SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Concanavalin A-like lectins/glucanases alignments in Sus scrofa 76_10.2

These alignments are sequences aligned to the 0052500 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2erfa1               n.............................................................................
ENSSSCP00000029807  tdfrrfqmipldpkgtsqndpnwvvrhqgkelvqtvncdpglavgydefnavdfsgtffinterdddyagfvfgyqss
ENSSSCP00000005158  tdfrrfqmipldpkgtsqndpnwvvrhqgkelvqtvncdpglavgydefnavdfsgtffinterdddyagfvfgyqss
ENSSSCP00000015013  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdfegtfhvnt................
ENSSSCP00000015012  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdfegtfhvnt................
ENSSSCP00000014796  tdfrafqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafng...........................
ENSSSCP00000006952  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdf........................
ENSSSCP00000004335  tdfrnfqmvpldpkgttqidpnwvirhqgkelvqtansdpgiavgfdefgsvdfsgtfyvntdrdddyagfvfgyqss
ENSSSCP00000014907  ykapvptgevyfadsfdrgtlsgwilskakkddtddeiakydgkwevdemketklpgdkglvllsrakhhaistklnk
ENSSSCP00000005280  hrrfeykysfkgphlvqsdgtvpfwayagnaipssdqiriapslksqrgsvwtkakaafenwevevtfrvtgrgriga
ENSSSCP00000024403  wkkatlhavdvtldpdtahphlflyedsksvrledsrqklpekperfdswpcvlgretftsgrhywevevgdrtdwai
ENSSSCP00000001201  wkkatlhavdvtldpdtahphlflyedsksvrledsrqklpekperfdswpcvlgretftsgrhywevevgdrtdwai
ENSSSCP00000029440  wkkatlhavdvtldpdtahphlflyedsksvrledsrqklpekperfdswpcvlgretftsgrhywevevgdrtdwai
ENSSSCP00000001416  rkilkqliadvtldpetahpnlvlsedrksvkfvetrlrdlpdtprrftfypcvlategftsgrhywevevgdkthwa
ENSSSCP00000029869  rkilkqliadvtldpetahpnlvlsedrksvkfvetrlrdlpdtprrftfypcvlategftsgrhywevevgdkthwa
ENSSSCP00000030828  rkilkqliadvtldpetahpnlvlsedrksvkfvetrlrdlpdtprrftfypcvlategftsgrhywevevgdkthwa
ENSSSCP00000026179  ktpqplgevyftetfdsgrlagwvlskakkddtdaeisiydgrweieelkenrvpgdrglvlksrakhhaisailakp
ENSSSCP00000014929  hlkrehslikpyqgvgssstlfwdfqgstiltsqylrltpderskegsiwnhlpcflkdwemhvhfkvhgagkknlhg
ENSSSCP00000029385  lreaqlysvdvtldpdtaypslilsdnlrqvrysylqqdlpdnperfnlfpcvlgspcfiagrhywevevgdkakwti
ENSSSCP00000001288  lreaqlysvdvtldpdtaypslilsdnlrqvrysylqqdlpdnperfnlfpcvlgspcfiagrhywevevgdkakwti
ENSSSCP00000024192  ikpqrgvgtgssslwnlmgnamvmtqyirltpdmqskqgalwnrvpcflrdwelqvhfrihgqgkknlhgdglaiwyt
ENSSSCP00000015699  krmlrsyavhitldpltaspwlvlsenrrqvrlgetrqevpeneerfdtypmvlgaqhfnsgkhywevdvagkeawdl
ENSSSCP00000001200  wrrsllhaadvvldpdtahpelflsedrrrvrrgpsrqsvpdnperfdcqpcvlglesfssgrhywevevenvmvwav
ENSSSCP00000008754  eylkrehslskpyqgvgtgssslwnlmgnamvmtqyirltpdmqskqgalwnrvpcflrdwelqvhfrihgqgkknlh
ENSSSCP00000015688  reilktfaadvrldpdtaysrlivsedrngvrygdtkqklpdnperfyrynivlgsqcissgrhywevevgdrsewgl
ENSSSCP00000029029  wrkeffqavtitldpdtahpslvlsegnrrvtwgeksqdlpenpqrfysfpcvlglqvitsgrcywevevgdsqawdl
ENSSSCP00000014840  mremlrkfqvdikldpatahpsllltadlrsvqdgelwkdvpnnperfdtwpcvlglqnfssgrhywevvvgeraewg
ENSSSCP00000021212  parldqlldmpaaglavqlrhawnpedrslnvfvkdddrltfhrhpvaqstdgirgkvgharglhawqihwparqrgt
ENSSSCP00000014732  atiyfqeefldgerwrnrwvqssndsqfghfrlssgkfyghkekdkg...............................
ENSSSCP00000003582  prirklqvdvtldadtankqliisedlktvhcgllkqkkeacperfsdtlcvlglprftsgrhywevdvessrewdvg
ENSSSCP00000005042  lspltldpktahpnlvlsknrtsvwhgdikqvmpddperfdssvavlgskgftsgkwywevevakktkwtvgvvresi
ENSSSCP00000009237  rkeefeaanvtldeatahpallvsergrrvtwqetcqdlpsstqrfnsipcvlgqlrinsgraywevevgdmqswdlg
ENSSSCP00000006271  wrdaplypanvtldeatahpallvsergrrvtwqetcqdlprstqrfnsipcvlgqlrinsgraywevevgdmqswdl
ENSSSCP00000006272  wrkevfeaanvtldeatahpallmseggrrvtwqetcqdlpnstqrfnsipcvlgqlrinsgraywevevgdmqswdl
ENSSSCP00000009236  rkeefeaanvtldeatahpallvsergrqvtwqetcqdlpsstqrfnsipcvlgqlrinsgrahwevevgdmqswdlg
ENSSSCP00000007533  tnvtldeatahpallvsergrrvtwqetcqdlprstqrfnsipcvlgqlrinsgraywevevgdmqswdlgicrdnvt
ENSSSCP00000014615  tiyfkeqfldgdgwtdrwieskhkpdfgrfvlssgkfygdqekdkglqtsqdarfyalsarfepfsnkgqtlvvqftv
ENSSSCP00000022095  wrsarlhfvavtldpdtahpklilsgdrrcvklgdtrqpvldnpqrfdfvvsilgsehftagchywevsvadkskwal
ENSSSCP00000027530  rkeefkavnvildaatahpalllskngrrvtwkgtgqdlprstqrfnsipyvlghlsicsgkshwevevgnascwdlg
ENSSSCP00000024940  wraaqqyavevtldpgsahpslevsedgkrvssrrmapglaaghhqqfleqtcvlsqqrfsagrhywevhvghrsrwf
ENSSSCP00000002077  qrrfeyklsfkgprlalpgagipfwshhgdailgleevrlapsmrnrsgavwsrtpvlfpawevevqmrvtgpgrlga
ENSSSCP00000023787  qrrfeyklsfkgprlalpgagipfwshhgdailgleevrlapsmrnrsgavwsrtpvlfpawevevqmrvtgpgrlga
ENSSSCP00000004776  sdeylkfweditldpatansflvfsedlrsiqygkiyqnlmedpqrfdywagvlgtpcfvsgchywevevgegnewal
ENSSSCP00000021310  sdeylkfweditldpatansflvfsedlrsiqygkiyqnlmedpqrfdywagvlgtpcfvsgchywevevgegnewal
ENSSSCP00000004184  dgwkkqwveskhrpdygkfqlvqedfygdeekdkglqtsedakfyalstfsnenetlvvqfsvkyeqgidcggryvkl
ENSSSCP00000003925  dihpvpaaltldpgtahqrlilsddctivaygnlhpqplqdspkrfdvevsvlgseafssgvhywevvvaektqwvig
ENSSSCP00000027015  tpqplypdlscpegleellsapppdlgaqrrhgwnpkdcsenievkegglcferrpvaqstdgvrgkrgysrglhawe
ENSSSCP00000008227  rkvlpapeslkldpttahpllelskgntvvqcgllaqrrasqperfdystcvlasrgfscgrhywevvvgsksdwrlg
ENSSSCP00000005767  rslflkyartptlepdtmharlrlsadrltvrcglfgrlgptptlcfdslwqvlgrdcfaagrhywevdvqeagigww
ENSSSCP00000024925  vkvildyntahnkvalsqnftvasaadtsqdyqphpqrftycsqvlglhcykkgihywevelqknnfcgvgvcygsmp
ENSSSCP00000018810  pymnpmvpftgmiqgglqdglqitingtvlmssgsrftvnlqtghrdndiafhfnprfeeggyvvcntkqngiwgpee
ENSSSCP00000014885  evlknfqedvmpdpttaypylllyesrqrrylstpvdgtacgkdrflaypcvvgqetfssgrhywevgmnltgdalwa
ENSSSCP00000028656  tdvqsywvdvtlnphtanlnlvlsknrrqvrfvgaqqsgsrldehygcgvlgsrhfssgkhywevdvakktdwilgvc
ENSSSCP00000030393  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfids.................
ENSSSCP00000030993  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfids.................
ENSSSCP00000012889  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfids.................
ENSSSCP00000029279  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfids.................
ENSSSCP00000030659  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfids.................
ENSSSCP00000005403  hfnstynarikafnktgvsqysktlvlqtsevawfafd........................................
ENSSSCP00000001314  vtldpltaspslvlsedrksvrytrqkqnlpdsplrfeglpvvlgspgfssgrh........................
ENSSSCP00000009454  kiaqkftedvildpetahpnllvsedrksatfmrmrqmvlkagrfrle..............................
