkrvgifldyeagtlsfynvtdrshiytftdtfteklwplfyp
ENSSSCP00000030828  ---------------------------tplhikvkpkrvgifldyeagtlsfynvtdrshiytftdtfteklwplfyp
ENSSSCP00000026179  ---------------------------lksrakhhaisailakpfvfadrplivqyevnfqdgidcggayiklladtd
ENSSSCP00000014929  ---------------------------tvmtdledknewknciditgvrlptgyyfgasagtgdlsdnhdiismklfq
ENSSSCP00000029385  ---------------------------waltspmtalplrtplqrvgifldydagevsfynvterchtftfshatfcg
ENSSSCP00000001288  ---------------------------waltspmtalplrtplqrvgifldydagevsfynvterchtftfshatfcg
ENSSSCP00000024192  ---------------------------dkfvglgvfvdtypneekqqervfpyisamvnngslsydherdgrptelgg
ENSSSCP00000015699  ---------------------------ngfwtiwlwnkqkyeagtctqtplypqvppsrvgifldydastvsfynisd
ENSSSCP00000001200  ---------------------------llpqngfwtlemfgnqyralsspekivplkerlhrvgifldyeagdvsfyn
ENSSSCP00000008754  ---------------------------pvfgnmdkfvglgvfvdtypneekqqesqrvfpyisamvnngslsydherd
ENSSSCP00000015688  ---------------------------yragtdeypllslpvpprrvgvfldyeahdisfynvtdngahiftfphypf
ENSSSCP00000029029  ---------------------------glqvitsgrcywevevgdsqawdlgicrshvmrkggisikpeggfwairsy
ENSSSCP00000014840  ---------------------------llkggeymvlaspsvpllhlerphcigifldyeageisfynvtngsyiytf
ENSSSCP00000021212  ---------------------------paflgpeeafalpdsllvvldmdegtlsfvvdgqylgvafrglkgkklypv
ENSSSCP00000014732  ---------------------------tnylteydlsefenigaiglelwqvrsgtifdnflitddeeyaenfgkatw
ENSSSCP00000003582  ---------------------------rgqfysagtvpstvlrvnprlhrvgifldlnsrsisfyhisdgshiftftk
ENSSSCP00000005042  ---------------------------kktkwtvgvvresilrkgscpltpeqgfwllrlrnqtdlkaldlpscslkl
ENSSSCP00000009237  ---------------------------spetslplrerplkvgifldyeagdvsfynmtdgshiftfpqntfygvlrp
ENSSSCP00000006271  ---------------------------petslplrerplkvgifldyeagdvsfynmtdgshiftfpqntfygvlrpl
ENSSSCP00000006272  ---------------------------petslplrerplkvgiflnyeagdvsfynmtdgshiftfpqntfcgvlrpl
ENSSSCP00000009236  ---------------------------spetslplrerplkvgifldyeagdvsfynmtdgshiftfpqntfygvlrp
ENSSSCP00000007533  ---------------------------petslplrerplkvgifldyeagdvsfynmtdgshiftfpqntfygvlrpl
ENSSSCP00000014615  -----------A---------------rfepfsnkgqtlvvqftvkheqnidcgggyvklfpdgldqtdmhgdseyni
ENSSSCP00000022095  ---------------------------ghwllrqnrqgeyealtspptsfregaprcvgvfldyeagvisfyvtgrsh
ENSSSCP00000027530  ---------------------------svtlltlkekplkvgifldyeagyvsfynmtdgshifsfsqnkfsgvlkpf
ENSSSCP00000024940  ---------------------------qfleqtcvlsqqrfsagrhywevhvghrsrwflgvclakvqcsgpvllspa
ENSSSCP00000002077  ---------------------------dssaedtqkspairvlvgnghnpdeplgdgasrvlgschrafrnrpnpfra
ENSSSCP00000023787  ---------------------------dssaedtqkspairvlvgnghnpdeplgdgasrvlgschrafrnrpnpfra
ENSSSCP00000004776  ---------------------------irmkagtiytfsvletripvspglchvgvfldieleeikffdvsndvliyt
ENSSSCP00000021310  ---------------------------irmkagtiytfsvletripvspglchvgvfldieleeikffdvsndvliyt
ENSSSCP00000004184  ---------------------------ggryvklfpdtlnqedmhseyyimfgldicgfgnnkvgvilcyqgkyhenn
ENSSSCP00000003925  ---------------------------wtrlnvrdkldkvgvfldydqgllifynaddmswlytfrekfpgklcsyfs
ENSSSCP00000027015  ---------------------------igrgklyhqskgpgapryppglqgehlevperllvvldmeegtlgyaiggt
ENSSSCP00000008227  ---------------------------eafscprvplpvaghphrigvylhyeqgeltffdadrpddlrllytfqadf
ENSSSCP00000005767  ---------------------------eywafhdgqrsrlrlrddpdrlgvfldyeagvlafydvsggmshlhtfraa
ENSSSCP00000024925  ---------------------------saswcvewfntkisawhnnvektlpstkstrvgvllncdhgfviffavadk
ENSSSCP00000018810  ---------------------------cntkqngiwgpeerkmqmpfqrghpfelsflvqssqfqvtvngrlfvqyth
ENSSSCP00000014885  ---------------------------pitlteppshmgifldfeagevsfynvnngshlhtysqpafpgplqpffcl
ENSSSCP00000028656  GCGVLGSRHFSSGKHYW----------evdvakktdwilgvcsdamaptfsfsqfaagrnvysryqpqsgywviglhr
ENSSSCP00000030393  ---------------------------hnskevpiepaphlrrvgilldydngsvafydalnslhlytfdvtfsqpvc
ENSSSCP00000030993  ---------------------------hnskevpiepaphlrrvgilldydngsvafydalnslhlytfdvtfsqpvc
ENSSSCP00000012889  ---------------------------hnskevpiepaphlrrvgilldydngsvafydalnslhlytfdvtfsqpvc
ENSSSCP00000029279  ---------------------------hnskevpiepaphlrrvgilldydngsvafydalnslhlytfdvtfsqpvc
ENSSSCP00000030659  ---------------------------hnskevpiepaphlrrvgilldydngsvafydalnslhlytfdvtfsqpvc
ENSSSCP00000005403  ---------------------------fgvaridvmkdvmlgkddkawamyvdnnrswfmhnnshtnrteggitkgat
ENSSSCP00000001314  ---------------------------saeegvwavilshqqcwastspgtdlplseiprrvgvaldyeagrvallna
ENSSSCP00000009454  ---------------------------avgvcmdtaprarsrhmegqscywtvgqrrgdyqawgpagilplelkedpc
ENSSSCP00000001560  ---------------------------pashkeslslrqlprrigvfldwdakqvsfynmidgshihsftgipihepl
ENSSSCP00000001564  ---------------------------pashkeslslrqlprrigvfldwdakqvsfynmidgshihsftgipihepl
ENSSSCP00000023159  ----------------W----------evdvskktawvlgvycrarsctaelalgrgaehqnahaiyrpqcgywvigl
ENSSSCP00000028586  ---------------------------pashkeslslrqlprrigvfldwdakqvsfynmidgshihsftgipihepl
ENSSSCP00000021328  ---------------------------nprfgestivcnsrdgnswgkeqrdshmcfspgsevklivtfeedgfkvkl
ENSSSCP00000021030  NYGVLGSQCFSSGKHYW----------evdvskktawvlgvycrarsctaelalgrgaehqnahaiyrpqcgywvigl
ENSSSCP00000001553  ---------------------------gvcrkdvkregwcrespekgfwlvgkfsdkyfvytaqytelslhqvlhrvg
ENSSSCP00000015601  ----------------W----------evdvskktawvlgvycrarsctaelalgrgaehqnahaiyrpqcgywvigl
ENSSSCP00000001716  ---------------------------vsffyhmygkhigslnllvrsrnkgaldthawslsgnkgnvwqqahvpinp
ENSSSCP00000019609  ---------------------------walqlncgqywavtspertplscghlsrvrvalglevgavsfyaaedmrhi
ENSSSCP00000022993  ---------------------------walqlncgqywavtspertplscghlsrvrvalglevgavsfyaaedmrhi
ENSSSCP00000001312  ---------------------------vdlahggsctvgvvsqdirrkgelrmrpeegvwavrlawgfvsalgsfptr
ENSSSCP00000029343  ---------------------------flllcvkvddnfhlfstspllpyyiqrpqgwigvfldyecgiisfinvaks
ENSSSCP00000015849  ---------------------------tlstnsppliqyvqrplgrvgvfldydngtvsfydvckgsliysflpssfs
ENSSSCP00000005434  ---------------------------rfnednrrvivcnskldnnwgreerqmvfpfecgkpfkiqvlvepdhfkva
ENSSSCP00000030635  ---------------------------rfnednrrvivcnskldnnwgreerqmvfpfecgkpfkiqvlvepdhfkva
ENSSSCP00000019990  ---------------------------rskkgtkfhqsigkhyssgygqgdvlgfyinlpedtetakslpdtykdkal
ENSSSCP00000021698  ---------------------------hsygyhgddghsfcssgtgqpygptfttgdvigccvnlingtcfytknghs
ENSSSCP00000025036  ---------------------------dvmlgkddkawamyvdnnrswfmhnnshtnrteggitkgatigvlldlnrk
ENSSSCP00000018810  ---------------------------inslevggdiqlthvq...................................
ENSSSCP00000015851  ---------------------------tlstnsppliqyvqrplgrvgvfldydngtvsfydvckgsliysflpssfs
ENSSSCP00000013361  ---------------------------fsrcnsnfvvrhnnkemlvdvhpqlkrlgvlldydnnmlsfydpanslhlh
ENSSSCP00000009456  ---------------------------dlensrrigvfldcelgevsfynliersllysfsaiftgklmpyfsvgsss
ENSSSCP00000018791  ---------------------------sdswcvewngasqlsawhvvkqtvlgsdrpgvvgiwldfekeklafysvad
ENSSSCP00000010821  ---------------------------eeivydmpfkkeksfeivimvlktifqvavngkhtllyshrispekintlg
ENSSSCP00000000129  ---------------------------qresafpfqpgsvvevcisfgqtdltiklpdgyefsfpnrlnleaieylaa
ENSSSCP00000011201  ---------------------------sydpgsypssaiysaetindgqfhtvelvtfdqmvnlsidggspmtmdnfg
ENSSSCP00000015852  ---------------------------lllcvkvddnfhlfstspllpyyiqrpqgwigvfldyecgiisfinvakss
ENSSSCP00000017851  ---------------------------alvfsynlgsgvasilvngsfndgrwhrvkavrdgqsgkitvddygartgk
ENSSSCP00000009455  ---------------------------gcwqiqvwattpdtgvsgnschigvfldyelgevsfynlydrsnlytfsai
ENSSSCP00000012112  ---------------------------gpskdkvavlsvddcdvavalqfgaeignyscaaagtqtsskksldltgpl
ENSSSCP00000006826  ---------------------------wvdgkpmvrrslkrgyslgtqasiilgqeqdafaggfeknqclvgdigdvn
ENSSSCP00000029570  ---------------------------wvdgkpmvrrslkrgyslgtqasiilgqeqdafaggfeknqclvgdigdvn
ENSSSCP00000018163  ---------------------------dkvaklpfvindgkwhhicitwttrdgvweayqdgtqggngenlapyhpik
ENSSSCP00000005380  ---------------------------ntaycfsffyhmygqhigvlnvylrlkgqttienplwsssgnkgqrwneah
ENSSSCP00000000853  ---------------------------gshhphtevfpyiladdkwhklslaisashlilhidcnkiyervvekpstd
ENSSSCP00000009453  ---------------------------ngcwkiqvwattpdtgvsgnschigvfldyelgevsfynlydrsnlytfsa
ENSSSCP00000008124  ---------------------------ttrdgmweafqdgeklgtgenlapwhpikpggvlilgqeqdtvggrfdatq
ENSSSCP00000025878  ---------------------------dngcwriqlrattpgtgdsgnscrigvfldyelgevsfydlykrsplylys
ENSSSCP00000026387  ---------------------------reergpgipfqrgqpfdvllittdegfkvvvgdleyhhfrhrmpptrvrav
ENSSSCP00000019654  ---------------------------wvdgkpkvrkslekgasveaeasiilgqeqdtfageyeknqclvgdigdvn
ENSSSCP00000024906  ---------------------------glailrsseplalgrwhhvsaerfnkdgslrvnggrpvlrsspgksqglnl
ENSSSCP00000015599  ---------------------------kygywviwlndkgeyntfeessssdsgpltlslgvpprrigvfleyeagtv
ENSSSCP00000024988  ---------------------------iglcndswakkndmalesegifllfciqenqqcslftsspltpqyvqrplg
ENSSSCP00000024616  ---------------------------iglcndswakkndmalesegifllfciqenqqcslftsspltpqyvqrplg
ENSSSCP00000021918  ---------------------------iglcndswakkndmalesegifllfciqenqqcslftsspltpqyvqrplg
ENSSSCP00000009325  ---------------------------tgshpasaiysvetindgnfhivellaldqslslsvdggspkiitnlskqs
ENSSSCP00000022455  ---------------------------alvfsynlgsgvasilvngsfndgrwhrvkavrdgqsgkitvddygartgk
ENSSSCP00000010821  ---------------------------skdialhlnprlnvkafvrnsflqeswgeeernitcfpfspgmyfemiiyc
ENSSSCP00000001973  ---------------------------vgvafedvpkqedlganhlswcmrhtfassrhkyeflhnkttpdiritvsp
ENSSSCP00000017851  ---------------------------iirrslqfrfncgtgvaiitsetkiklgawhtvtlyrdglngllqlnngtp
ENSSSCP00000022455  ---------------------------iirrslqfrfncgtgvaiitsetkiklgawhtvtlyrdglngllqlnngtp
ENSSSCP00000013885  --G------------------------hwqaearwphlalqrgasflilflfgneemkvsvnglhflhyryrlplsrv
ENSSSCP00000006160  ---------------------------gkpgpedyplfrginlsdgkwhrvalsvhkknvtlildckkkttkfldrsd
ENSSSCP00000023414  ---------------------------nwaiglcndswakkndmalesegifllfciqenqqcslftsspltpqyvqr
ENSSSCP00000029303  ---------------------------ralrtperrpsrigiylsfadgvlsfydasdadalellfafherlpgpvyp
ENSSSCP00000008285  ---------------------------ralrtperrpsrigiylsfadgvlsfydasdadalellfafherlpgpvyp
ENSSSCP00000024906  ---------------------------alregrrgsiqvdgeelvsgqspgpnvavntkgsvyiggapdvaaltggrf
ENSSSCP00000005158  ---------------------------vvsngkagtldlsltvqgkqqvvsveeallatgqwksitlfvqedraqlyi
ENSSSCP00000029039  ---------------------------lsladgkwhrvavavkgqsvtlildckkrvtrplprsahpvldthgviifg
ENSSSCP00000018428  ---------------------------lvlhmslgsspiqprpghttvsaggvlndqhwhyvrvdrfgrdanltldgy
ENSSSCP00000006832  ---------------------------glkrgytvkekasiilgqeqdsfgggfdakqsfvgeiwdvslwnrvlplkn
ENSSSCP00000006161  ---------------------------gkpgpedyplfrginlsdgkwhrvalsvhkknvtlildckkkttkfldrsd
ENSSSCP00000018218  ---------------------------ypelkrrklgphtdnigrgptswglciqedrtqawhngvaqrlpgvsgrll
ENSSSCP00000018024  ---------------------------rlvydslssppttvysvetvndgqfhsvelvmlnqtlnlvvdkgapkslgk
ENSSSCP00000001598  ---------------------------lsladgkwhrvavavkgqsvtlildckkrvtrplprsahpvldthgviifg
ENSSSCP00000030976  ---------------------------lsladgkwhrvavavkgqsvtlildckkrvtrplprsahpvldthgviifg
ENSSSCP00000011839  -----------Q---------------adenqkgkvarlvspvvysqnsahcmtfwyhmsgshvgtlrvklryqkpee
ENSSSCP00000030667  ---------------------------clvgvaselvtrrgplmiepltgfwvlrivgfdcqalteggtreelsvrpr
ENSSSCP00000001317  ---------------------------clvgvaselvtrrgplmiepltgfwvlrivgfdcqalteggtreelsvrpr
ENSSSCP00000003232  ---------------------------ncevkssdmpfadgqpfelhilvlqneyqvmvngqhyysfphrlspqsvkl
ENSSSCP00000013851  ---------------------------ihyvfdlgngpslmkgnsdkpvndnqwhnvvvsrdpgnvhtlkidsrtvtq
ENSSSCP00000023132  ---------------------------ialaivdghlqltydlgsqpvvlrstvavntnrwlrvrahrdqregslqvg
ENSSSCP00000016666  ---------------------------qkgrlalhlnlddskprlsssppsatlgsllddqhwhsvllervgkqvnft
ENSSSCP00000004335  ---------------------------aqhvisledvgladaqwknvtvqvtgetyslyvgcdlmdsftldepfyeql
ENSSSCP00000019848  -----------------G---------glllflndgklklnlyrpgklpsditagvglndgqwhsvslfakrnylsvt
ENSSSCP00000010319  ---------------------------hscyhdtrsgfwyvcrtrgvdgdhcvtsdpatsplvpaiprrlrvelecee
ENSSSCP00000022089  ---------------------------ggagppprrirvdldwergrvafydghsldllfafqgpgplgervfpllct
ENSSSCP00000007459  ---------------------------havslevngnyarlvldqvhtasgtapgtlktlnldnhvffgghirqqgsr
ENSSSCP00000001326  ---------------------------vlrivgfdcqalteggtreelsvrprkvrihvnheggevvfydsitssriy
ENSSSCP00000001327  ---------------------------ggagppprrirvdldwergrvafydghsldllfafqgpgplgervfpllct
ENSSSCP00000005851  ---------------------------dcpavndgnwhhiaitwtsvdgawkvyidgklsdggmglsigsaipgggal
ENSSSCP00000010214  ---------------------------stwivlglragrlelqlryqgvgrvtssgpvinhgvwqtisveelernlvv
ENSSSCP00000025497  ---------------------------edgrqrvilyytepgsqvsheaasfpvpvmthrwnrfavvvqgeeasllve
ENSSSCP00000030716  ---------------------------ysqadenqkgkvarlvspvvysqnsahcmtfwyhmsgshvgtlrvklryqk
ENSSSCP00000029973  ---------------------------ysqadenqkgkvarlvspvvysqnsahcmtfwyhmsgshvgtlrvklryqk
ENSSSCP00000004541  ---------------------------miptkindgqwhkikimrikqegildvdgasnrtispkkadildvvgmlyv
ENSSSCP00000026569  ---------------------------yihyvfdlgngpnvikgnsdrplndnqwhnvvitrdnsnthslkvdtkvvt
ENSSSCP00000000431  ---------------------------igvddrswvftyaqrkwhtmlanekapiegigqpekvgllleyeaqklslv
ENSSSCP00000020796  ---------------------------igvddrswvftyaqrkwhtmlanekapiegigqpekvgllleyeaqklslv
ENSSSCP00000012801  ---------------------------fyistptgpggrqervgllslpleptlepvclsfwyymygenvyklsinis
ENSSSCP00000016666  ---------------------------hllsinarrnritltldndaaspaqdtsrmqiysgnsyyfggcpdnltdsq
ENSSSCP00000023132  ---------------------------pavltssvpvqpgrwhrlelsrhwrrgtlsvggrrprgvqchsglregvpl
ENSSSCP00000019848  ---------------------------klyflinsgdaklasshaptsltlgsllddqhwhsvliqrlgrqvnltvde
ENSSSCP00000006241  ---------------------------egeadthlwlrsgthgnrwheawatlhhpqdtsakyqllfeglrdgyhgtm
ENSSSCP00000020492  ---------------------------kfdgllsdsnrdsfllvcvkednhyrlwatapttplyiqkpvgrvgmfldf
ENSSSCP00000008085  QGGRWG---------------------qeevstvfplvlgepfemevssdaehfhvhaqehkvlqfahrhrplaaitr
ENSSSCP00000018239  ---------------------------yswclewdslkfsvwhnntqtvlhggyhrtlgvaldcgagclsfygvavag
ENSSSCP00000021088  ---------------------------yswclewdslkfsvwhnntqtvlhggyhrtlgvaldcgagclsfygvavag
ENSSSCP00000003894  ---------------------------dghspgtlgiyvrvnggplgsavwnmtgshgrqwhqaelavstfwpneyqv
ENSSSCP00000020352  ---------------------------pdqpfrveilcehprfrvfvdghqlfdfyhriqtlsaidtikingdlqitk
ENSSSCP00000024007  ---------------------------pdqpfrveilcehprfrvfvdghqlfdfyhriqtlsaidtikingdlqitk
ENSSSCP00000012140  ---------------------------crfnqeegvgdthnsyaydgnrvrkwnvtttnygkawaagdivsclidldd
ENSSSCP00000015856  ---------------------------isgravndgswhsvflelnrnftslslddsyverrraplyfqtlstestiy
ENSSSCP00000000096  ---------------------------gwhhiciawitrdglwsayqdgelrgsgenlaawhpikphgililgqeqdt
ENSSSCP00000022990  ---------------------------tincrfnqeegvgdthnsyaydgnrvrkwnvtttnygkawaagdivsclid
ENSSSCP00000009188  ---------------------------hdqglcrvgwssmqasldlgtdkfgfgfggtgkkshnkqfdnygeeftmhd
ENSSSCP00000030087  ---------------------------qlvvlaaesvtlalmeikvcdgqehvvtvsvnkdeatlevdgtrgqrdvsp
ENSSSCP00000012497  ---------------------------cstwnseqghvalwvngdliatkvdmatghivpeggilqigqekngccvgg
ENSSSCP00000031041  ---------------------------ltyfnydysgdfqtvtfegpeirkifygsfhklhiivsktmakvvidckev
ENSSSCP00000004838  ---------------------------kdtrgevqtvtfdtdevktlfygsfhkvhivvtsksvkiyidcyeiiekni
ENSSSCP00000025331  ---------------------------prkwymisivhiynrwrnseircyvngqlvsygdmawhvntndsydkcflg
ENSSSCP00000006405  ---------------------------ltyfnydysgdfqtvtfegpeirkifygsfhklhiivsktmakvvidckev
ENSSSCP00000013851  ---------------------------ewchvdfqrdgrkgsisvnsrstpflatgeseildleselylgglpeggrv
ENSSSCP00000005821  DGGQLSFYDANSKQLLYS---------fktkftqpvlpgfmvwcgglsln............................