ENSSSCP00000001560  wrkeqfkamavtldpntahrnlslsengksftenvppngdtpalqdqgasedilnvlgqecpsagrhywevevkaktd
ENSSSCP00000001564  wrkeqfkamavtldpntahrnlslsengksftenvppngdtpalqdqgasedilnvlgqecpsagrhywevevkaktd
ENSSSCP00000023159  thvqcyweditldpfnlnlnlvlsedqrqvisvpiwpvkcynygvlgsqyfssgkhywevdvskktawvlgvycrars
ENSSSCP00000028586  wrkeqfkamavtldpntahrnlslsengksftenvppngdtpalqdqgasedilnvlgqecpsagrhywevevkaktd
ENSSSCP00000021328  veimnmdmkvgktlkikgkidddadgfvinlgqgtdklalhfnprfgestivcnsrdgns..................
ENSSSCP00000021030  thvqcyweditldpfnlnlnlvlsedqrqvisvpiwpvkcynygvlgsqcfssgkhywevdvskktawvlgvycrars
ENSSSCP00000001553  wrtekfqprpvtldpgsaasslvvthektsvtrkntgvnpgdmdsvlgfedissgrwyweveikdgdgcewalgvcrk
ENSSSCP00000015601  thvqcyweditldpfnlnlnlvlsedqrqvisvpiwpvkcynygvlgsqyfssgkhywevdvskktawvlgvycrars
ENSSSCP00000001716  dntchfedekicgytqdltdnfdwtrqnaltqnpkrspntgpptdisgtpegyymfietsrprelgdrarlvsplyna
ENSSSCP00000019609  ilxlsldlksvrlgqraqdlpshprrfdtntrvlascgfssgrhhwevevgskdgwafgvaresvrrkgltpftpe..
ENSSSCP00000022993  ilxlsldlksvrlgqraqdlpshprrfdtntrvlascgfssgrhhwevevgskdgwafgvaresvrrkgltpftpe..
ENSSSCP00000001312  epahisldpqtshpklllsednqqarfsykwqnspdnpqrfdr...................................
ENSSSCP00000029343  mlerlnnfqvdvtlddkiqnchvaliedmrrlrcrpdhgdtprnpasseytpswgaqtftsgkhywevdvglscnwii
ENSSSCP00000015849  mldmlnnfraenvlsqkmsihsvrlsedeasvvfeddpqgasseppseerfvawgaqaftsgrhywevdvtrssnwil
ENSSSCP00000005434  nvpydlplpggvmprmli............................................................
ENSSSCP00000030635  nvpydlplpggvmprmli............................................................
ENSSSCP00000019990  gyryilaepdphapdpekleldcwagkpipgdlyraclyervllalhdrapqlkisddrltvvgekgysmvrashgvr
ENSSSCP00000021698  hetplprswspkdkynyiglsqgnlrvhykghgknhkdaasvrathpi..............................
ENSSSCP00000025036  avawfafdpgsah.................................................................
ENSSSCP00000018810  pipffasipgglypsksimvsgtilpsaqsfyinlrsgsdiafhlnprfkenavvrntqigsswgp............
ENSSSCP00000015851  mldmlnnfraenvlsqkmsihsvrlsedeasvvfeddpqgasseppseerfvawgaqaftsgrhywevdvtrssnwil
ENSSSCP00000013361  rlktnsqpfkldpkmthkklkisndglqmekdesslkkshtperfsgtgcygaagnifidsgchywevvmgsstwyai
ENSSSCP00000009456  kmittfqeyltldagtahnslfitkdrktatfqrmklncfynpqaftshpavlgsegfnagrhfwqvegrglgewslg
ENSSSCP00000018791  faqwaisptfdlgslscslevsedhrtvtvshypqsypwsperfascqvlgsqgfs......................
ENSSSCP00000010821  iynpiipyvgtiseqlepgtlivlrghvpsdsd.............................................
ENSSSCP00000000129  vasnlnlkpgeclkvrgevapdaksfvlnlgkdsnnlclhfnprfdmhgdintivcnskdggawgaeqr.........
ENSSSCP00000011201  vcqclpgfggpecekllsvnfvdrdtylqftdlqnwpran......................................
ENSSSCP00000015852  nvhevdvtlddkiqnchvaliedmrrlrcrpdhgdtprnpasseytpswgaqtftsgkhywevdvglscnwiiglcke
ENSSSCP00000017851  pcahggscrprkegyecdcplgfeglhcqkaiteaieipqfigrsyltydnpailkrvsgsrsn..............
ENSSSCP00000009455  kmistfqdhltldaetahrslvisqdgktatfqtrgpnrarkskaftshpsvlgsegfdagrhfwqvegrglgewslg
ENSSSCP00000012112  ggfrcqcpaggafegprcevaarsf.....................................................
ENSSSCP00000006826  tdmig.........................................................................
ENSSSCP00000029570  tdmig.........................................................................
ENSSSCP00000018163  qltfplrtn.....................................................................
ENSSSCP00000005380  efhcgfedgniclftqddtdnfdwtkqstatrntkytpntgpnadrsgskegfymyietsrprlegekarllspvfsi
ENSSSCP00000000853  ..............................................................................
ENSSSCP00000009453  kmistfqeyltldaetahgslilsqdgktatfqslepnhvhnpkaftshpavlgsegfdagrh...............
ENSSSCP00000008124  k.............................................................................
ENSSSCP00000025878  istfqeyltldaetahcsliisqdgktatfqglepnsvhkskaftshpavlgsegfnagrhfw...............
ENSSSCP00000026387  gfsmphktlladgirvgtvmrirgvvpdqagrfy............................................
ENSSSCP00000019654  dlhk..........................................................................
ENSSSCP00000024906  tcrchlgrsgrrceegvtvttpsmsg....................................................
ENSSSCP00000015599  tdvrrywvhvtlnnlkiksdvtisvdrrqvryarkfglsstcpngdfedcsvlgyplissgkhywevdvsgkrawilg
ENSSSCP00000024988  mdwlhqfqvyfasdketvtrhvpvfedlqrwlsgpdrpgvdntptrlkyflawgaesftsgqhywevnmagccnwai.
ENSSSCP00000024616  mdwlhqfqvyfasdketvtrhvpvfedlqrwlsgpdrpgvdntptrlkyflawgaesftsgqhywevnmagccnwai.
ENSSSCP00000021918  mdwlhqfqvyfasdketvtrhvpvfedlqrwlsgpdrpgvdntptrlkyflawgaesftsgqhywevnmagccnwai.
ENSSSCP00000009325  icqclpgyqgekceklvsvnfvnkesylqipsakvrpqtn......................................
ENSSSCP00000022455  pcahggscrprkegyecdcplgfeglhcqkecgnyclntiteaieipqfigrsyltydnpailkrvsgsrsn......
ENSSSCP00000010821  qftlpfvarlnspmgpgrtivikgevntnakgfnvdllsgkskdialhlnprlnvkafvrns................
ENSSSCP00000001973  fhlnehtchpwltisedgltvvrserrapasellssdtrftrcvavmgnlipvrgrhywevevdecldytvgvafedv
ENSSSCP00000017851  twggsrchcnlgkggescsediviqypqffghsy............................................
ENSSSCP00000022455  twggsrchcnlgkggescsediviqypqffghsy............................................
ENSSSCP00000013885  pvvpyvttifgglragkmvqlqgvvpldarrfqvdfqcgcslhprpdiaihfnprfh.....................
ENSSSCP00000006160  p.............................................................................
ENSSSCP00000023414  mgwleqfqvyfasdketvtrhvpvfedlqrwlsgpdcpgvdytptrlkyflawgaesftsgqhywevnvagccnwaig
ENSSSCP00000029303  fralmpamqeltfdpstahpslvlsasgrrvecseqkappagedprqfdkavavvthqllsegehywevevgdkprwa
ENSSSCP00000008285  fralmpamqeltfdpstahpslvlsasgrrvecseqkappagedprqfdkavavvthqllsegehywevevgdkprwa
ENSSSCP00000024906  rclcppgfsgprcqqgsvhgiaesdwhlegsggndapgqyg.....................................
ENSSSCP00000005158  s.............................................................................
ENSSSCP00000029039  s.............................................................................
ENSSSCP00000018428  aryirivplawnprgkiglrlgiygcpyk.................................................
ENSSSCP00000006832  kdlrgkv.......................................................................
ENSSSCP00000006161  p.............................................................................
ENSSSCP00000018218  rrklwqnyrnltfdpisanrhlylsqqdqqvkhcrkpqgpdgpdsfelwqvqcaqsfqa...................
ENSSSCP00000018024  tcrcppgfagprceklitvnfvgkdsyvelasakvrpqanis....................................
ENSSSCP00000001598  s.............................................................................
ENSSSCP00000030976  s.............................................................................
ENSSSCP00000011839  tygfncefgwgshktfchwehdshvqlkwsvltsktgpiqdhtag.................................
ENSSSCP00000030667  eelkaaltpvtldaasahpdliisqdlktvtldpvpqsrcaeptdparfhpfrcvlglpglssgcqtweaelegpegg
ENSSSCP00000001317  eelkaaltpvtldaasahpdliisqdlktvtldpvpqsrcaeptdparfhpfrcvlglpglssgcqtweaelegpegg
ENSSSCP00000003232  ytkhvslpvgssvtirgkpavcfsknpemqvdfhteadgdsdiafhfrvsfg..........................
ENSSSCP00000013851  ymdqckdgditycelnarfglraivad...................................................
ENSSSCP00000023132  syeclcpggfsglhcekgli..........................................................
ENSSSCP00000016666  rfirfvplewnpsgkigmrvevygcsyks.................................................
ENSSSCP00000004335  t.............................................................................
ENSSSCP00000019848  yngvdiidlakqqnpqiiimgnvsfscsqpqsvp............................................
ENSSSCP00000010319  cvesvpfsfdpntaagwlsvsddltsvtnhdyrvqvenperfpsapcllgscvlsqgshawevdlgtlpswrvgvvrw
ENSSSCP00000022089  nmlhrltadltldpgtahrrllvsadrrsvrlappgtpvppdgparfdqlpavlgaqgfgagrhcwevetadaasgds
ENSSSCP00000007459  ekytcvcpggkf..................................................................
ENSSSCP00000001326  eelkaaltpvtldaasahpdliisqdlktvtldpvpqsrcaeptdparfhpfrcvlglpglssgcqtweaelegpegg
ENSSSCP00000001327  nmlhrltadltldpgtahrrllvsadrrsvrlappgtpvppdgparfdqlpavlgaqgfgagrhcwevetadaasgds
ENSSSCP00000005851  sfnldfevsgiy..................................................................
ENSSSCP00000010214  cscpgqreeaegrepeqdilpcvpfnvaksvkslylgrm.......................................
ENSSSCP00000025497  h.............................................................................
ENSSSCP00000030716  tygfncefgwgshktfchwehdshvqlkwsvltsktgpiqdhtgdgn...............................
ENSSSCP00000029973  tygfncefgwgshktfchwehdshvqlkwsvltsktgpiqdhtgdgn...............................
ENSSSCP00000004541  srnshiaiafddtkv...............................................................
ENSSSCP00000026569  idlckngdidycelkarfglrniiad....................................................
ENSSSCP00000000431  vsfkleektahsslalfksdtgvkygmvgleptklalnverfrewavvladtaitsgrhywevtvkrsqqfrigvadv
ENSSSCP00000020796  vsfkleektahsslalfksdtgvkygmvgleptklalnverfrewavvladtaitsgrhywevtvkrsqqfrigvadv
ENSSSCP00000012801  incnfedgfcfwiqdlnddneweriqgttfppftgpnfdhtfgnasgfyi............................
ENSSSCP00000016666  yngvniidlakrrkhqiytvgnvtfscsepqivpi...........................................
ENSSSCP00000023132  gaftcscpagrggtfceealplsrpafg..................................................
ENSSSCP00000019848  vyscalgsevvdldgkssll..........................................................
ENSSSCP00000006241  evscnferdtcswhtdhltdahwrrvesqgprfdhttgrgyfmlldpteppaqgpsahlltqpqaptapqeclsfwyh
ENSSSCP00000020492  mdwlnhfkvkisfsnevsnqhirvfddvrslkyrddglyvsldaspskyfaawgtraftsgkqy..............
ENSSSCP00000008085  lqfeafyagglapgwnllvqghsdsgedkfeinflseagdivfhikprfs............................
ENSSSCP00000018239  rktllqcycnlsfdpttaseelflfkethsvlnlgillepfaaggpfpgfkqwpqvlcsrglaagrhyweaevsnswv
ENSSSCP00000021088  rktllqcycnlsfdpttaseelflfkethsvlnlgillepfaaggpfpgfkqwpqvlcsrglaagrhyweaevsnswv
ENSSSCP00000003894  agctfeeasdpavpceysqaqyddfqweqvrihpgtrapadlphgsylmvnasqha......................
ENSSSCP00000020352  ivpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllrnscisgergeeqsaip
ENSSSCP00000024007  ivpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllrnscisgergeeqsaip
ENSSSCP00000012140  ldhtggfeglllvdddllgvighsnfgtirsttcvykgkwvyevlissqglmqigwctincrf...............
ENSSSCP00000015856  cqcppgklge....................................................................
ENSSSCP00000000096  nym...........................................................................
ENSSSCP00000022990  vldhtggfeglllvdddllgvighsnfgtirsttcvykgkwvyevlissqglmqigwstincrfnqeegvgdthnsya
ENSSSCP00000009188  iqivyetlkdqqegkkgkttiktgasvlnkwqmnpydrgsafdpaigsdglccqsrevkewhgcratkgltkgkhyye
ENSSSCP00000030087  kmqcfsltergsffpgtgfalysldyartspdigaetfwe......................................
ENSSSCP00000012497  cetailfpmrskkifas.............................................................
ENSSSCP00000031041  f.............................................................................
ENSSSCP00000004838  p.............................................................................
ENSSSCP00000025331  sgiwprhavkllsvlnqmpq..........................................................
ENSSSCP00000006405  f.............................................................................
ENSSSCP00000013851  lsfrcedvaaldpv................................................................
ENSSSCP00000005821  tsigsrppavrgsrdrftgesytvlgdtaiesgqhywevkaqkdcksysvgvayktlgkfdqlgktntswcihvnnwl
ENSSSCP00000004541  qkgtyf........................................................................
ENSSSCP00000021819  gspqnedas.....................................................................
ENSSSCP00000018415  pcfhggrcverysyytcdceltafdgpycnhdiggffepgtwmrynlqsalrsaare.....................
ENSSSCP00000013851  pcrngglcregwnrfvcdcigtgflgrvcereatvlsydgsmymkimlpnamhteaedvs..................
ENSSSCP00000010214  kmqcfsltergsffpgtgfalysldyartspdigaetfwe......................................
ENSSSCP00000011618  ngqhgfsclcppgy................................................................
ENSSSCP00000008984  ggcfllclsllllgcwaelgnglefpgaegqwtrfpkwnaccese.................................
ENSSSCP00000004615  ..............................................................................
ENSSSCP00000030087  fsgtpvirlrfkrl................................................................
ENSSSCP00000004918  enlpiqevsfdpekaqccivengqilthgsggkgyglastgvtsgcyqwkfyivkenrgnegtcvgvsrwpvhdfnhr
ENSSSCP00000007532  swdlgicrdnvtregvftmspqngfwairlydgdywaltspetslplrerplkvgifldyeagdvs............
ENSSSCP00000004775  svtpcfegpmetgtyfsteggyvvldesfni...............................................
ENSSSCP00000008985  iatfkgseyfcydlsqnp............................................................
ENSSSCP00000018428  niadlavrrhsritfegkv...........................................................
ENSSSCP00000004775  praiah........................................................................
ENSSSCP00000008158  ellkrfqvpvnpaldtahpklvfsqegrymkngaaaagswplttawsylagwrshqktagfverfrhlpcvlgqnvft
ENSSSCP00000013851  fvatfkgneffcydlshnpiqss.......................................................
ENSSSCP00000026169  ellkrfqvpvnpaldtahpklvfsqegrymkngaaaagswplttawsylagwrshqktagfverfrhlpcvlgqnvft
ENSSSCP00000023415  lprqva........................................................................
ENSSSCP00000027051  ..............................................................................
ENSSSCP00000026077  lclglefmglpnqwarylrwdastr.....................................................
ENSSSCP00000004541  segtiq........................................................................
ENSSSCP00000027650  dtlvaidtyncdlhfkvardrssgypltiegfaylwsgarasygvrrgrvcfemkineeisvkhlpstepdphvvrig
ENSSSCP00000019848  cglegncidsqyscncdadrnewtndtgflsykehlpvtkivitdthrphseaayklgpllcrgdrl...........
ENSSSCP00000023361  tdvrrywvhvtlnnlkiksdvtisvdrrqvryarkfglsstcpngdfedcsvlgyplissgkhxawilgvygrklsnc
ENSSSCP00000026213  yngvdiidlakqqnpqiiimgnvsfscsqpqsvp............................................
ENSSSCP00000023132  eaqcecprgrggslcqtaserddamqpflad...............................................
ENSSSCP00000008195  qcdfednahpfcdwvqasqdggywrqgnkntfiqpagpfgislngeghyifletdkfsqagq................
ENSSSCP00000006241  pascdfeaglcgwhhlpwpglggyswdwssgatpsryrqppvdhtlgtekghfalfetgvlgpggraawlrsqplpat
ENSSSCP00000025417  gaftcscpagrggtfceealplsrpafggrsflafptlrafralepeglllyngnargkdflpehllpps........
ENSSSCP00000016447  eaetvsp.......................................................................
ENSSSCP00000021819  cvlepirsvsflr.................................................................
ENSSSCP00000006241  tpfschfeqdfcgwrdistsgyswlreragaapggpgprsdhtlgtdlgwyaavgthrgkeaataalrspvlheaapt
ENSSSCP00000019848  chhggkcrekpsgfscdctssaytgpfcsdeisayfgsgasiiynfqenyslsknsssha..................
ENSSSCP00000021829  dpavptgsfmmvnssgrasgqkahlllptlkendthcidfhyyfssrdrsspga........................
ENSSSCP00000020853  wnsa..........................................................................
ENSSSCP00000013851  gglefgggpgqwaryarwagaassge....................................................
ENSSSCP00000016390  cgiernctdpryycncdadykqwrkdagflsykdhlpvsqvvvgdtdrqgseaklsvgplrcqgdrnyw.........
ENSSSCP00000004039  scdfelenvcgmiqssedsadwqrvsqvpegpesdhsnmgqckgsgffmhfssssvnvgdtavlesrklypkrgfqcl
ENSSSCP00000014354  grdrftaesyt...................................................................
ENSSSCP00000020506  dhcafekanicgmiqgtrddadwvhedsaqpgqvdhtlggqctgagyfmhfdtssgaveeaallesrilypkrkqqcl
ENSSSCP00000001881  dhcafekanicgmiqgtrddadwvhedsaqpgqvdhtlggqctgagyfmhfdtssgaveeaallesrilypkrkqqcl
ENSSSCP00000013851  canqgvclqqwdgftcdctmtsyggpvcndpgtt............................................