ENSSSCP00000004541  ---------------------------ftavydtgipghlcdgkwhkvvakkikhrveltvdgnqveaqspnpastsa
ENSSSCP00000021819  ---------------------------wykiafqrnkkqgllavidahdtsyketkqgetpgassdlnrldkdpiyvg
ENSSSCP00000018415  ---------------------------vrdymavlikedgtlqlryqlgtspyvyqlttrpvtdgqphsvnitrvyrn
ENSSSCP00000013851  ---------------------------lrvgcapskgpetlfaghklndnewhtvrvvrrgkslqlsvdnvtvegqma
ENSSSCP00000010214  ---------------------------qlvvlaaesvtlalmeikvcdgqehvvtvsvnkdeatlevdgtrgqrdvsp
ENSSSCP00000011618  ---------------------------vvlfiaqnasdgewhsvevtfaeavtvalrddsctgsciskapspfgsdrs
ENSSSCP00000008984  ---------------------------lladtpvndgawhsvrirrqfrnttlfidqveakwvevkskrrdmtvfsgl
ENSSSCP00000004615  ---------------------------tksvafsykgldgslqtaafsnlpslfdsqwhkimigvernsatlfvdcnr
ENSSSCP00000030087  ---------------------------stwivlglragrlelqlryqgvgrvtssgpvinhgvwqtisveelernlvv
ENSSSCP00000004918  ---------------------------wlyraysgnlyhngeqtltlssftqgdfitcvldmeartisfgkngeepkl
ENSSSCP00000007532  ---------------------------petslplrerplkvgifldyeagdvsfynmtdgshiftfpqntfygvlrpl
ENSSSCP00000004775  ---------------------------tsvapkqslcdgrwhritvirdsnvvqldvdsevnhvvgplnpkpvdhrep
ENSSSCP00000008985  ---------------------------nawhdvkvtrnlrqhsgighamvtisvdgiltttgytqedytmlgsddffy
ENSSSCP00000018428  ---------------------------yrlndgfwhevnfvaqenhavisiddvegaevrvsypllirtgtsyffggc
ENSSSCP00000004775  ---------------------------ndglwhdvifirekssgrliidglrvleeslpptgatwkikgpiylggvap
ENSSSCP00000008158  ---------------------------tagfverfrhlpcvlgqnvftlgkyywevenrgdlevavgvcredvmevte
ENSSSCP00000013851  ---------------------------ndnawhdvrvtrnlrqhagighamvtisvdgiltttgytqedytmlgsddf
ENSSSCP00000026169  ---------------------------tagfverfrhlpcvlgqnvftlgkyywevenrgdlevavgvcredvmevte
ENSSSCP00000023415  ---------------------------lytepgatrtrtaasftlpalhgrwthlalsvdgahvalfvdceevqlepl
ENSSSCP00000027051  ---------------------------ehgiqqvgievgrspvflyedhmgkpapedyplfrtvniadgkwhrvaisv
ENSSSCP00000026077  ---------------------------lclslvdgrvrlrfsmdcaetevlshkqvndsswhflmvsrdrlrtvlvld
ENSSSCP00000004541  ---------------------------ivdidtnqeetiattspgnnfgldlkaddkiyfgglptlrnlsmkarpevn
ENSSSCP00000027650  ---------------------------sldscstqlgeepfsygyggtgkkstnsrfenygdkfaendvigcfvdfec
ENSSSCP00000019848  ---------------------------ttassgvflenlgitdyirielrspavvtfsfdvgngpseisvqspthfnd
ENSSSCP00000023361  ---------------------------ygywviwlndkgeyntfeessssdsgpltlslgvpprrigvfleyeagtvs
ENSSSCP00000026213  -----------E---------------lqlvsgglllflndgklklnlyrpgklpsditagvglndgqwhsvslfakr
ENSSSCP00000023132  ---------------------------vslalhnrllefrydlgrgrrssgskepvalgvwtrvslerngrkgamrvg
ENSSSCP00000008195  ---------------------------hyifletdkfsqagqsfrlvsrpfcapavicvtftyhmyglgqgtklrlll
ENSSSCP00000006241  ---------------------------gpggraawlrsqplpatevsclrfwyhmgfpehfykgelrvllssaqgqla
ENSSSCP00000025417  ---------------------------lgqspsgtdglnldtdlfvggvpedqaavvlertsvsvglrgcirlldvnn
ENSSSCP00000016447  ---------------------------gkwthvavtydgqrmalyvdgtrvasspdqsgplnspfmascrslllggds
ENSSSCP00000021819  ---------------------------kralpraptgtysdgqehsislirsgriitvqldettpvdmklgpstesrt
ENSSSCP00000006241  ---------------------------aasgdvaelrlelthgaetltlwqssgpwrpgwqellvttgrirgdfrvtf
ENSSSCP00000019848  ---------------------------iarngslqiryklnryqepdvvnfdfknmadgqlhhikinreeavvfveid
ENSSSCP00000021829  ---------------------------gpqgnpvwnvsgvvtegwvkaelaistfwphfyqvifesvslkghpgyiav
ENSSSCP00000020853  ---------------------------gsnvcfvggtagrqrgflgcmrslqlnglaldleeratmtpgvepgcpghc
ENSSSCP00000013851  ---------------------------tnatralllylddggdcdflelllvdgrlrlrftlscaepatlqldtpvad
ENSSSCP00000016390  ---------------------------sfyfktliprgvflenlgntdfiklelksatevsfsfdvgngpveivvrsp
ENSSSCP00000004039  ---------------------------yireysgdnvngililveeikdiplgswqlyhvtlkvtnkfrvvfrgvrga
ENSSSCP00000014354  ---------------------------hvnnwlqvsftakhankakvldapvpdclgvhcdfhqglltfynartkqll
ENSSSCP00000020506  ---------------------------tgnvrklvkmktfqgdfdqnwkiahvplreekkfrylfqgtkgdpqnsngg
ENSSSCP00000001881  ---------------------------tgnvrklvkmktfqgdfdqnwkiahvplreekkfrylfqgtkgdpqnsngg
ENSSSCP00000013851  ---------------------------tvgvifnvgtdditidepnaivsdgkyhvvrftrsggnatlqvdswpvner
ENSSSCP00000016666  ---------------------------vlickngslqvryqlskeeihvftidtenfanrrlhhlkinregrgltiqv
ENSSSCP00000005883  ---------------------------dldvhdgrwhhlalelrgrsvtlvtacgqrrvpvslpfhrdpaldpeglfl
ENSSSCP00000004543  SGGRSG---------------------yiaiddiqvlsypc.....................................
ENSSSCP00000003039  ---------------------------lldlnekqmifflngnqlppekqvfsstvsgffaaasfmsyqqcefnfgak
ENSSSCP00000018415  ---------------------------vlrpmplqtyiwleydrplyvgsaelkrrpfigclramrlngvtlnlegra
ENSSSCP00000027862  ---------------------------mkegctevsllrvgwsvdfshpqlgedefsygfdgrglkaengqfeefgqt
ENSSSCP00000004541  ---------------------------vkpepslfhdgrehsvhvertrgiftvqvdedrrhmqnltveqaievkklf
ENSSSCP00000018099  ---------------------------rleyrcpggfdgnlssrvhvndqewhsvlvevtdtsirllvdstgtaflvl
ENSSSCP00000012904  ---------------------------vpalagqkkdigrlklllpdlqpqsnlcllfhyrlagnkvgklrvfvknsn
ENSSSCP00000030031  ---------------------------vpalagqkkdigrlklllpdlqpqsnlcllfhyrlagnkvgklrvfvknsn
ENSSSCP00000004614  ---------------------------lgigiqsqgislymdcnlvasqntdgkgaldfrgrtiimarasdgkpvdve
ENSSSCP00000027678  ---------------------------kalieyscerqhqiifeairgvsirsdiaiddikfqagpc...........
ENSSSCP00000017907  ------L--------------------fcvkdsislvidkhyemtgqitggrhslhfqhgiyiaghggldvpyldgel
ENSSSCP00000027979  ---------------------------klkskercndgkwhtvvfghdgergrlvmdglraregslpgnstislrapv
ENSSSCP00000004016  ---------------------------klkskercndgkwhtvvfghdgergrlvmdglraregslpgnstislrapv
ENSSSCP00000003680  ---------------------------ekkykpaefhwklhqvcdeewhhyvlnvdipsvvlyvdgashepfsvtedy
ENSSSCP00000001127  ---------------------------vigccvnlinntcfytknghslgiaftdlppnlyptvglqtpgevvdanfg
ENSSSCP00000006241  ---------------------------ghvasltseahrplaqpacltfwyhlslrnpgtlrvhveeakrrqvlsist
ENSSSCP00000001629  -HPVLGIFISGQTQI------------gkysgkeetvqfdvqklriycdpeqnnretac...................
ENSSSCP00000005988  ---------------------------qlggrwalfadgrrragarglgaghplppggvlvlgqdqdslgggfsarda
ENSSSCP00000024916  ---------------------------qlggrwalfadgrrragarglgaghplppggvlvlgqdqdslgggfsarda
ENSSSCP00000021132  --------C------------------frtskglgysahfvggcliitsikskgkgfqhcvkfdfkpqkwymvtivhi
ENSSSCP00000017907  ---------------------------fteryldlmvdeqgvrtllplqsqpfvsegplfvgglgnhkgeevkrlqla
ENSSSCP00000005893  ---------------------------tdrarqvttinahrsylpgqwvylaatydgrlmklyvngaqvatsgeqvgg
ENSSSCP00000029807  ---------------------------vvsveeallatgqwksitlfvqedraqlyidcekmenaeldvpiqsiftrd
ENSSSCP00000011596  ---------------------------rhlytkdidihevrigwslttsgmllgeeefsygyslkgiktcncetedyg
ENSSSCP00000002048  ---------------------------ghlravvekgqgtvllhnsvpvadgqphevsihvdahrleisvdqyptrts
ENSSSCP00000001310  ---------------------------rrvgialdyeggtvtftnaesqeliytfkatftrrllpflwlrwpg.....
ENSSSCP00000028578  ---------------------------rrvgialdyeggtvtftnaesqeliytfkatftrrllpflwlrwpg.....
ENSSSCP00000012112  ---------------------------vsdgrwhdlrlelqeepggrrghhvlmvsldfslfqdtlavgselqglkvk
ENSSSCP00000018222  ---------------------------aedfsplepydrgrlgrnahscclqwngrsfsvwfhgleaalphpfsptvg
ENSSSCP00000029355  ---------------------------aedfsplepydrgrlgrnahscclqwngrsfsvwfhgleaalphpfsptvg
ENSSSCP00000003233  ---------------------------shpfvpgqplelrilvldseyqvlvnnrptysfghylppqsvkmmqlkgdv
ENSSSCP00000023342  ---------------------------kalrqawacplriikipghylvvvngdpfyefghripvqlvthlqvdgdlt
ENSSSCP00000023857  ---------------------------fhwklhqvcdeewhhyvlnvdipsvvlyvdgashepfsvtedyplhpssie
ENSSSCP00000026405  ---------------------------dhsawflialrdgkieiqfknehttkittggrvindglwnmvcftefikni
ENSSSCP00000023656  ---------------------------gdfvsciflvpqlfdlrwhklvlsvaervasvhvdctsassqplgprrpir
ENSSSCP00000001565  ---------------------------kiviflgyedgdisfysmtdgahiysfthcnffgqispyvklk........
ENSSSCP00000003907  ---------------------------gdfvsciflvpqlfdlrwhklvlsvaervasvhvdctsassqplgprrpir
ENSSSCP00000012436  ---------------------------etilcnsdktemnrhhyalyvhncrlvfllrkdfdqadtfrpaefhwkldq
ENSSSCP00000001558  ---------------------------kiviflgyedgdisfysmtdgahiysfthcnffgqispyv...........
ENSSSCP00000004775  -NGYLHV--------------------fydfgfssgpvhledtmkkaqindakyheisiiyhndkkmilvvdrrhvks
ENSSSCP00000010407  ---------------------------atfsppgpywthvlftwkfkeglkvyvngtlsnsdpsgkeahaygepnanl
ENSSSCP00000027979  ---------------------------qhivhleldsehsytagrhpfspartkehlhigdvpgnscadfpptrgcvg
ENSSSCP00000004016  ---------------------------qhivhleldsehsytagrhpfspartkehlhigdvpgnscadfpptrgcvg
ENSSSCP00000026273  ---------------------------glwhhvtlsmtdpraqasrwqmevdhpaplvtsavaagsldflkddidihv
ENSSSCP00000027979  ---------------------------ielstrdssgpiltspqtymdgllhyvsvisdnsglrlliddqplknnqkl
ENSSSCP00000004016  ---------------------------ielstrdssgpiltspqtymdgllhyvsvisdnsglrlliddqplknnqkl
ENSSSCP00000015120  DKGKVGFYDM-----------------dhmkclyerqvdcshtmypafalmgsg........................
ENSSSCP00000029926  DKGKVGFYDM-----------------dhmkclyerqvdcshtmypafalmgsg........................