ENSSSCP00000016666  chnggkcvekhsgyfcdcttspyegpfckkevsavfeagtsvtyvfqepy............................
ENSSSCP00000005883  e.............................................................................
ENSSSCP00000004543  pqgsymivdssdhdpgekarlqlptmkendthcidfsyllysqkglnpgtlnilvrvnkgplanpiwnv.........
ENSSSCP00000003039  nsiramlnsndvseylkisphglearcdassfesvrctfcvdagvwyyevtvvtsgvmqigwatrdskflnhegygig
ENSSSCP00000018415  rcygdrnswntisfhtgaa...........................................................
ENSSSCP00000027862  srsksppppeeeakdeeedqtlvnldtytsdlhfqvskdryggqplfsekfptlwsgarstygvtkgkvcfeakvtqn
ENSSSCP00000004541  cslenvytvsfpkpgfvelspvpidvgteinlsfstknesgiillgsggtpapprrkrrqt.................
ENSSSCP00000018099  rlerncsc......................................................................
ENSSSCP00000012904  svdcsfdhgvcdwkqdveddfdwnpadrdnavgyymavpalagqkkdigrlklllpdlqpqsn...............
ENSSSCP00000030031  svdcsfdhgvcdwkqdveddfdwnpadrdnavgyymavpalagqkkdigrlklllpdlqpqsn...............
ENSSSCP00000004614  ktcfklg.......................................................................
ENSSSCP00000027678  myieashmvygqkaqllsrplrgvagrhcltffyhmygagtgllnvy...............................
ENSSSCP00000017907  pasfygesyv....................................................................
ENSSSCP00000027979  lrfgdsp.......................................................................
ENSSSCP00000004016  lrfgdsp.......................................................................
ENSSSCP00000003680  gsl...........................................................................
ENSSSCP00000001127  mgiglsaqgvnmnrlpgwdkhsygyhgddghsfcssgtgqpygptfttgdvigccvnlinn.................
ENSSSCP00000006241  pkrcsfedsacgfstggqglwtrqtnatghaawgphadhttetaqghymvvdmspqalprghvasltseahrplaqpa
ENSSSCP00000001629  fdillglgvkkkakkriqlsptkikgy...................................................
ENSSSCP00000005988  alrfgertad....................................................................
ENSSSCP00000024916  alrfgertad....................................................................
ENSSSCP00000021132  hagkllsvlkhmpqkygpdaff........................................................
ENSSSCP00000017907  inffssrsyv....................................................................
ENSSSCP00000005893  spps..........................................................................
ENSSSCP00000029807  t.............................................................................
ENSSSCP00000011596  ddtvvcldtyncdlhfkisrdrlsassltmesfaflwaggrasygvskgkvcfemkvtekipvrhlytkdidihevri
ENSSSCP00000002048  dvalgfsgphslaafpawgtqd........................................................
ENSSSCP00000001310  scmvgvardsvkrkgdlslrpedgvwalrlsssgiwantrpeaelfpaqrprrvg.......................
ENSSSCP00000028578  scmvgvardsvkrkgdlslrpedgvwalrlsssgiwantrpeaelfpaqrprrvg.......................
ENSSSCP00000012112  erwggfscdcpvgfggkdcrltmahphhfrgngtlswdfgndmavsvp..............................
ENSSSCP00000018222  rdyflkfayivdldsdtadkflqlfgtkgvkrvlcpinypesptrfthceqvlgegaldrgtyyweveiiegwvsvgv
ENSSSCP00000029355  rdyflkfayivdldsdtadkflqlfgtkgvkrvlcpinypesptrfthceqvlgegaldrgtyyweveiiegwvsvgv
ENSSSCP00000003233  lrwsvslavgwmvkikadllhpsrkspefkadffvcpeeggniafhfrnavvmssfqeggwreakrasshpfvp....
ENSSSCP00000023342  ptynptlpyykpipgglrvgmsvyiqgvanehmkrgasnpgtgrgpgsslhfsfsssdgdkcwrqtrregrwgaetta
ENSSSCP00000023857  gsl...........................................................................
ENSSSCP00000026405  ycdgkrgfklaqdqksceavpvclplnldknyellylaeqfvgvvlylkf............................
ENSSSCP00000023656  kirnpkgplilrlg................................................................
ENSSSCP00000001565  rdcnlitleqeafssgrhywevdikdtdewtlgiyempmqgegkcndlpkkfrvlekkgpd.................
ENSSSCP00000003907  kirnpkgplilrlg................................................................
ENSSSCP00000012436  ii............................................................................
ENSSSCP00000001558  rdcnlitleqeafssgrhywevdikdtdewtlgiyempmqgegkcndlpkkfrvlekkgpd.................
ENSSSCP00000004775  s.............................................................................
ENSSSCP00000010407  satvdivegkvnkgiylkgekgitllyfgeykpscifnpaq.....................................
ENSSSCP00000027979  kgiyfsqe......................................................................
ENSSSCP00000004016  kgiyfsqe......................................................................
ENSSSCP00000026273  vftgqsseivfrsngn..............................................................
ENSSSCP00000027979  krcsedwklvrsasfsrggqlsftnl....................................................
ENSSSCP00000004016  krcsedwklvrsasfsrggqlsftnl....................................................
ENSSSCP00000015120  ppapvfsflfdekcgynnehlllnlkrdrvesragfnlllaaeriqvgyytsldyiigdvgitkgkhfwafrvepysy
ENSSSCP00000029926  ppapvfsflfdekcgynnehlllnlkrdrvesragfnlllaaeriqvgyytsldyiigdvgitkgkhfwafrvepysy
ENSSSCP00000019261  pp............................................................................
ENSSSCP00000027979  pcrrrkdesdknyfegtgyariptqsnaa.................................................
ENSSSCP00000004016  pcrrrkdesdknyfegtgyariptqsnaa.................................................
ENSSSCP00000019207  mwlyraysgnl...................................................................
ENSSSCP00000025417  gasyeclcpggfsglhcekgeccphraaaggdldalafdgrtyveylnavslfpseltneipapeapesgaphsekal
ENSSSCP00000024968  ddvalgfsgphslaafpawgtqdegile..................................................
ENSSSCP00000001308  clvgvaresvvrrgflsftpeegfwtlqlssagvcictslepfqilsycprq..........................
ENSSSCP00000004775  dslisrra......................................................................
ENSSSCP00000025895  ddvalgfsgphslaafpawgtqdegile..................................................
ENSSSCP00000022922  ddvalgfsgphslaafpawgtqdegile..................................................
ENSSSCP00000002048  chtasffgenhlevplatalpdidl.....................................................
ENSSSCP00000000712  g.............................................................................
ENSSSCP00000022455  iclcplgfrgrhcedaftltipqfreslrsyaatpwpleprhylsf................................
ENSSSCP00000001310  rdleyktvsvtldpqsasgylqlse.....................................................
ENSSSCP00000028578  rdleyktvsvtldpqsasgylqlse.....................................................
ENSSSCP00000016392  gpiyghtsvtt...................................................................
ENSSSCP00000008559  dcrcgeededfdwvwddlnkssatllscdnrkvs............................................
ENSSSCP00000021819  r.............................................................................
ENSSSCP00000003203  syavqsgrwyfefeavttgemrvgwarpelrpdvelgadelayvfnghrgqrwhlgsel...................
ENSSSCP00000010021  mpavqldtqhmgtdvvivkngrricgtggclasaplhqnksyfefkiqstgiwgigvatqkvnlnqiplgrdvhslvm
ENSSSCP00000010815  yavkagrwyfefeavtagdmrvgwsrpgcqpdqelgsderafafdgfkaqr...........................
ENSSSCP00000020574  s.............................................................................
ENSSSCP00000016666  fwnavsf.......................................................................
ENSSSCP00000022958  keevwcvgtngkryqaq.............................................................
ENSSSCP00000005978  cdcprpysgptcadevpaatfglggtlss.................................................
ENSSSCP00000017851  iclcplgfrgrhcedaftltipqfreslrsyaatpwpleprhylsf................................
ENSSSCP00000021247  sgfncnfdfpeepcgwvydhakwlrstwtsssspsdrtfpddrnflrlqsdgrregq.....................
ENSSSCP00000012777  lalvsgntvpfalslvdsateklqdivvsvenveiarikalslcsslqsllemrvsvnslelltqfekrrissedyqg
ENSSSCP00000006241  latdfemglglwnhsegwarnhstgrpqhpawprgdhsrnsaqgsflvstaepsdpailsspe...............
ENSSSCP00000028807  iynpiipyvgtiseqlepg...........................................................
ENSSSCP00000013885  evpcsralprglwpgqviivrglvlpepkdftlrlrdeaahvpv..................................
ENSSSCP00000025417  xdg...........................................................................
ENSSSCP00000004775  qvsmmfdgqsavegppqasmddlktft...................................................
ENSSSCP00000024968  chtasffgenhlevplatalpdid......................................................
ENSSSCP00000000277  dvglaqarhplstrshyfeveivdpgekcyialglarkdypknrhpgwsrgsvayhaddgkifhgsgvgdpfgprcyk
ENSSSCP00000027978  g.............................................................................
ENSSSCP00000005978  hctcpanftgptcaqqlwcpgqpclppatceevpdgfvcvaeatfregppaefsghnassgralsglslafrtrdpea
ENSSSCP00000014530  q.............................................................................