ENSSSCP00000019261  ---R-----------------------whhlalelrgrsvtlvtacgqrrvpvslpfhrdpaldpeglflfgkmspha
ENSSSCP00000027979  ---------------------------ieggrlmvrykvdsgppkekeigaivndgkdhlisvrisrlqkrmrirmds
ENSSSCP00000004016  ---------------------------ieggrlmvrykvdsgppkekeigaivndgkdhlisvrisrlqkrmrirmds
ENSSSCP00000019207  ---------------------------itcvldmeartisfgkngeepklafedvdaaelypcvmfyssnpgekvkic
ENSSSCP00000025417  ---------------------------dgsghtgltlgggpqgvvlwgeeqratlmasrhpsprdqregslqvgneap
ENSSSCP00000024968  ---------Y-----------------vdifeghlravvxllhnsvpvadgqphevsihvdahrleisvdqyptrtsn
ENSSSCP00000001308  ---------------------------qilsycprqigvaldydggkvaftnarthefiyefsssfsgrifpflwlnc
ENSSSCP00000004775  ---------------------------mdvkgikvqsadkqyndglshfiitsvsparyelivdksrlgsknptkgkv
ENSSSCP00000025895  ---------Y-----------------vdifeghlravvxllhnsvpvadgqphevsihvdahrleisvdqyptrtsn
ENSSSCP00000022922  ---------Y-----------------vdifeghlravvxllhnsvpvadgqphevsihvdahrleisvdqyptrtsn
ENSSSCP00000002048  ---------------------------ilgreevrlqtlaemllsdsvphtvgltvsdswaslsvdgllnasalvqgg
ENSSSCP00000000712  ---------------------------nkgkkeeetivcntvqnedgfshysltvhgcriaflywpllesarpvkflw
ENSSSCP00000022455  ---------------------------dtgskdflsitmagghvefrfdcgsgtgvlrsqtaitlgkdhnikkisqta
ENSSSCP00000001310  ---------------------------ssylhpqqfecepgvlgskgftwgkvywevevereg...............
ENSSSCP00000028578  ---------------------------ssylhpqqfecepgvlgskgftwgkvywevevereg...............
ENSSSCP00000016392  ---------------------------rtngefdyldldyeitfggipfsgkpssssrknfkgcmesinynginitdl
ENSSSCP00000008559  ---------------------------nrkvsfhteyscgtaairgtkelaegqhfweikmtspvygtdmmvgigtsd
ENSSSCP00000021819  ---------------------------tlmfvgglggqikkspavkvthfkgcmgeaflngqsiglwnymeregkchg
ENSSSCP00000003203  ---------------------------fgrpwqsgdvvgcmidltentiiftlngevlmsdsgsetafrdievgdgfl
ENSSSCP00000010021  ---------------------------lyhnneeknrlpanslpqegdvvgitydhvelnvylngknmhcpasgirgt
ENSSSCP00000010815  ---------------------------rswqagdvvgcmvdmtehtmmftlngeillddsgselafkdfdvgdgfipv
ENSSSCP00000020574  ---------------------------ernipevyvadghwhtfligkngtatvlsidriynrdiihptqdfggldvl
ENSSSCP00000016666  ---------------------------sswrtgsqkthilfptncnmdlggtssrqkgflgcirslhlngqkldleer
ENSSSCP00000022958  EAGRLGFYN------------------aetlahvhtfsaaflgervfpffrvlskgtrik..................
ENSSSCP00000005978  ---------------------------lpgrwddglrhlvmlsfgpdhlqslgqqvhvggrlfpadaqpwggpfrgci
ENSSSCP00000017851  ---------------------------tfrpdsedgvllysydtgskdflsitmagghvefrfdcgsgtgvlsdtsqh
ENSSSCP00000021247  ---------------------------ewkhgriilpsydmey...................................
ENSSSCP00000012777  ---------------------------qfaildkamegtvatylgglpdvpfsatpvnafyngcmdviingvpldlde
ENSSSCP00000006241  ---------------------------pailsspefqasaphncslvfyhylhgseagclqvflqarssgapqtpvll
ENSSSCP00000028807  ---------------------------sdsdrfqvdlqcgnsvkpradvafhfnprfkranciv..............
ENSSSCP00000013885  ---------------------------gkklipapflfypqrffevlllcqegglklalngqglgatslgpqalerlr
ENSSSCP00000025417  ---------------------------lerngrkgamrvgdgprvlgespksrkvphtilnlkeplyiggapdfsrla
ENSSSCP00000004775  ---------------------------sstaeekfikkgefagddslldldpedtvfyvggvpsnfklpaslnlpgfv
ENSSSCP00000024968  ---------------------------qvrlilgreevrlqtlaemllsdsvphtvgltvsdswaslsvdgllnasal
ENSSSCP00000000277  VGDPFGPRCY-----------------kgdimgcgimfprdyildsegdsddscdtvilsptaravrnvrnvmylhqe
ENSSSCP00000027978  ---------------------------criaflywpllesarpvkflwkleqvcddewhhyalnlefptvtlyadgis
ENSSSCP00000005978  ---------------------------gprvadgawhrvrlamerpeaaasrwllwldgaatpvalrglagdldflrg
ENSSSCP00000014530  ---------------------------diqellistdpqaafqaceqylpgc..........................
ENSSSCP00000023947  ---------------------------thitlrgadvksvifkgekrrghtgeialddvslrkghct...........
ENSSSCP00000025895  ---------------------------vrlilgreevrlqtlaemllsdsvphtvgltvsdswaslsvdgllnasalv
ENSSSCP00000022922  ---------------------------vrlilgreevrlqtlaemllsdsvphtvgltvsdswaslsvdgllnasalv
ENSSSCP00000005978  ---------------------------lrlldmalndgywhqvevalrlgvlelrlwhegcparlcmasspvalppla
ENSSSCP00000026588  ---------------------------ygflkmsdtlavyifeenhmvqekiwsvlesprgvwmqaeitfkkpmst..
ENSSSCP00000001308  ---------------------------gqrfdpepgvlgskgftwgkvywevkvdriw....................
ENSSSCP00000000277  KGRQFGSKCNSGDR-------------igcgiepvsfdvqtaqifftkngkrvgstimpmspdglfpavgmhslgeev
ENSSSCP00000004471  ---------------------------cfvwnnslgsigvnfkrnyeevscdstvskvipgngklllgsnqneiaslk
ENSSSCP00000004541  ---------------------------kasmvpstyhsasppgytildvdanamlfvggltgklkkadavrvitftgc
ENSSSCP00000020853  ---------------------------dknsssfavlshedltltretvtlsfrttatpslllyvssfheeylsvila
ENSSSCP00000006241  ---------------------------asripgadaagnvaghflslqrawgqlteearvltpllgpsgprcelhlay
ENSSSCP00000026906  ---------------------------weglngdhitlelrrgklyf...............................
ENSSSCP00000016389  ---------------------------slqirynlggtrepynidvehrnmangqphsvnitrhektiilkvsicyls
ENSSSCP00000006954  ---------------------------hdsgaedatveasppfafltigmgkillgagassnagltgrdgpatsctvp
ENSSSCP00000015012  ---------------------------eftvmgrlnkailrylkndgkihlvvfnnlqladgrrhrlllrltnlhrga
ENSSSCP00000016392  ---------------------------frtwnpnglllfshfadnlgnveidlteskvgvhinitqt...........
ENSSSCP00000027979  ---------------------------ksetqeavmdrvkfqriyqfarlnytqkatsskpeapqlhdvdskssntll
ENSSSCP00000004016  ---------------------------ksetqeavmdrvkfqriyqfarlnytqkatsskpeapqlhdvdskssntll
ENSSSCP00000020473  ---------------------------nspkslflgkvietgkidqeihkyntpgftgclsrvqfn............
ENSSSCP00000008195  ---------------------------qpgpswqpvsvnytsqgqiqftlvgvfgkipepavavdaisiapc......
ENSSSCP00000030974  ---------------------------aderwkmgkiqlyrgvgtpksiifeaergkgrtgeialdgvlllsgfc...
ENSSSCP00000019430  ---------------------------hepfsvtedyplhpssietqlvvgacwqeysgvendnetepepmasaggdl
ENSSSCP00000022637  ---------------------------ftrnggnatlqvdnwpvnehyptgnt.........................
ENSSSCP00000014907  ---------------------------dnfiicgdrrvvddwandgwg..............................
ENSSSCP00000017077  ---------------------------kreyatvmlpdhsfcdslwhnitivhmpgkrpfgqslvyiydngqqkvyap
ENSSSCP00000010815  ---------------------------qhllrtddvisccldlsapsisfringqpvqgmfenfnidglffpvvsfsa
ENSSSCP00000009337  ---------------------------enyhnqtisfredfhyndtdgyfiiggsryvagiegffgplkyyrlhalhp
ENSSSCP00000019007  ---------------------------gttildeyghnldrlkagdtvgvvrredgtlhffvngmtqgpaawnvppgv
ENSSSCP00000024991  ---------------------------dgdeasavrtnsplqvktgekyffg..........................
ENSSSCP00000009843  ---------------------------nstaalyidgqlvgtvklhyvhstpggsgsanppvvstvyaymg.......
ENSSSCP00000019007  ---------------------------rdgrsvleeygqdldqlgegdrvgvertvagelrlwvngrdcgvaatglpa
ENSSSCP00000023477  ---------------------------qlhivstrl..........................................
ENSSSCP00000009452  ---------------------------ktatfqrrnvpipptpdngcwkiqvwa........................
ENSSSCP00000003203  ---------------------------pedvvsccldlsvpsisfringcpvqgvfeafnlnglffpvvsfsagvkvr
ENSSSCP00000003203  ---------------------------kcsncymvwggdfvspgqqgrishtdlvigclvdlatglmtftangkesnt
ENSSSCP00000022093  ---------------------------vnlyevaqrrpgsfanvsidmcai...........................
ENSSSCP00000027047  ----------------F----------aglprkvenalikpinprldgcirgwnl.......................
ENSSSCP00000006952  ---------------------------gkinkvlvryqredgkvhavnlqqagladgrthtallrlrgpsrpspalql
ENSSSCP00000011072  ---------------------------mepeddlepsagrqlrvrcgqllacgqwhhlavvvskemkrnctvstyldg
ENSSSCP00000023964  ---------------------------mepeddlepsagrqlrvrcgqllacgqwhhlavvvskemkrnctvstyldg


                                                                                                    
                                                                                                    
d1ux6a1               ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000015013  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000014796  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000014907  dadlktyftdkkthlytlilnpdnsfeilvdqavvnsgnllndmtppv..............................
ENSSSCP00000005280  anqalascqrdfrnkpypirakiiyyqktltvmihngftpdkndyefcakvenmiipaqghfgisaatggladdhdvl
ENSSSCP00000024403  tplplagpprrvgifldyesgdisfynmtdgshiysfpsasfsgplrpffclwscgkkplticpi.............
ENSSSCP00000001201  tplplagpprrvgifldyesgdisfynmtdgshiysfpsasfsgplrpffclwscgkkplticpi.............
ENSSSCP00000029440  tplplagpprrvgifldyesgdisfynmtdgshiysfpsasfsgplrpffclwscgkkplticpi.............
ENSSSCP00000001416  giragrknaapltirpp.............................................................
ENSSSCP00000029869  giragrknaapltirpp.............................................................
ENSSSCP00000030828  giragrknaapltirpp.............................................................
ENSSSCP00000026179  glnlenfydktsytimfgpdkcgedyklhfifrhkhpktgvfeekhakppdvdlkkfftdrkthlytlvmnpddtfev
ENSSSCP00000014929  l.............................................................................
ENSSSCP00000029385  pvrpyfslsysggksaapliicpm......................................................
ENSSSCP00000001288  pvrpyfslsysggksaapliicpm......................................................
ENSSSCP00000024192  ctaivrnlhydtflviryvkrhltimmdidgkhewrdcievpgvrlprgyyfgtssitgdlsdnhdvislklfel...
ENSSSCP00000015699  hgsliysfsecafagpvrpffnpgfndggrnappltlcpl......................................
ENSSSCP00000001200  mrdrshiytcprspfseplrpflrlgsddsplficp..........................................
ENSSSCP00000008754  grptelggctaivrnlhydtflviryvkrhltimmdidgkhewrdcievpgvrlprgyyfgtssitgdlsgt......