ENSSSCP00000023947  aggqyltvsaakgpagraarlllplghllhsgdlcls.........................................
ENSSSCP00000025895  kasffgenhlevplatalpdidlql.....................................................
ENSSSCP00000022922  kasffgenhlevplatalpdidlql.....................................................
ENSSSCP00000005978  tcrcppgthgplcgqnt.............................................................
ENSSSCP00000026588  tgdhtsgfgyyllantkftsqpgyigrlygpslpgnlqyc......................................
ENSSSCP00000001308  rdleyktmris...................................................................
ENSSSCP00000000277  ilvdgdtlsyhgnsgevgcyvasrpltkdsnyfevsivdsgvrgtiavglvpqyysldhqpgwlpdsvayhaddgkly
ENSSSCP00000004471  vsvaksvs......................................................................
ENSSSCP00000004541  r.............................................................................
ENSSSCP00000020853  crnggrcrekhrgitcdctssaydgpfceneisayfgtgssviynfqehyyhtf........................
ENSSSCP00000006241  cgttdfedpsaggwedasvgrlqwmrvsaqasripgadaagnvaghflslqrawgqlteearvltpllgpsgprce..
ENSSSCP00000026906  rflrfiplewnpkgrigmrievfgcayrsevvdldgks........................................
ENSSSCP00000016389  gaffeegmwlrynfqapgvnakesgsfs..................................................
ENSSSCP00000006954  tsrerlaiskdqravrsvpglplllaaerlltgchlsvdvlgdvavtqgrsywacavkptsylvkvgvglenklqesf
ENSSSCP00000015012  lnpsvlqp......................................................................
ENSSSCP00000016392  ynginitdlarrkklepsnvgnlsfs....................................................
ENSSSCP00000027979  aipmrfngksgve.................................................................
ENSSSCP00000004016  aipmrfngksgve.................................................................
ENSSSCP00000020473  angqp.........................................................................
ENSSSCP00000008195  fsfpggfymlldpknakprqrsallspliqssgclslsfqyt....................................
ENSSSCP00000030974  fhyrlagnkvgklrvfvknsnsalawek..................................................
ENSSSCP00000019430  ksvketa.......................................................................
ENSSSCP00000022637  qgkigvvfnigtvdisikee..........................................................
ENSSSCP00000014907  lepfkmtpfsaiglelws............................................................
ENSSSCP00000017077  yfnlshsmagisvpsiq.............................................................
ENSSSCP00000010815  kwyyelmvdhtepfvtaeath.........................................................
ENSSSCP00000009337  vw............................................................................
ENSSSCP00000019007  erllfhpncgqkaaithegrtalrphatddfnhgvvlssralrdgevfqvridkmvdkwagsieigvtthnpaylqlp
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  sgerf.........................................................................
ENSSSCP00000019007  rlvslsacgrtarrqqpgqefnhglvlsreplrdgrvftvridrkvnswsgsieigvtaldpsvldfpssatglkggs
ENSSSCP00000023477  agatyifg......................................................................
ENSSSCP00000009452  hkmistfqenltldaktah...........................................................
ENSSSCP00000003203  thlrvgwaltegyspypgggegwggngvgddlysygfdglhlwtghvprlvtspgqhllapedv..............
ENSSSCP00000003203  yyysvrvfagqepscvwvgwvtpdyhqhdmnfdltkvravtvtmgdeqgnihsslkcsncymvwggdfvspgqqgris
ENSSSCP00000022093  sshsvl........................................................................
ENSSSCP00000027047  inkpeslfkptngfletkvyfaglp.....................................................
ENSSSCP00000006952  tag...........................................................................
ENSSSCP00000011072  gtgaars.......................................................................
ENSSSCP00000023964  gtgaars.......................................................................


                                                                                                    
                                                                                                    
d2erfa1               ..............................................................................
ENSSSCP00000029807  srfyv.........................................................................
ENSSSCP00000005158  srfyv.........................................................................
ENSSSCP00000015013  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000014796  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000004335  srfyvvmwkqvt..................................................................
ENSSSCP00000014907  pfifdtkplivqyevnfqngiecggayvkllsktpelnldqfh...................................
ENSSSCP00000005280  dglaiwytenqglegpvfgsadmw......................................................
ENSSSCP00000024403  gvcrenvmkkgfdpmtpengfwavelygngywaltplrtplplagppr..............................
ENSSSCP00000001201  gvcrenvmkkgfdpmtpengfwavelygngywaltplrtplplagppr..............................
ENSSSCP00000029440  gvcrenvmkkgfdpmtpengfwavelygngywaltplrtplplagppr..............................
ENSSSCP00000001416  vgvcrdsvsrkgeltplpetgywrvrlwngdkyaatttpftplhikvkpkr...........................
ENSSSCP00000029869  vgvcrdsvsrkgeltplpetgywrvrlwngdkyaatttpftplhikvkpkr...........................
ENSSSCP00000030828  vgvcrdsvsrkgeltplpetgywrvrlwngdkyaatttpftplhikvkpkr...........................
ENSSSCP00000026179  fvfadrplivqyevnfqdgidcggayiklladtdglnlenfydktsytimfgpdkcgedyklhfifrhkhpktgvfee
ENSSSCP00000014929  dgialwytrdrmvpgpvfgskdnfhglaifldtypndetterv...................................
ENSSSCP00000029385  gvcedsvcrkggvtsapqngfwavslwygkeywaltspmtalplrtplqr............................
ENSSSCP00000001288  gvcedsvcrkggvtsapqngfwavslwygkeywaltspmtalplrtplqr............................
ENSSSCP00000024192  kdrmqpgpvfgnmdkfvglgvfvdtypneekqqervfpyisamvnngslsydherdgrptelggctaivrnlhyd...
ENSSSCP00000015699  gvcrdsvkrkghfllnpsngfwtiwlwnkqkyeagtctqtplypqvppsr............................
ENSSSCP00000001200  gvcrnsver.....................................................................
ENSSSCP00000008754  gdglaiwytkdrmqpgpvfgnmdkfvglgvfvdtypneekqqesqrvfpyisamvnngslsydherdgrp........
ENSSSCP00000015688  gvcresvdrkevvylsphygfwvirlrkgseyragtdeypllslpvpprr............................
ENSSSCP00000029029  gicrshvmrkggisikpeggfwairsyndeywal............................................
ENSSSCP00000014840  lgvcqdtvsrkgettpspengvwalwllkggeymvlaspsvpllhlerp.............................
ENSSSCP00000021212  havvgvataraplhsvgytalvgsdaeswgwdlgrsrlyhdgknrpgvaypaflgpeeafalpdsll...........
ENSSSCP00000014732  ..............................................................................
ENSSSCP00000003582  vckesvhrqgmiqlspdrg...........................................................
ENSSSCP00000005042  lrkgscpltpeqgfwllrlrnqtdlkaldlpscs............................................
ENSSSCP00000009237  icrdnvtrkgafimspqngfwairlydgdywaltspetslplrerplkvgifl.........................
ENSSSCP00000006271  gicrdnvtregvftmspqngfwairlydgdywaltspetslplrerplkvgif.........................
ENSSSCP00000006272  gicrdnvtrkgafimspqngfwairlydgdywaltspetslplrerplkvg...........................
ENSSSCP00000009236  icrenvtrkgafimspqngfwairlydgdywaltspetslplrerplkvgifldye......................
ENSSSCP00000007533  regvftmspqngfwairlydgdywaltspetslplrerplkvgifldy..............................
ENSSSCP00000014615  kheqnidcgggyvklfpdgldqtdmhgdseynimfgpdicg.....................................
ENSSSCP00000022095  gvcsesvnrkgkvtaspanghwllrqnrqgeyealtspptsfregaprcvgvf.........................
ENSSSCP00000027530  icrdnvtkkeeftmspqkgfwvirlcdgdywaltssvtlltlkekplkv.............................
ENSSSCP00000024940  lgvclakvqcsgpvllspangywvmglwngceyfvldphrvaltmhvpprcvgifl......................
ENSSSCP00000002077  qgmavwytrgrgqvssvlgaldsgdsigilfdssaedtqkspair.................................
ENSSSCP00000023787  qgmavwytrgrgqvssvlgaldsgdsigilfdssaedtqkspair.................................
ENSSSCP00000004776  gvckmsvnrk....................................................................
ENSSSCP00000021310  gvckmsvnrk....................................................................
ENSSSCP00000004184  fpdtlnqedmhse.................................................................
ENSSSCP00000003925  laheaasrkgsiqiqpsrgfycivmhdgnqysactepwtrl.....................................
ENSSSCP00000027015  iswpreqrgthavvgvatalaplqadhyaallgsnseswgwdigrgklyhqskgpgapryppglqgehlevperllvv
ENSSSCP00000008227  vikgtasrkgklnkspehgvwliglkegrvyeafscprvplpvaghp...............................
ENSSSCP00000005767  vgaaygslrrrgasaaarlgcnrqswclkrydleywaf........................................
ENSSSCP00000024925  rhgpesrlgrnsa.................................................................
ENSSSCP00000018810  rkmqmpfqrghpf.................................................................
ENSSSCP00000014885  lgvcrdnvsrrgrvlkspengfwvvqlckgkryaptmsalipitltepp.............................
ENSSSCP00000028656  sdamaptfsfsqfaagrnvysryqpqsgywviglhrkheyrayedssaslllsmtvpp....................
ENSSSCP00000030393  ..............................................................................
ENSSSCP00000030993  ..............................................................................
ENSSSCP00000012889  ..............................................................................
ENSSSCP00000029279  ..............................................................................
ENSSSCP00000030659  ..............................................................................
ENSSSCP00000005403  ..............................................................................
ENSSSCP00000001314  ..............................................................................
ENSSSCP00000009454  ..............................................................................
ENSSSCP00000001560  dgsgtkwalgvcsktawrkgwfvespekkfwvvmykegkvsvpashkeslslrqlpr.....................
ENSSSCP00000001564  dgsgtkwalgvcsktawrkgwfvespekkfwvvmykegkvsvpashkeslslrqlpr.....................
ENSSSCP00000023159  ctaelalgrgaehqnahaiyrpqcgywviglknafkykafedastcdlnvltlsgavpplrvgvfld...........
ENSSSCP00000028586  dgsgtkwalgvcsktawrkgwfvespekkfwvvmykegkvsvpashkeslslrqlpr.....................
ENSSSCP00000021328  ..............................................................................
ENSSSCP00000021030  ctaelalgrgaehqnahaiyrpqcgywviglknafkykafedastcdlnvltlsgavpplrvgvfldcea........
ENSSSCP00000001553  dvkregwcrespekgfwlvgkfsdkyfvytaqytelslhqvl....................................
ENSSSCP00000015601  ctaelalgrgaehqnahaiyrpqcgywviglknafkykafedastcdlnvltlsgavpplrvgvfld...........
ENSSSCP00000001716  sakfycvsffyhmygkhigslnllv.....................................................
ENSSSCP00000019609  ..............................................................................
ENSSSCP00000022993  ..............................................................................
ENSSSCP00000001312  ..............................................................................
ENSSSCP00000029343  glckeswtsrndml................................................................
ENSSSCP00000015849  gvckdiwtsdtdisvd..............................................................
ENSSSCP00000005434  ..............................................................................
ENSSSCP00000030635  ..............................................................................
ENSSSCP00000019990  kgawyfeitvdemppdtaarlgwsq.....................................................
ENSSSCP00000021698  ..............................................................................
ENSSSCP00000025036  ..............................................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000015851  gvckdiwtsdtdisvd..............................................................
ENSSSCP00000013361  giayksapknewigknasswvfsrcnsnfvvrhnnkemlvdvhpqlkr..............................
ENSSSCP00000009456  vckesfprnvpipptpdngcwkiqvrattsgtgdle..........................................
ENSSSCP00000018791  ..............................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000000129  ..............................................................................
ENSSSCP00000011201  ..............................................................................
ENSSSCP00000015852  swtsrndml.....................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000009455  vckesfprnvpkpptpdngcwqiqvwattpdtgv............................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000006826  ..............................................................................
ENSSSCP00000029570  ..............................................................................
ENSSSCP00000018163  ..............................................................................
ENSSSCP00000005380  apknpygptntaycfsf.............................................................
ENSSSCP00000000853  ..............................................................................
ENSSSCP00000009453  ..............................................................................
ENSSSCP00000008124  ..............................................................................
ENSSSCP00000025878  ..............................................................................
ENSSSCP00000026387  ..............................................................................
ENSSSCP00000019654  ..............................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000015599  vygrklsnclfcfsksnqhpywrykpkygywviwlndkgeyntfees...............................
ENSSSCP00000024988  ..............................................................................
ENSSSCP00000024616  ..............................................................................
ENSSSCP00000021918  ..............................................................................
ENSSSCP00000009325  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000001973  pkqedlganhlswcmrhtfassrhk.....................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000006160  ..............................................................................
ENSSSCP00000023414  lcndswa.......................................................................
ENSSSCP00000029303  lgvigaqagrrgrlhavpsqglwllglregkileahveakepralr................................
ENSSSCP00000008285  lgvigaqagrrgrlhavpsqglwllglregkileahveakepralr................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000029039  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000006832  ..............................................................................
ENSSSCP00000006161  ..............................................................................
ENSSSCP00000018218  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000001598  ..............................................................................
ENSSSCP00000030976  ..............................................................................
ENSSSCP00000011839  ..............................................................................
ENSSSCP00000030667  gclvgvaselvtrrgplmiepltgfwvlrivgfdcqalteggtreelsvrprkv........................
ENSSSCP00000001317  gclvgvaselvtrrgplmiepltgfwvlrivgfdcqalteggtreelsvrprkv........................
ENSSSCP00000003232  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000010319  rqdagsegrshscyhd..............................................................
ENSSSCP00000022089  sgededdgeslyavgaage...........................................................
ENSSSCP00000007459  ..............................................................................
ENSSSCP00000001326  gclvgvaselvtrrgplmiepltgfwvlrivgfdcqalteggtreelsvrprkv........................
ENSSSCP00000001327  sgededdgeslyavgaag............................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000025497  ..............................................................................
ENSSSCP00000030716  ..............................................................................
ENSSSCP00000029973  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000026569  ..............................................................................
ENSSSCP00000000431  dmsrdscigvddrswvf.............................................................
ENSSSCP00000020796  dmsrdscigvddrswvf.............................................................
ENSSSCP00000012801  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000006241  lhgpqigt......................................................................
ENSSSCP00000020492  ..............................................................................
ENSSSCP00000008085  ..............................................................................
ENSSSCP00000018239  clgvtyrrspplsgrprrni..........................................................
ENSSSCP00000021088  clgvtyrrspplsgrprrni..........................................................
ENSSSCP00000003894  ..............................................................................
ENSSSCP00000020352  yfpfipdqpf....................................................................
ENSSSCP00000024007  yfpfipdqpf....................................................................
ENSSSCP00000012140  ..............................................................................
ENSSSCP00000015856  ..............................................................................
ENSSSCP00000000096  ..............................................................................
ENSSSCP00000022990  y.............................................................................
ENSSSCP00000009188  vschdqglcrvgwssmqasldlg.......................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000012497  ..............................................................................
ENSSSCP00000031041  ..............................................................................
ENSSSCP00000004838  ..............................................................................
ENSSSCP00000025331  ..............................................................................
ENSSSCP00000006405  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000005821  qntfaakhn.....................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000008984  ..............................................................................
ENSSSCP00000004615  ..............................................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000004918  ttsdmwlyraysgnl...............................................................
ENSSSCP00000007532  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008985  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008158  lgkyywevenrgdlevavgvcredvmevtedsemspfvgiwaicwssagfrpltrppasptkrep.............
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000026169  lgkyywevenrgdlevavgvcredvmevtedsemspfvgiwaicwssagfrpltrppasptkrep.............
ENSSSCP00000023415  ..............................................................................
ENSSSCP00000027051  ..............................................................................
ENSSSCP00000026077  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000027650  wsldscstqlgeepfsygyggtgkkstnsrfeny............................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000023361  lfcfsksnqhpywrykpkygywviwlndkgeyntfees........................................
ENSSSCP00000026213  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000006241  evsclrfwyhm...................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000016447  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000006241  celrlwyhaasgdvaelrlelth.......................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000021829  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016390  ..............................................................................
ENSSSCP00000004039  qff...........................................................................
ENSSSCP00000014354  ..............................................................................
ENSSSCP00000020506  ..............................................................................
ENSSSCP00000001881  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000005883  ..............................................................................
ENSSSCP00000004543  ..............................................................................
ENSSSCP00000003039  d.............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000027862  lpmke.........................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000018099  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000004614  ..............................................................................
ENSSSCP00000027678  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000003680  ..............................................................................
ENSSSCP00000001127  ..............................................................................
ENSSSCP00000006241  cltfwy........................................................................
ENSSSCP00000001629  ..............................................................................
ENSSSCP00000005988  ..............................................................................
ENSSSCP00000024916  ..............................................................................
ENSSSCP00000021132  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000005893  ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000011596  g.............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000018222  maedfsplepydrgrlgrnahsc.......................................................
ENSSSCP00000029355  maedfsplepydrgrlgrnahsc.......................................................
ENSSSCP00000003233  ..............................................................................
ENSSSCP00000023342  sakalrqawacplriikip...........................................................
ENSSSCP00000023857  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000023656  ..............................................................................
ENSSSCP00000001565  ..............................................................................
ENSSSCP00000003907  ..............................................................................
ENSSSCP00000012436  ..............................................................................
ENSSSCP00000001558  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000010407  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000026273  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000015120  lvkvgvassdklqewlrspr..........................................................
ENSSSCP00000029926  lvkvgvassdklqewlrspr..........................................................
ENSSSCP00000019261  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000019207  ..............................................................................
ENSSSCP00000025417  qsnhfelslrteatqglvlwsg........................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000000712  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000008559  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000010021  rndgalyhnne...................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000020574  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000022958  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000021247  ..............................................................................
ENSSSCP00000012777  qfaildkamegtvatylgglpdvpfsat..................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000028807  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000000277  gd............................................................................
ENSSSCP00000027978  ..............................................................................
ENSSSCP00000005978  gllraedapat...................................................................
ENSSSCP00000014530  ..............................................................................
ENSSSCP00000023947  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000026588  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000000277  ngrakgrqfgskcnsgdrigcgiep.....................................................
ENSSSCP00000004471  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000026906  ..............................................................................
ENSSSCP00000016389  ..............................................................................
ENSSSCP00000006954  qgapdvisprydpdsghdsgaedatveasppfaflti.........................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000020473  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000030974  ..............................................................................
ENSSSCP00000019430  ..............................................................................
ENSSSCP00000022637  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000017077  ..............................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000009337  ..............................................................................
ENSSSCP00000019007  stmtnlrsgtwmmtgngvmhngttildeyghnldrlkagdtvg...................................
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  ..............................................................................
ENSSSCP00000019007  wvvsgcsvlrdgrsvleeygqdldqlgegd................................................