ENSSSCP00000015688  pgrllpyfspcysiganntapltics....................................................
ENSSSCP00000029029  ndeywaltspetqlipkehparvcifleyeegrisfynmtdkshihtfsqgsfegplkpffrlwpsdsaclticpv..
ENSSSCP00000014840  nqlfsgflrpyfficdttplilppltk...................................................
ENSSSCP00000021212  vsavwghcevtmryingldpeplplmdlcrrsir............................................
ENSSSCP00000014732  g.............................................................................
ENSSSCP00000003582  lptaeplrpffspgsatrdaqcflricpv.................................................
ENSSSCP00000005042  nnnlnkvgiyldyeggqvsfynaktmnhiytfsstfmeklypyfcpclndggenkeplhivh................
ENSSSCP00000009237  lfrlwssds.....................................................................
ENSSSCP00000006271  frlwssds......................................................................
ENSSSCP00000006272  frlwsfdsgsl...................................................................
ENSSSCP00000009236  lfrlwssdsgsl..................................................................
ENSSSCP00000007533  frlwssdsgsl...................................................................
ENSSSCP00000014615  mfgpdicgpgtkkvhvifnykgknvlinkdirckddefthlytlivrpdntyevkidnsqvesgsleddwdflppkki
ENSSSCP00000022095  iltfthsffgplrpffesclhdggkniaplvics............................................
ENSSSCP00000027530  frlwssdsgflticp...............................................................
ENSSSCP00000024940  ngywvmglwngceyfvldphrvaltmhvpprcvgifldcdagklsffnvtdgshiftftdtfsetlcayfrprahdgs
ENSSSCP00000002077  ritywrqrlrlslnsgltpsdpdelcvdvgplllapggffgvlaatstladdhdvlsfltfslse.............
ENSSSCP00000023787  ritywrqrlrlslnsgltpsdpdelcvdvgplllapggffgvlaatstladdhdvlsfltfslse.............
ENSSSCP00000004776  hnnlscleplcpffslelpregekgaslkicp..............................................
ENSSSCP00000021310  hnnlscleplcpffslelpregekgaslkicp..............................................
ENSSSCP00000004184  ktikcrdhkdthlytliihpnatyevkidnqqvaagdleddwaflpprkikdpyaqkp....................
ENSSSCP00000003925  pgqshangknvqplrin.............................................................
ENSSSCP00000027015  ylgpafrglkgrtlypavsavwgqchvrisyl..............................................
ENSSSCP00000008227  qgklypildtcwhergsnslpm........................................................
ENSSSCP00000005767  fqeplypalrlwega...............................................................
ENSSSCP00000024925  vhllykfkvafaealypafwvfsagatlsics..............................................
ENSSSCP00000018810  rvpfhrvdtisvtgivqlsyisfqnth...................................................
ENSSSCP00000014885  gapk..........................................................................
ENSSSCP00000028656  kheyrayedssaslllsmtvpprrvgvfldyeagtvsfynvtnhgfpiytfskyyfpstlcpyfnpcncvvpmt....
ENSSSCP00000030393  ptftvwnkcltiitglpipd..........................................................
ENSSSCP00000030993  ptftvwnkcltiitglpipd..........................................................
ENSSSCP00000012889  ptftvwnkcltiitglpipd..........................................................
ENSSSCP00000029279  ptftvwnkcltiitglpipd..........................................................
ENSSSCP00000030659  ptftvwnkcltiitglpipd..........................................................
ENSSSCP00000005403  igvlldlnrktltffindeqqgpvafdnveglffpavslnrnvqvtlhtglpvpd.......................
ENSSSCP00000001314  etrapiftfaasfsgkvfpffavwkkgs..................................................
ENSSSCP00000009454  gigvyldyelgvisfynlkdrshihsftdsfsgvlkpyfcvgcds.................................
ENSSSCP00000001560  ypyfslrgagtsltic..............................................................
ENSSSCP00000001564  ypyfslrgagtsltic..............................................................
ENSSSCP00000023159  knafkykafedastcdlnvltlsgavpplrvgvfldceagtvsffnvtnygsliyrfskcsfsqnvypyfnpwncpap
ENSSSCP00000028586  ypyfslrgagtsltic..............................................................
ENSSSCP00000021328  pdghqltfpnrlgyshlsylsvqggfsitsfkl.............................................
ENSSSCP00000021030  knafkykafedastcdlnvltlsgavpplrvgvfldceagtvsffnvtnygsliyrfskcsfsqnvypyfnpwncpap
ENSSSCP00000001553  vfldheegdvsfynmtdgshifsftgvsfsgalcpyfklragdvsmtics............................
ENSSSCP00000015601  knafkykafedastcdlnvltlsgavpplrvgvfldceagtvsffnvtnygsliyrfskcsfsqnvypyfnpwncpap
ENSSSCP00000001716  sgpfqiifegvrgsgylgdiaiddvtlkkgec..............................................
ENSSSCP00000019609  ytfrvnfqervfplfsvcstgtylr.....................................................
ENSSSCP00000022993  ytfrvnfqervfplfsvcstgtylr.....................................................
ENSSSCP00000001312  laleehprqvrvsidyevgwvtfvnavtqepiytftasftqkvfpffglwgrg.........................
ENSSSCP00000029343  slicnflscsfsfplrpfiwrg........................................................
ENSSSCP00000015849  splrpflclr....................................................................
ENSSSCP00000005434  vndahllqynhrmrnlreisklgisgditltsas............................................
ENSSSCP00000030635  vndahllqynhrmrnlreisklgisgditltsas............................................
ENSSSCP00000019990  ikfksylyfeekdfvdkaekslkqtphseiifykngvnqgvaykdifegvyfpaislyksctvsinfgp.........
ENSSSCP00000021698  lgvaftdlpanlyptvglqtpgeivdanfgqqpflfdiedymrewra...............................
ENSSSCP00000025036  tltffindeqqgpvafdnveglffpavslnrnvqvtlhtglpvpd.................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000015851  splrpylff.....................................................................
ENSSSCP00000013361  tfdvtfilpvcptftiwnkslmilsglpa.................................................
ENSSSCP00000009456  t.............................................................................
ENSSSCP00000018791  qekllyeypvsasfalypafwlygly....................................................
ENSSSCP00000010821  iygkviihslgf..................................................................
ENSSSCP00000000129  dgdfkikcvaf...................................................................
ENSSSCP00000011201  khytlnseaplyvggmpvdvnsaafrlwqilngssfhgcirnlyinnelqdftktrmkpgvvpgc.............
ENSSSCP00000015852  licnflscsfsfplrpfiwrg.........................................................
ENSSSCP00000017851  spgmmrqlningalyvggmkeialhtnrqymrglvgcishft....................................
ENSSSCP00000009455  ftgklmpyfsvrpss...............................................................
ENSSSCP00000012112  llggvpnlpenfpvshkdfvgcmrdlhidgrqvdmagfvanngtmagcqak...........................
ENSSSCP00000006826  mwdyvlspeeintvyaggtfspnvlnwralryemsgevyvkpql..................................
ENSSSCP00000029570  mwdyvlspeeintvyaggtfspnvlnwralryemsgevyvkpql..................................
ENSSSCP00000018163  pqgvlvlgqeqdtlgggfdatqafvgelahfniwdrkltpgevynlatcstkalsgnviswaeshieiyggatk....
ENSSSCP00000005380  vniypitsfqlifegirgpgiegdiaiddisiaegec.........................................
ENSSSCP00000000853  lpvgttfwlgqrnnahgyfkgimqdvqllvmpqgfiaqcpdlnrtc................................
ENSSSCP00000009453  iftgklmpyf....................................................................
ENSSSCP00000008124  afvgelsqfniwdrvlraqeiigiancstnmagniipwvdnnvdvfggaskw..........................
ENSSSCP00000025878  aiftgklmpyfsvgssst............................................................
ENSSSCP00000026387  evggdlqlelvk..................................................................
ENSSSCP00000019654  mwdyvlspeeistvyaggtfspnvlnwralsyemsgevyvkpqlwp................................
ENSSSCP00000024906  htllylggvepsvqlppatnvsahfhgcigevsvngkrldltysflgsrgi...........................
ENSSSCP00000015599  sffnitnhgsliyrfsscpfsqatfpyfnpmkchipmilcs.....................................
ENSSSCP00000024988  qvgvfldyeaglvsfidvatsslicsflscsfssalkaflcsg...................................
ENSSSCP00000024616  qvgvfldyeaglvsfidvatsslicsflscsfssalkaflcsg...................................
ENSSSCP00000021918  qvgvfldyeaglvsfidvatsslicsflscsfssalkaflcsg...................................
ENSSSCP00000009325  tlnfdsplyvggmpgknnvaaalrqapghngtsfhgcirnlyinselqdfrkvpmqtgilpgc...............
ENSSSCP00000022455  spgmmrqlningalyvggmkeialhtnrqymrglvgcishft....................................
ENSSSCP00000010821  dvrefkvaingvhsleykhrfrelsnidtleidgdihllevr....................................
ENSSSCP00000001973  kkigilldyensklsffnvglsqhlytfscqlhqfvhpcfslekpgclkihngismp.....................
ENSSSCP00000017851  vtgqsqgqyskitfrtplyvggapsvywlvratgtnrgfqgcvqsltvngkrmdlrpwplgkalsgadvgecssg...
ENSSSCP00000022455  vtgqsqgqyskitfrtplyvggapsvywlvratgtnrgfqgcvqsltvngkrmdlrpwplgkalsgadvgecssg...
ENSSSCP00000013885  dtlgiygdilvtavg...............................................................
ENSSSCP00000006160  hpiidvngiivfgtrildeevfegdiqqllfvsdhraaydycehyspdc.............................
ENSSSCP00000023414  plgqvgvfldheaglvsfidvatsslicsflscsfssslkaflcsg................................
ENSSSCP00000029303  ffdvcwhdkgknaqplllv...........................................................
ENSSSCP00000008285  ffdvcwhdkgknaqplllv...........................................................
ENSSSCP00000024906  ssgitgciknlvlhsarp............................................................
ENSSSCP00000005158  dcekmenaeldvpiqsiftrdlasianlriakggvndnfqgvlqnvrfvfgttpedilrnkgcs..............
ENSSSCP00000029039  arildeevfegdvqelviipgvqaayesceqkeldc..........................................
ENSSSCP00000018428  vhrfvlngdferlnldnemfigglvgaaqknlayrhnfrgcienvifn..............................
ENSSSCP00000006832  mctscypgniltwqaltykargyvvvkpkv................................................
ENSSSCP00000006161  hpiidvngiivfgtrildeevfegdiqqllfvsdhraaydycehyspdc.............................
ENSSSCP00000018218  gmdldlasgclsfyslepktqllhtfhaiftrplypifwllegrtltlc.............................
ENSSSCP00000018024  lqkqpavsinsplylggiptstglsalrqgadrplggfhgcihevrinnelqdfkalppqalgvspgc..........
ENSSSCP00000001598  arildeevfegdvqelviipgvqaayesceqkeldc..........................................
ENSSSCP00000030976  arildeevfegdvqelviipgvqaayesceqkeldc..........................................
ENSSSCP00000011839  ydqlvwmaighqgdhwkegrvllhkslklyqvifegeigkgslggiavddisisnh......................
ENSSSCP00000030667  kvgvhvnheggevvfydsitssriytfhtsfpgqvlpffrllfpg.................................
ENSSSCP00000001317  kvgvhvnheggevvfydsitssriytfhtsfpgqvlpffrllfpg.................................
ENSSSCP00000003232  mqvwrdvslssv..................................................................
ENSSSCP00000013851  hsngarnldlkgelyigglsknmfnnlpklvasrdgfqgclasvdln...............................
ENSSSCP00000023132  neapvtgssplgatqldtdgalwlggleklpggqalpkaystgfvgclrdvvvgrrplhlledavtkpelrpcp....
ENSSSCP00000016666  vdkhtqhfrtkgeadaldidyelsfggipvpgkpgtflkknfhgcmenlyyn..........................