ENSSSCP00000023477  ..............................................................................
ENSSSCP00000009452  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000003203  h.............................................................................
ENSSSCP00000022093  ..............................................................................
ENSSSCP00000027047  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000011072  ..............................................................................
ENSSSCP00000023964  ..............................................................................


                                                       10                20        30               
                                                        |                 |         |               
d2erfa1               .........................-SVFDIFELTG.AA.RK....GSG..RRLVKGPDPSSP.......AFR.IEDA
ENSSSCP00000029807  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005158  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015013  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015012  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014796  .........................-----------.--.--....---..------------.......-VD.FEGT
ENSSSCP00000006952  .........................-----------.--.--....---..------------.......---.-EGT
ENSSSCP00000004335  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014907  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005280  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024403  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001201  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029440  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001416  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029869  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030828  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026179  khakppdvdlkkfftdrkthlytlv-----------.--.--....---..------------.......---.----
ENSSSCP00000014929  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029385  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001288  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024192  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015699  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001200  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008754  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015688  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029029  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014840  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021212  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014732  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003582  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005042  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009237  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006271  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006272  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009236  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000007533  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014615  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022095  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027530  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024940  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000002077  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023787  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004776  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021310  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004184  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003925  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027015  ..................ldmeegt-----------.--.--....---..------------.......---.----
ENSSSCP00000008227  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005767  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024925  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018810  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014885  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000028656  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030393  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030993  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012889  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029279  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030659  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005403  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001314  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009454  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001560  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001564  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023159  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000028586  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021328  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021030  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001553  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015601  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001716  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019609  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022993  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001312  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029343  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015849  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005434  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030635  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019990  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021698  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000025036  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018810  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013361  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009456  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018791  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010821  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000000129  .........................-----------.--.--....---..----E-------.......---.----
ENSSSCP00000011201  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015852  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000017851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009455  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012112  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006826  .........................-----------.--.--....---..-----------K.......AFV.FPKE
ENSSSCP00000029570  .........................-----------.--.--....---..-----------K.......AFV.FPKE
ENSSSCP00000018163  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005380  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000000853  .........................---IDVLTELE.LG.ES....TTG..VRQVPGLHNGTK.......AFL.FQDT
ENSSSCP00000009453  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008124  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000025878  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026387  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019654  .........................-----------.--.--....---..-----------K.......AFV.FPQE
ENSSSCP00000024906  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015599  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024988  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024616  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021918  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009325  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022455  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010821  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001973  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000017851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022455  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013885  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006160  .........................---ADLLKVLD.FH.NL....PDG..ITKTTGFCAARRsskgpdvAYR.VTKD
ENSSSCP00000023414  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029303  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008285  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024906  .........................-----------.--.--....---..------------.......-AY.FYDD
ENSSSCP00000005158  .........................--VFDIFELTG.AA.RK....GSG..RRLVKGPDPSSP.......AFR.IEDA
ENSSSCP00000029039  .........................--PVDVLRALR.FP.SL....PDG..VRRTRGICPADV.......AYR.VSRP
ENSSSCP00000018428  .........................-----------.--.--....---..----------SD.......VLY.FDGD
ENSSSCP00000006832  .........................-----------.--.--....---..------------.......-FI.FPEE
ENSSSCP00000006161  .........................---ADLLKVLD.FH.NL....PDG..ITKTTGFCAARRsskgpdvAYR.VTKD
ENSSSCP00000018218  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018024  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001598  .........................--PVDVLRALR.FP.SL....PDG..VRRTRGICPADV.......AYR.VSRP
ENSSSCP00000030976  .........................--PVDVLRALR.FP.SL....PDG..VRRTRGICPADV.......AYR.VSRP
ENSSSCP00000011839  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030667  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001317  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003232  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023132  .........................-----------.--.--....---..----EKSAGDLD.......ALA.FDGR
ENSSSCP00000016666  .........................-----------.--.--....---..-----------D.......VAD.FDGR
ENSSSCP00000004335  .........................--AFDLFSVSN.IN.RK....TIG..AKQFRGPDPSVP.......AYR.FVRF
ENSSSCP00000019848  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010319  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022089  .........................-----------.--.--....S--..------------.......---.----
ENSSSCP00000007459  .........................-----------.--.--....---..-----GQCPGSS.......SVT.FTGN
ENSSSCP00000001326  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001327  .........................-----------.--.-E....---..------------.......---.----
ENSSSCP00000005851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010214  .........................-----------.--.--....---..------------.......---.FSGT
ENSSSCP00000025497  .........................---LDLTELIG.V-.PL....PSS..VSFVTG-YGGFP.......AYS.FGPG
ENSSSCP00000030716  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029973  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004541  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026569  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000000431  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020796  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012801  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016666  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023132  .........................-----------.--.--....---..------------.......---.--GR
ENSSSCP00000019848  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006241  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020492  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008085  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018239  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021088  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003894  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020352  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024007  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012140  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015856  .........................-----------.--.--....---..-------CSGHT.......SLS.FAGN
ENSSSCP00000000096  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022990  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009188  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030087  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012497  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000031041  .........................----KMMELFG.LV.EKdfssVEG..VSMEPGTFNVYP.......CYH.LHKD
ENSSSCP00000004838  .........................--GFKMLEAYN.LT.EKnfasVQG..VSLESGSFPSYS.......AYR.LQKN
ENSSSCP00000025331  .........................-----------.--.--....---..------RHGPDT.......FFN.FPGC
ENSSSCP00000006405  .........................----KMMELFG.LV.EKdfssVEG..VSMEPGTFNVYP.......CYH.LHKD
ENSSSCP00000013851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005821  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004541  .........................-----------.--.--....---..------------.......---.-DGT
ENSSSCP00000021819  .........................-----------.--.--....---..------------.......-FH.FDGS
ENSSSCP00000018415  .........................-----------.--.--....---..------------.......---.---F
ENSSSCP00000013851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010214  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000011618  .........................-----------.--.--....---..---TGSLCETVT.......TLS.FEGN
ENSSSCP00000008984  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004615  .........................-PGFDLISQFQ.ID.KA....ASRraIQRVVGSTALQV.......AYK.LGKN
ENSSSCP00000030087  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004918  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000007532  .........................-----------.--.--....---..------------.......FYN.MTDG
ENSSSCP00000004775  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008985  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018428  .........................-----------.--.--....---..------------.......AFRcLDPV
ENSSSCP00000004775  .........................-----------.--.--....---..------------.......AYQ.YGGT
ENSSSCP00000008158  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026169  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023415  .........................-----------.--.--....---..--LVHDPD-VGP.......AYE.FDGI
ENSSSCP00000027051  .........................--PVDVLKALD.FH.NS....PEG..ISKTTGFCTNRKnskgsdtAYR.VSKQ
ENSSSCP00000026077  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004541  .........................-----------.--.--....---..------------.......---.FDGE
ENSSSCP00000027650  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019848  .........................-----------.--.--....---..------------.......---.FWNS
ENSSSCP00000023361  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026213  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023132  .........................-----------.--.--....---..------------.......---.FNSF
ENSSSCP00000008195  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006241  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000025417  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016447  .........................-----------.--.--....---..-------QGGLP.......VLY.FSGR
ENSSSCP00000021819  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006241  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019848  .........................-----------.--.--....---..------------.......-AS.FQGD
ENSSSCP00000021829  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020853  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016390  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004039  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014354  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020506  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001881  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013851  .........................-----------.--.--....---..------------.......-YI.FGKG
ENSSSCP00000016666  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005883  .........................--DVDVLQRLG.LS.WTk...AAGgrSPPPPGVIPFQS.......GFI.FTQR
ENSSSCP00000004543  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003039  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018415  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027862  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004541  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018099  .........................-----------.--.--....---..--------N-GT.......AAR.FSGQ
ENSSSCP00000012904  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030031  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004614  .........................-----------.--.--....---..------------.......---.---S
ENSSSCP00000027678  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000017907  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027979  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004016  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003680  .........................-----------.--.NW....TVG..LPTDNGHDSDQ-.......VFE.FNGT
ENSSSCP00000001127  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006241  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001629  .........................-----------.--.--....---..------------.......--E.VTSK
ENSSSCP00000005988  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024916  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021132  .........................-----------.--.--....---..------------.......--N.FPGK
ENSSSCP00000017907  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005893  .........................-----------.--.--....---..-----------R.......ALY.FSGR
ENSSSCP00000029807  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000011596  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000002048  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001310  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000028578  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012112  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000018222  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029355  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003233  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023342  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023857  .........................-----------.--.NW....TVG..LPTDNGHDSDQ-.......VFE.FNGT
ENSSSCP00000026405  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023656  .........................-----------.--.--....---..------------.......---.--AT
ENSSSCP00000001565  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003907  .........................-----------.--.--....---..------------.......---.--AT
ENSSSCP00000012436  .........................----DLLPSPStAT.NW....TAG..LLV----DSSEM.......IFK.FDGR
ENSSSCP00000001558  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004775  .........................-----------.--.--....---..------------.......-YF.FDGS
ENSSSCP00000010407  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027979  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004016  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026273  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027979  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004016  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015120  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000029926  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019261  .........................-----------.--.--....---..----PGVIPFQS.......GFI.FTQR
ENSSSCP00000027979  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004016  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019207  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000025417  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024968  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001308  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004775  .........................-----------.--.--....---..------------.......--Y.FNGQ
ENSSSCP00000025895  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022922  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000002048  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000000712  .........................--EVDLLPMPG.PNaNW....TAG..LSVHYSQDSSL-.......IYW.FNGT
ENSSSCP00000022455  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001310  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000028578  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016392  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008559  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021819  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003203  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010021  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010815  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020574  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016666  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022958  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005978  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000017851  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000021247  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000012777  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006241  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000028807  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000013885  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000025417  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004775  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024968  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000000277  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027978  .........................--EVDLLPMPG.PNaNW....TAG..LY-------SSL.......IYW.FNGT
ENSSSCP00000005978  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014530  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023947  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000025895  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022922  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000005978  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026588  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000001308  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000000277  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004471  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004541  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020853  .........................-----------.--.--....---..------------.......---.-DKN
ENSSSCP00000006241  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000026906  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016389  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006954  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000015012  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000016392  .........................-----------.--.--....---..------------.......--C.VEPY
ENSSSCP00000027979  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000004016  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000020473  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000008195  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000030974  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019430  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022637  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000014907  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000017077  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000010815  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009337  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019007  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000024991  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000009843  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000019007  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023477  .........................-----------.--.--....---..------------.......---.--KS
ENSSSCP00000009452  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003203  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000003203  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000022093  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000027047  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000006952  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000011072  .........................-----------.--.--....---..------------.......---.----
ENSSSCP00000023964  .........................-----------.--.--....---..------------.......---.----


                       40        50              60                    70                       80  
                        |         |               |                     |                        |  
d2erfa1               NLIPPVPDDKFQDLVDA....VRTEK..GFL.LLASLRQ...........MKK...TR.G.......TLL.A...LE.