ENSSSCP00000004335  kteqsrmyvakgsareshfrgllqnvflvfensvedllskkgc...................................
ENSSSCP00000019848  vdgqvasaapsmgpehiysggsyyfggcpdnsvaskcrsplsgfqgcmrlis..........................
ENSSSCP00000010319  gelsfydaerhchlytfharfgevrpyfyvggsrgdgppeplricpl...............................
ENSSSCP00000022089  rdpraplrivp...................................................................
ENSSSCP00000007459  hgrspqvgngfrgcmdsiylngqelplnnkprsyahieesvdvspgcllt............................
ENSSSCP00000001326  tfhtsfpgqvlpffrllfpg..........................................................
ENSSSCP00000001327  rdrraplrivp...................................................................
ENSSSCP00000005851  vlgqeqdikgegfnpaesfvgsisqlnlwdyvlspqqvkslatscpeelskgnvlawpdflsgivgrvkidsk.....
ENSSSCP00000010214  kvnrdavmkiavagelfqldrglyhlnltvggipfkekdlvqpmnprldgcmrswnw.....................
ENSSSCP00000025497  ceeqghvsfprssqalafepsagifvgnagatglerftgsiqqltvhpdprtpeelce....................
ENSSSCP00000030716  peeydqlvwmaighqgdhwkegrvllhkslklyqvifegeigkgslggiavddisisnh...................
ENSSSCP00000029973  peeydqlvwmaighqgdhwkegrvllhkslklyqvifegeigkgslggiavddisisnh...................
ENSSSCP00000004541  gglpinyttrrigpvtysidgcirnfqmteapadlerptssyhvgt................................
ENSSSCP00000026569  qvingaknldlkgdlymaglaqgmysnlpklvasrdgfqgclasvdln..............................
ENSSSCP00000000431  dvnrvavvhtlqtdfrgpvvpafalwdgellthsgle.........................................
ENSSSCP00000020796  dvnrvavvhtlqtdfrgpvvpafalwdgellthsgle.........................................
ENSSSCP00000012801  ndqnmekiifqkegnygenwnygqvtlnetvefkvafnafknqflsdialddisltygic..................
ENSSSCP00000016666  clnptkafqgcmrlifid............................................................
ENSSSCP00000023132  tpgphlggrvlertsvsvglrgcirlldvnnqrlelsawqgsatrssrvgecgdhpcvpspc................
ENSSSCP00000019848  hkhhfhaqgefgylhldyeisfggipapgksvsfphknfhgclenlyyn.............................
ENSSSCP00000006241  alddvavrpgpc..................................................................
ENSSSCP00000020492  htgslsfvdvarrsliwryedgvftfpvkpftctg...........................................
ENSSSCP00000008085  vqvlsdhrlaqvelarr.............................................................
ENSSSCP00000018239  gvsliyrflaafleplypavmvssgasvtl................................................
ENSSSCP00000021088  gvsliyrflaafleplypavmvssgasvtl................................................
ENSSSCP00000003894  lfealispdrrgymglddilllsypc....................................................
ENSSSCP00000020352  l.............................................................................
ENSSSCP00000024007  l.............................................................................
ENSSSCP00000012140  gtlsfclngvslgtafenlsrglgmayfpaislsfkesvafnfgsrplryplagyrplqdpp................
ENSSSCP00000015856  fgalvqadnirsltdtrvtqvlsgfqgcldsvvlnnnelplqnkr.................................
ENSSSCP00000000096  lggrfdatqafvgdiaqfnlwdhaltpaqvlglanctgpllgnilpwedklvevfggat...................
ENSSSCP00000022990  lddgtlsfclngvslgtafenlsrglgmayfpaislsfkesvafnfgsrplryplagyrplqdpp.............
ENSSSCP00000009188  tigcyldidkghvkfskngkdlglafeipphmknqalfpacvlknaelkfnfgeeefkfp..................
ENSSSCP00000030087  aglqerlvllgrhlqgsvltfigglpdvpvtsapvtafyrgcmtlevngkaldldeatykhsditahscppv......
ENSSSCP00000012497  gfdeilafsgrltgfniwdrvlsteeikktggaeschirgnvvgwg................................
ENSSSCP00000031041  gekainassnitsdgvevlgrmvrsrgpngnsapfqlqmfdivcstswankdkcc.......................
ENSSSCP00000004838  qeagnittdgyeilgkllkgerksatfqiqnfdivcspvwtsrdrccd..............................
ENSSSCP00000025331  ssetadanrvfcgqlgavyvfseal.....................................................
ENSSSCP00000006405  gekainassnitsdgvevlgrmvrsrgpngnsapfqlqmfdivcstswankdkcc.......................
ENSSSCP00000013851  dlplppevwtaalragyvgcvrdlfidgrsrdlrglaeaqgavgvapfc.............................
ENSSSCP00000005821  ..............................................................................
ENSSSCP00000004541  dtndpvfvggfpdglnqfglttnirfrgcirflrltkgtgkplevnfakalelrgvqpvscp................
ENSSSCP00000021819  gvprsrvvrkgvssksylgciknleisrstfdllrnsygvrkgcvlep..............................
ENSSSCP00000018415  lfiqvdyfplteqkfsllvdsqldspkalylgrvmetgvidpeiqryntpgfsgclsgvrfn................
ENSSSCP00000013851  gahtrlefhnietgimterrfisvvpsnfighlsglvfn.......................................
ENSSSCP00000010214  aglqerlvllgrhlqgsvltfigglpdvpvtsapvtafyrgcmtlevngkaldldeatykhsditahscppv......
ENSSSCP00000011618  acalqnsflgglpegtirslpvdtlpstpslvgclqdieigsnpitpesissgwslnvkagcvrkdwceshpc.....
ENSSSCP00000008984  fvgglppelraaalkltlasvrerepfkgwirdvrvn.........................................
ENSSSCP00000004615  ieslpikprgqidvdgfavlgklvdnpqvsvpfelqwmlihcdplrps..............................
ENSSSCP00000030087  kvnrdavmkiavagelfqldrglyhlnltvggipfkekdlvqpmnprldgcmrswnw.....................
ENSSSCP00000004918  afedvdaaelypcvmfyssnpgekvkicdmqmrgtprdllpgdpicspv.............................
ENSSSCP00000007532  frlwssdsgsln..................................................................
ENSSSCP00000004775  vfvggvpeslltprlapgrpftgcirhfvidgrpvsfskaalvsgavsinscpa........................
ENSSSCP00000008985  vggspstadlpgspvsnnfmgclk......................................................
ENSSSCP00000018428  pkpasrwgchsnqtafhgcmellkvd....................................................
ENSSSCP00000004775  gravknvqinsvysfsgclsnlqlngasissasqt...........................................
ENSSSCP00000008158  dsemspfvgiwaicwssagfrpltrppasptkrepalhgvgifldqgagevsfysaaegehlhtfscpvsnlrpffwl
ENSSSCP00000013851  fyiggspntadlpgspvsnnfmgclkdvvyknndfkl.........................................
ENSSSCP00000026169  dsemspfvgiwaicwssagfrpltrppasptkrepalhgvgifldqgagevsfysaaegehlhtfscpvsnlrpffwl
ENSSSCP00000023415  srslralqlepdarlfvaqagradpdkfqgmiselrvrgdpqvsplqcr.............................
ENSSSCP00000027051  ekktvtmivdckkkttkpldrseraivdtngitvfgtrildeevfe................................
ENSSSCP00000026077  gegqsgelqpqrpymdvvsdlflggvpadirpsaltldgvqampgfkglildlk........................
ENSSSCP00000004541  lkkysgclkdieisrtpynilsspdyvgvtkgcsle..........................................
ENSSSCP00000027650  gndvelsftkngkwmgiafriqkealggqalyphvlvkncavefnfgqraep..........................
ENSSSCP00000019848  nqwhhvrvernikeasvqvdqlsprrqpapadghvllqlnsqlfvggta.............................
ENSSSCP00000023361  ffnitnhgsliyrfsscpfsqatfpyfnpmkchipmilcs......................................
ENSSSCP00000026213  nylsvtvdgqvasaapsmgpehiysggsyyfg..............................................
ENSSSCP00000023132  dgprvlgespvphtilnlkeplyiggapdfsrlaraaavssgfdgaiqlvalngrqlltrehv...............
ENSSSCP00000008195  gspagsppsslwervgpqspewlntsvtipsghqqpmqlifeavrgtntafvvalgfvlinhgtc.............
ENSSSCP00000006241  vwgtgghlrhqwlegrvqvasaeefqivfeatlggqpalgpialddveylag..........................
ENSSSCP00000025417  qrlelsawq.....................................................................
ENSSSCP00000016447  sedghcfrghlgtlvfwstarpqshlq...................................................
ENSSSCP00000021819  invsnlyiggvpegveapvlkmrssfqgciqnlifnmelldftgaigyehvdldscsps...................
ENSSSCP00000006241  satrnathrgavalddmafgr.........................................................
ENSSSCP00000019848  enarrqvhlasgtelsairslvlgrilehsevdqetalagaqgflgclsavql.........................
ENSSSCP00000021829  devrvlahpc....................................................................
ENSSSCP00000020853  ss............................................................................
ENSSSCP00000013851  drwhmvlltrdarrtalavdgearaaevrskrremqvasdlfvggippdvrlsaltlstvkyeppfrgllanlk....
ENSSSCP00000016390  splnddqwhrvtaernvkqaslqvdrlpqqvrkapteghtrlelysqlfvg...........................
ENSSSCP00000004039  gdslgglsiddinlsetqc...........................................................
ENSSSCP00000014354  htfkakftqpllpaftvwcgsfhvttglqvp...............................................
ENSSSCP00000020506  iylddvtltetpc.................................................................
ENSSSCP00000001881  iylddvtltetpc.................................................................
ENSSSCP00000013851  ypagnfdnerlaiarqripyrlgrvvdewlldkgrqltifnsqaaikiggrdqgrpfqgqvsglyyn...........
ENSSSCP00000016666  deqlrlsynfspeaefragksltlgkvtetlgldaevakanilgfigclasvqyn.......................
ENSSSCP00000005883  fgkmsphavqfegalcqfsiypvtrvahnycthlrkqc........................................
ENSSSCP00000004543  ..............................................................................
ENSSSCP00000003039  pfkyp.........................................................................
ENSSSCP00000018415  nasegtspnctg..................................................................
ENSSSCP00000027862  fgendvigcfanfeaeevelsfskngedlgvafriskesladrallphvlckncvvelnfgqkeepf...........
ENSSSCP00000004541  iggappefqppplrtipsfegciwnlvinsvpmdfaqpvsfknadigrcah...........................
ENSSSCP00000018099  petcqglrpegdlflgglvlshsspnvsqgfegcldavvingealellahgkkaagllerraltpcc...........
ENSSSCP00000012904  salawektrsaderwkmgkiqlyrgvgtpksiifeaergkgrtgeialdgvlllsgfc....................
ENSSSCP00000030031  salawektrsaderwkmgkiqlyrgvgtpksiifeaergkgrtgeialdgvlllsgfc....................
ENSSSCP00000004614  lhqlkiycdlnfiaqetcc...........................................................
ENSSSCP00000027678  ..............................................................................
ENSSSCP00000017907  pnfrgcmedvvfnqrei.............................................................
ENSSSCP00000027979  ylgaspsgkskslpqnsfvgclrnfqldlkpletpsaslgvspc..................................
ENSSSCP00000004016  ylgaspsgkskslpqnsfvgclrnfqldlkpletpsaslgvspc..................................
ENSSSCP00000003680  plhpssietqlvvgacwqggdlhmtqffrgnlagltirsgkladkkvidclytc........................
ENSSSCP00000001127  qhpfvfdiedymrewr..............................................................
ENSSSCP00000006241  hggfawrlgsvdvqaerawrvvfeavaagverayialddlllqdgpc...............................
ENSSSCP00000001629  ..............................................................................
ENSSSCP00000005988  fsgnltdfhlwartlspvqlnrarscapplggllfrwdl.......................................
ENSSSCP00000024916  fsgnltdfhlwartlspvqlnrarscapplggllfrwdl.......................................
ENSSSCP00000021132  ynrwknselrcyvngelasygeitwfvnts................................................
ENSSSCP00000017907  fvprksarglsfkgcirgleanskkralkdallskdiaagc.....................................
ENSSSCP00000005893  ifspltqkckvlmlggsalnhnyrgyverfslwkvartqqevlldme...............................
ENSSSCP00000029807  lasianlriakggvndnfqgvlqnvrfvfgttpedilrnkgcs...................................
ENSSSCP00000011596  ekfdendvitcfanfesdevelsyakngqdlgiafkiskevlaerplfphvlchncavefnfgqkekpy.........
ENSSSCP00000002048  nrgvlssleprgslllggldaeasrplqehrlglavnvsllgcledlsvngqrwglrdalltrsmaagc.........
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000012112  rlhvgglppgseeeapqglvgciqgvwlgstplgspallppshrvnvepgcvvtna......................
ENSSSCP00000018222  icleyadralafyavqdgkmsllrrlk...................................................
ENSSSCP00000029355  icleyadralafyavqdgkmsllrrlk...................................................
ENSSSCP00000003233  ..............................................................................
ENSSSCP00000023342  lqsinfiggqp...................................................................
ENSSSCP00000023857  tqlvvgacwqeysgvendnetepepmasaggdlhmtqffrgnlagltirsgkladkkvidclytc.............
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000023656  pvghvflgldaeqgkpvsfdlqqahiycdpefvleegcc.......................................
ENSSSCP00000001565  ..............................................................................
ENSSSCP00000003907  pvghvflgldaeqgkpvsfdlqqahiycdpefvleegcc.......................................
ENSSSCP00000012436  icdkewhyyvinvefpvvtlymdgatyepylvtndwpihpshiamqltvgacwqggevtkprfaqffhgslasltirp
ENSSSCP00000001558  ..............................................................................
ENSSSCP00000004775  mdnekmkipftdiyiggappeilqssrtlrahlpleinfrgcmkgfqfqkkdfnlleqtetlgigygcpe........
ENSSSCP00000010407  vigseqdqtkrydngafdefiiweraltpdeiamyft.........................................
ENSSSCP00000027979  gllkiqvnhvpipvteatqvqgtvslngcp................................................
ENSSSCP00000004016  gllkiqvnhvpipvteatqvqgtvslngcp................................................
ENSSSCP00000026273  ggqatdntqglrgclstidisgihlsyfenvpg.............................................
ENSSSCP00000027979  rdfsdsqqslrlggsqfegcisnvfvrrlmespkvldlaskstkrdvslggcs.........................
ENSSSCP00000004016  rdfsdsqqslrlggsqfegcisnvfvrrlmespkvldlaskstkrdvslggcs.........................
ENSSSCP00000015120  ..............................................................................
ENSSSCP00000029926  ..............................................................................
ENSSSCP00000019261  vqfegalcqfsiypvtrvahnycthlrkqc................................................
ENSSSCP00000027979  lssiegdafdfstyylggipisirerfnistpafrgcmknlrktsgvvrlndtvgvtkrc..................
ENSSSCP00000004016  lssiegdafdfstyylggipisirerfnistpafrgcmknlrktsgvvrlndtvgvtkrc..................
ENSSSCP00000019207  dmqmrgtprdllpgdpicspva........................................................
ENSSSCP00000025417  vtgssplgatqxdtdgalwlggleklpggqalpkaystgfvgclrdvvvgrrplhlledavtkpelrpc.........
ENSSSCP00000024968  rgvlssleprgslllggldaeasrplqehrlglavnvsllgcledlsvngqrwglrdallt.................
ENSSSCP00000001308  mr............................................................................
ENSSSCP00000004775  eqtqagekkfyfggspispqyanftgcisnayftsykhrldrdv..................................
ENSSSCP00000025895  rgvlssleprgslllggldaeasrplqehrlglavnvsllgcledlsvngqrwglrdallt.................
ENSSSCP00000022922  rgvlssleprgslllggldaeasrplqehrlglavnvsllgcledlsvngqrwglrdallt.................
ENSSSCP00000002048  plevpyglflggtgsldlpylrgasrplrgclhtatlngrsl....................................
ENSSSCP00000000712  kleqvcddewhhyalnlefptvtlyadgisfdpalihdnglihpprrepalmigacwaeeknkekekggdnstdatpg
ENSSSCP00000022455  ksglllliwhnhqlvtesqkdgiftflsvnnip.............................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000016392  arrkklepsnvgnlsfsc............................................................
ENSSSCP00000008559  g.............................................................................
ENSSSCP00000021819  cfgs..........................................................................
ENSSSCP00000003203  pvcslgpgqvghlnlgqd............................................................
ENSSSCP00000010021  vypvvyvddsaildcqfsefyhtpppgfe.................................................
ENSSSCP00000010815  csl...........................................................................
ENSSSCP00000020574  tislggip......................................................................
ENSSSCP00000016666  akvtsgvrpgcpghcss.............................................................
ENSSSCP00000022958  ..............................................................................
ENSSSCP00000005978  qdlrlnglhlpffppl..............................................................
ENSSSCP00000017851  svelptweslkkis................................................................
ENSSSCP00000021247  ..............................................................................
ENSSSCP00000012777  aiakhndirahscpsv..............................................................
ENSSSCP00000006241  rgrrgelgaawvrdrvdiqsgrpfrillaaqtgpggvvglddlilsdhc.............................
ENSSSCP00000028807  ..............................................................................
ENSSSCP00000013885  elhisgsiqlycvhy...............................................................
ENSSSCP00000025417  ra............................................................................
ENSSSCP00000004775  gclelatlnndvislynfkhiynmdps...................................................
ENSSSCP00000024968  vqggplevpyglpylrgasrplrgclhtatlngrsl..........................................
ENSSSCP00000000277  geeeeeeeeeeddgeeieqehegkkvvvfftrngkiivkkdavvpsggffptigmlscgekvkv..............
ENSSSCP00000027978  fdpalihdnglihpprrepalmigac....................................................
ENSSSCP00000005978  pgaarvllaenftgclgrvalgglplplarp...............................................
ENSSSCP00000014530  ..............................................................................
ENSSSCP00000023947  ..............................................................................
ENSSSCP00000025895  qggplevpyglpylrgasrplrgclhtatlngrsl...........................................
ENSSSCP00000022922  qggplevpyglpylrgasrplrgclhtatlngrsl...........................................
ENSSSCP00000005978  sqapmpagfcssqlgggafagclqdvhvdghlllped.........................................
ENSSSCP00000026588  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000000277  rlhl..........................................................................
ENSSSCP00000004471  gdiynfrlwnftmnsktlsnlscnvkgnvvdwqndfwnip......................................
ENSSSCP00000004541  mgetyfdskpiglwnfrevegdckgc....................................................
ENSSSCP00000020853  pnevlltqvnisvhmnklvlqfilkdd...................................................
ENSSSCP00000006241  yfqsqpqgflelvvvegsrrelvwqapvhspvgwkmdtillgarhrpfrpppaklefvglvdldgpgqqgagvdhvtl
ENSSSCP00000026906  ..............................................................................
ENSSSCP00000016389  ivhdivmqslssvilg..............................................................
ENSSSCP00000006954  lpprlgicldyergrvsfldavsfrgllecpldcsgpvcpafcfigggavq...........................
ENSSSCP00000015012  gsvelyldctqvdsih..............................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000027979  nldpenvvfyvggypsdfrlpsrlrfppykgcielddlnenvlslynfkkt...........................
ENSSSCP00000004016  nldpenvvfyvggypsdfrlpsrlrfppykgcielddlnenvlslynfkkt...........................
ENSSSCP00000020473  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000030974  ..............................................................................
ENSSSCP00000019430  hmtqffrgnlagltirsgkladkkvidclytc..............................................
ENSSSCP00000022637  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000017077  lrfpamnepfisccigsagqrt........................................................
ENSSSCP00000010815  gikvrfllggrhgefkflpppgya......................................................
ENSSSCP00000009337  aq............................................................................
ENSSSCP00000019007  yavvdlygqaaqativ..............................................................
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  ..............................................................................
ENSSSCP00000019007  rvwavvdlygkctqitvlppepgf......................................................
ENSSSCP00000023477  ..............................................................................
ENSSSCP00000009452  ..............................................................................
ENSSSCP00000003203  fllggrhgefkflpppgyap..........................................................
ENSSSCP00000003203  ffqvepntklfpavfvlpt...........................................................
ENSSSCP00000022093  ..............................................................................
ENSSSCP00000027047  ..............................................................................
ENSSSCP00000006952  yvdcklgdqh....................................................................
ENSSSCP00000011072  qvigtakmlyiqvlp...............................................................
ENSSSCP00000023964  qvigtakmlyiqvlp...............................................................


                                                         
                                                         
d1ux6a1               ...................................
ENSSSCP00000029807  ...................................
ENSSSCP00000005158  ...................................
ENSSSCP00000015013  ...................................
ENSSSCP00000015012  ...................................
ENSSSCP00000014796  ...................................
ENSSSCP00000006952  ...................................
ENSSSCP00000004335  ...................................
ENSSSCP00000014907  ...................................
ENSSSCP00000005280  sfltfqlte..........................
ENSSSCP00000024403  ...................................
ENSSSCP00000001201  ...................................
ENSSSCP00000029440  ...................................
ENSSSCP00000001416  ...................................
ENSSSCP00000029869  ...................................
ENSSSCP00000030828  ...................................
ENSSSCP00000026179  lidqivvnkgslledvvppinppkeiedpn.....
ENSSSCP00000014929  ...................................
ENSSSCP00000029385  ...................................
ENSSSCP00000001288  ...................................
ENSSSCP00000024192  ...................................
ENSSSCP00000015699  ...................................
ENSSSCP00000001200  ...................................
ENSSSCP00000008754  ...................................
ENSSSCP00000015688  ...................................
ENSSSCP00000029029  ...................................
ENSSSCP00000014840  ...................................
ENSSSCP00000021212  ...................................
ENSSSCP00000014732  ...................................
ENSSSCP00000003582  ...................................
ENSSSCP00000005042  ...................................
ENSSSCP00000009237  ...................................
ENSSSCP00000006271  ...................................
ENSSSCP00000006272  ...................................
ENSSSCP00000009236  ...................................
ENSSSCP00000007533  ...................................
ENSSSCP00000014615  kdpda..............................
ENSSSCP00000022095  ...................................
ENSSSCP00000027530  ...................................
ENSSSCP00000024940  khpdplticpl........................
ENSSSCP00000002077  ...................................
ENSSSCP00000023787  ...................................
ENSSSCP00000004776  ...................................
ENSSSCP00000021310  ...................................
ENSSSCP00000004184  ...................................
ENSSSCP00000003925  ...................................
ENSSSCP00000027015  ...................................
ENSSSCP00000008227  ...................................
ENSSSCP00000005767  ...................................
ENSSSCP00000024925  ...................................
ENSSSCP00000018810  ...................................
ENSSSCP00000014885  ...................................
ENSSSCP00000028656  ...................................
ENSSSCP00000030393  ...................................
ENSSSCP00000030993  ...................................
ENSSSCP00000012889  ...................................
ENSSSCP00000029279  ...................................
ENSSSCP00000030659  ...................................
ENSSSCP00000005403  ...................................
ENSSSCP00000001314  ...................................
ENSSSCP00000009454  ...................................
ENSSSCP00000001560  ...................................
ENSSSCP00000001564  ...................................
ENSSSCP00000023159  mtlcpp.............................
ENSSSCP00000028586  ...................................
ENSSSCP00000021328  ...................................
ENSSSCP00000021030  mtlcpp.............................
ENSSSCP00000001553  ...................................
ENSSSCP00000015601  mtlcpp.............................
ENSSSCP00000001716  ...................................
ENSSSCP00000019609  ...................................
ENSSSCP00000022993  ...................................
ENSSSCP00000001312  ...................................
ENSSSCP00000029343  ...................................
ENSSSCP00000015849  ...................................
ENSSSCP00000005434  ...................................
ENSSSCP00000030635  ...................................
ENSSSCP00000019990  ...................................
ENSSSCP00000021698  ...................................
ENSSSCP00000025036  ...................................
ENSSSCP00000018810  ...................................
ENSSSCP00000015851  ...................................
ENSSSCP00000013361  ...................................
ENSSSCP00000009456  ...................................
ENSSSCP00000018791  ...................................
ENSSSCP00000010821  ...................................
ENSSSCP00000000129  ...................................
ENSSSCP00000011201  ...................................
ENSSSCP00000015852  ...................................
ENSSSCP00000017851  ...................................
ENSSSCP00000009455  ...................................
ENSSSCP00000012112  ...................................
ENSSSCP00000006826  ...................................
ENSSSCP00000029570  ...................................
ENSSSCP00000018163  ...................................
ENSSSCP00000005380  ...................................
ENSSSCP00000000853  ...................................
ENSSSCP00000009453  ...................................
ENSSSCP00000008124  ...................................
ENSSSCP00000025878  ...................................
ENSSSCP00000026387  ...................................
ENSSSCP00000019654  ...................................
ENSSSCP00000024906  ...................................
ENSSSCP00000015599  ...................................
ENSSSCP00000024988  ...................................
ENSSSCP00000024616  ...................................
ENSSSCP00000021918  ...................................
ENSSSCP00000009325  ...................................
ENSSSCP00000022455  ...................................
ENSSSCP00000010821  ...................................
ENSSSCP00000001973  ...................................
ENSSSCP00000017851  ...................................
ENSSSCP00000022455  ...................................
ENSSSCP00000013885  ...................................
ENSSSCP00000006160  ...................................
ENSSSCP00000023414  ...................................
ENSSSCP00000029303  ...................................
ENSSSCP00000008285  ...................................
ENSSSCP00000024906  ...................................
ENSSSCP00000005158  ...................................
ENSSSCP00000029039  ...................................
ENSSSCP00000018428  ...................................
ENSSSCP00000006832  ...................................
ENSSSCP00000006161  ...................................
ENSSSCP00000018218  ...................................
ENSSSCP00000018024  ...................................
ENSSSCP00000001598  ...................................
ENSSSCP00000030976  ...................................
ENSSSCP00000011839  ...................................
ENSSSCP00000030667  ...................................
ENSSSCP00000001317  ...................................
ENSSSCP00000003232  ...................................
ENSSSCP00000013851  ...................................
ENSSSCP00000023132  ...................................
ENSSSCP00000016666  ...................................
ENSSSCP00000004335  ...................................
ENSSSCP00000019848  ...................................
ENSSSCP00000010319  ...................................
ENSSSCP00000022089  ...................................
ENSSSCP00000007459  ...................................
ENSSSCP00000001326  ...................................
ENSSSCP00000001327  ...................................
ENSSSCP00000005851  ...................................
ENSSSCP00000010214  ...................................
ENSSSCP00000025497  ...................................
ENSSSCP00000030716  ...................................
ENSSSCP00000029973  ...................................
ENSSSCP00000004541  ...................................
ENSSSCP00000026569  ...................................
ENSSSCP00000000431  ...................................
ENSSSCP00000020796  ...................................
ENSSSCP00000012801  ...................................
ENSSSCP00000016666  ...................................
ENSSSCP00000023132  ...................................
ENSSSCP00000019848  ...................................
ENSSSCP00000006241  ...................................
ENSSSCP00000020492  ...................................
ENSSSCP00000008085  ...................................
ENSSSCP00000018239  ...................................
ENSSSCP00000021088  ...................................
ENSSSCP00000003894  ...................................
ENSSSCP00000020352  ...................................
ENSSSCP00000024007  ...................................
ENSSSCP00000012140  ...................................
ENSSSCP00000015856  ...................................
ENSSSCP00000000096  ...................................
ENSSSCP00000022990  ...................................
ENSSSCP00000009188  ...................................
ENSSSCP00000030087  ...................................
ENSSSCP00000012497  ...................................
ENSSSCP00000031041  ...................................
ENSSSCP00000004838  ...................................
ENSSSCP00000025331  ...................................
ENSSSCP00000006405  ...................................
ENSSSCP00000013851  ...................................
ENSSSCP00000005821  ...................................
ENSSSCP00000004541  ...................................
ENSSSCP00000021819  ...................................
ENSSSCP00000018415  ...................................
ENSSSCP00000013851  ...................................
ENSSSCP00000010214  ...................................
ENSSSCP00000011618  ...................................
ENSSSCP00000008984  ...................................
ENSSSCP00000004615  ...................................
ENSSSCP00000030087  ...................................
ENSSSCP00000004918  ...................................
ENSSSCP00000007532  ...................................
ENSSSCP00000004775  ...................................
ENSSSCP00000008985  ...................................
ENSSSCP00000018428  ...................................
ENSSSCP00000004775  ...................................
ENSSSCP00000008158  splaslfi...........................
ENSSSCP00000013851  ...................................
ENSSSCP00000026169  splaslfi...........................
ENSSSCP00000023415  ...................................
ENSSSCP00000027051  ...................................
ENSSSCP00000026077  ...................................
ENSSSCP00000004541  ...................................
ENSSSCP00000027650  ...................................
ENSSSCP00000019848  ...................................
ENSSSCP00000023361  ...................................
ENSSSCP00000026213  ...................................
ENSSSCP00000023132  ...................................
ENSSSCP00000008195  ...................................
ENSSSCP00000006241  ...................................
ENSSSCP00000025417  ...................................
ENSSSCP00000016447  ...................................
ENSSSCP00000021819  ...................................
ENSSSCP00000006241  ...................................
ENSSSCP00000019848  ...................................
ENSSSCP00000021829  ...................................
ENSSSCP00000020853  ...................................
ENSSSCP00000013851  ...................................
ENSSSCP00000016390  ...................................
ENSSSCP00000004039  ...................................
ENSSSCP00000014354  ...................................
ENSSSCP00000020506  ...................................
ENSSSCP00000001881  ...................................
ENSSSCP00000013851  ...................................
ENSSSCP00000016666  ...................................
ENSSSCP00000005883  ...................................
ENSSSCP00000004543  ...................................
ENSSSCP00000003039  ...................................
ENSSSCP00000018415  ...................................
ENSSSCP00000027862  ...................................
ENSSSCP00000004541  ...................................
ENSSSCP00000018099  ...................................
ENSSSCP00000012904  ...................................
ENSSSCP00000030031  ...................................
ENSSSCP00000004614  ...................................
ENSSSCP00000027678  ...................................
ENSSSCP00000017907  ...................................
ENSSSCP00000027979  ...................................
ENSSSCP00000004016  ...................................
ENSSSCP00000003680  ...................................
ENSSSCP00000001127  ...................................
ENSSSCP00000006241  ...................................
ENSSSCP00000001629  ...................................
ENSSSCP00000005988  ...................................
ENSSSCP00000024916  ...................................
ENSSSCP00000021132  ...................................
ENSSSCP00000017907  ...................................
ENSSSCP00000005893  ...................................
ENSSSCP00000029807  ...................................
ENSSSCP00000011596  ...................................
ENSSSCP00000002048  ...................................
ENSSSCP00000001310  ...................................
ENSSSCP00000028578  ...................................
ENSSSCP00000012112  ...................................
ENSSSCP00000018222  ...................................
ENSSSCP00000029355  ...................................
ENSSSCP00000003233  ...................................
ENSSSCP00000023342  ...................................
ENSSSCP00000023857  ...................................
ENSSSCP00000026405  ...................................
ENSSSCP00000023656  ...................................
ENSSSCP00000001565  ...................................
ENSSSCP00000003907  ...................................
ENSSSCP00000012436  grmdsqkvisclqac....................
ENSSSCP00000001558  ...................................
ENSSSCP00000004775  ...................................
ENSSSCP00000010407  ...................................
ENSSSCP00000027979  ...................................
ENSSSCP00000004016  ...................................
ENSSSCP00000026273  ...................................
ENSSSCP00000027979  ...................................
ENSSSCP00000004016  ...................................
ENSSSCP00000015120  ...................................
ENSSSCP00000029926  ...................................
ENSSSCP00000019261  ...................................
ENSSSCP00000027979  ...................................
ENSSSCP00000004016  ...................................
ENSSSCP00000019207  ...................................
ENSSSCP00000025417  ...................................
ENSSSCP00000024968  ...................................
ENSSSCP00000001308  ...................................
ENSSSCP00000004775  ...................................
ENSSSCP00000025895  ...................................
ENSSSCP00000022922  ...................................
ENSSSCP00000002048  ...................................
ENSSSCP00000000712  dplpihhyfhgylagfsvrsgrlesrevieclyac
ENSSSCP00000022455  ...................................
ENSSSCP00000001310  ...................................
ENSSSCP00000028578  ...................................
ENSSSCP00000016392  ...................................
ENSSSCP00000008559  ...................................
ENSSSCP00000021819  ...................................
ENSSSCP00000003203  ...................................
ENSSSCP00000010021  ...................................
ENSSSCP00000010815  ...................................
ENSSSCP00000020574  ...................................
ENSSSCP00000016666  ...................................
ENSSSCP00000022958  ...................................
ENSSSCP00000005978  ...................................
ENSSSCP00000017851  ...................................
ENSSSCP00000021247  ...................................
ENSSSCP00000012777  ...................................
ENSSSCP00000006241  ...................................
ENSSSCP00000028807  ...................................
ENSSSCP00000013885  ...................................
ENSSSCP00000025417  ...................................
ENSSSCP00000004775  ...................................
ENSSSCP00000024968  ...................................
ENSSSCP00000000277  ...................................
ENSSSCP00000027978  ...................................
ENSSSCP00000005978  ...................................
ENSSSCP00000014530  ...................................
ENSSSCP00000023947  ...................................
ENSSSCP00000025895  ...................................
ENSSSCP00000022922  ...................................
ENSSSCP00000005978  ...................................
ENSSSCP00000026588  ...................................
ENSSSCP00000001308  ...................................
ENSSSCP00000000277  ...................................
ENSSSCP00000004471  ...................................
ENSSSCP00000004541  ...................................
ENSSSCP00000020853  ...................................
ENSSSCP00000006241  kdc................................
ENSSSCP00000026906  ...................................
ENSSSCP00000016389  ...................................
ENSSSCP00000006954  ...................................
ENSSSCP00000015012  ...................................
ENSSSCP00000016392  ...................................
ENSSSCP00000027979  ...................................
ENSSSCP00000004016  ...................................
ENSSSCP00000020473  ...................................
ENSSSCP00000008195  ...................................
ENSSSCP00000030974  ...................................
ENSSSCP00000019430  ...................................
ENSSSCP00000022637  ...................................
ENSSSCP00000014907  ...................................
ENSSSCP00000017077  ...................................
ENSSSCP00000010815  ...................................
ENSSSCP00000009337  ...................................
ENSSSCP00000019007  ...................................
ENSSSCP00000024991  ...................................
ENSSSCP00000009843  ...................................
ENSSSCP00000019007  ...................................
ENSSSCP00000023477  ...................................
ENSSSCP00000009452  ...................................
ENSSSCP00000003203  ...................................
ENSSSCP00000003203  ...................................
ENSSSCP00000022093  ...................................
ENSSSCP00000027047  ...................................
ENSSSCP00000006952  ...................................
ENSSSCP00000011072  ...................................
ENSSSCP00000023964  ...................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0044555 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 6312
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma mobile 163K
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus proteolyticus MRP
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Ruminococcus sp.
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Eubacterium eligens ATCC 27750
NoYes   Clostridium difficile 630
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Elusimicrobium minutum Pei191
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Nitrospira defluvii
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Nitratiruptor sp. SB155-2
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax citrulli AAC00-1
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Pusillimonas sp. T7-7
NoYes   Bordetella avium 197N
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Hyphomicrobium sp. MC1
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Saccharophagus degradans 2-40