ENSSSCP00000029807  -----------------....-----..---.-V-----...........---...--.-.......---.-...--.
ENSSSCP00000005158  -----------------....-----..---.-V-----...........---...--.-.......---.-...--.
ENSSSCP00000015013  -----QTDDDYAGFIFG....YQDSS..SFY.VVMW---...........---...--.-.......---.-...--.
ENSSSCP00000015012  -----QTDDDYAGFIFG....YQDSS..SFY.VVMW---...........---...--.-.......---.-...--.
ENSSSCP00000014796  FHVNTVTDDDYAGFIFG....YQDSS..SFY.VVMWKQ-...........---...--.-.......---.-...--.
ENSSSCP00000006952  FHVNTVTDDDYAGFLFS....YQDSG..RFY.VVMW---...........---...--.-.......---.-...--.
ENSSSCP00000004335  -----------------....-----..---.-------...........-Q-...--.-.......---.-...--.
ENSSSCP00000014907  ----DKTPYTIMFGPDK....CGED-..-YK.LHFIFRH...........---...--.-.......---.-...--.
ENSSSCP00000005280  -----------------....-----..---.-------...........--N...--.-.......---.-...--.
ENSSSCP00000024403  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001201  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029440  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001416  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029869  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000030828  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000026179  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014929  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029385  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001288  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024192  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015699  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001200  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008754  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015688  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029029  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014840  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021212  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014732  --------------LQT....TQNSR..FYA.ISARFKP...........FSN...KG.K.......NLI.I...QY.
ENSSSCP00000003582  --FWTVSLRRGQFYSAG....TVPS-..---.-------...........---...--.-.......---.T...VL.
ENSSSCP00000005042  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009237  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006271  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006272  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009236  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000007533  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014615  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000022095  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000027530  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024940  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000002077  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023787  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004776  -------------RPSG....FSSDH..GFW.I------...........---...--.-.......---.-...--.
ENSSSCP00000021310  -------------RPSG....FSSDH..GFW.I------...........---...--.-.......---.-...--.
ENSSSCP00000004184  -----------------....-----..-Y-.-------...........---...--.-.......---.-...--.
ENSSSCP00000003925  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000027015  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008227  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000005767  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024925  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000018810  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014885  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000028656  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000030393  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000030993  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000012889  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029279  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000030659  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000005403  ---------PGSAHSDI....IFSND..NLT.VTC----...........SSY...DD.R.......VVL.G...KT.
ENSSSCP00000001314  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009454  -----------------....-----..---.-------...........---...-P.A.......VLG.S...-V.
ENSSSCP00000001560  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001564  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023159  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000028586  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021328  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021030  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001553  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015601  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001716  -----------------....-----..---.-------...........---...--.-.......---.-...RS.
ENSSSCP00000019609  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000022993  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001312  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029343  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015849  -----------------....---SE..DAF.LLFSMKVndqyt......LST...NS.P.......PLI.Q...YV.
ENSSSCP00000005434  -----------------....-----..--T.ILGTVK-...........---...--.-.......---.-...--.
ENSSSCP00000030635  -----------------....-----..--T.ILGTVK-...........---...--.-.......---.-...--.
ENSSSCP00000019990  --------P--------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021698  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000025036  --------------SDI....IFSND..NLT.VTC----...........SSY...DD.R.......VVL.G...KT.
ENSSSCP00000018810  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015851  -----------------....---SE..DAF.LLFSMKVndqyt......LST...NS.P.......PLI.Q...YV.
ENSSSCP00000013361  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009456  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000018791  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000010821  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000000129  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000011201  -----------------....-----..---.ITLQVS-...........TAE...DN.G.......ILL.Y...NG.
ENSSSCP00000015852  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000017851  -----------------....-----..---.AFMRFK-...........TTA...KD.G.......LLM.W...RG.
ENSSSCP00000009455  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000012112  -------PPSSFVMFRG....LRQR-..-FH.LTLSLSFa..........TVQ...PS.G.......LLF.Y...NG.
ENSSSCP00000006826  SENSYVS-----LTARL....TKPLT..AFT.VCLRVYT...........DLN...RD.Y.......SLF.S...YA.
ENSSSCP00000029570  SENSYVS-----LTARL....TKPLT..AFT.VCLRVYT...........DLN...RD.Y.......SLF.S...YA.
ENSSSCP00000018163  --------YMYAKVKKS....LPEMY..AFT.VCMWLKA...........TAA...PGvG.......TPF.S...YA.
ENSSSCP00000005380  --------------F--....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000000853  PRSIKASTATAEQFFQK....LRNKH..EFT.VLVTLKQ...........THL...NS.G.......VIL.S...IH.
ENSSSCP00000009453  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008124  ----------------T....LPELY..AFT.ICLWLRS...........SAS...PGiG.......TPF.S...YA.
ENSSSCP00000025878  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000026387  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000019654  SDNSYVSLKA-----QL....KKPLK..AFT.VCLHIYSel.........AST...RG.Y.......SVF.S...YA.
ENSSSCP00000024906  -------TGSYLALPAL....TNTHH..ELR.LDVEFKP...........LAP...DG.I.......LVF.S...GG.
ENSSSCP00000015599  -----------------....-----..---.-------...........---...--.-.......---.-...-S.
ENSSSCP00000024988  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024616  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021918  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009325  -----------------....-----..-IT.L----QIa..........TDE...DS.G.......ILL.Y...KG.
ENSSSCP00000022455  -----------------....-----..---.AFMRFK-...........TTA...KD.G.......LLM.W...RG.
ENSSSCP00000010821  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001973  --------------Y--....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000017851  ------------VTFEP....LKNSYq.AFQ.ITLEFRA...........EAE...DG.L.......LLY.C...GE.
ENSSSCP00000022455  ------------VTFEP....LKNSYq.AFQ.ITLEFRA...........EAE...DG.L.......LLY.C...GE.
ENSSSCP00000013885  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006160  A---QLSAPTKQLYPASa...FPED-..-FS.ILTTVKA...........KKG...SQ.A.......FLV.S...IY.
ENSSSCP00000023414  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029303  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008285  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024906  G---FLALPGR-VFSRS....LP-EV..PET.IELEVRT...........STA...SG.L.......LLW.QgveVG.
ENSSSCP00000005158  NLIPPVPDDKFQDLVDA....VRAEK..GFL.LLASLRQ...........MKK...TR.G.......TLL.A...VE.
ENSSSCP00000029039  A---QLSAPTRQLFPGG....FPKD-..-FS.LLTAVRT...........RPG...LQ.A.......PLL.T...LY.
ENSSSCP00000018428  D-------AISYRFPRG....VSRSL..WDV.FAFSFK-...........TEE...KD.G.......LLL.H...AE.
ENSSSCP00000006832  SNTAHVS-----LVPRV....NNPLK..NFT.LCLKAFT...........DLT...RP.Y.......SLF.S...YN.
ENSSSCP00000006161  A---QLSAPTKQLYPASa...FPED-..-FS.ILTTVKA...........KKG...SQ.A.......FLV.S...IY.
ENSSSCP00000018218  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000018024  -----------------....-----..---.--LQVA-...........TDK...DN.G.......ILL.Y...KG.
ENSSSCP00000001598  A---QLSAPTRQLFPGG....FPKD-..-FS.LLTAVRT...........RPG...LQ.A.......PLL.T...LY.
ENSSSCP00000030976  A---QLSAPTRQLFPGG....FPKD-..-FS.LLTAVRT...........RPG...LQ.A.......PLL.T...LY.
ENSSSCP00000011839  -----------------....-----..---.-------...........---...DG.N.......FIY.S...QA.
ENSSSCP00000030667  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001317  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000003232  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000013851  --PVTFKSRSSYLALAT....LQAYA..SMH.LFFQFK-...........TTA...PD.G.......LLL.F...NS.
ENSSSCP00000023132  TYVEYLNAVT---ESEK....ALQS-..-NH.FELSLRT...........EAT...QG.L.......VLW.S...GK.
ENSSSCP00000016666  S-------SLLYRFNQK....LMSTL..KDV.ISLKFK-...........SMQ...GD.G.......VLF.H...GE.
ENSSSCP00000004335  DYIPPVGAEPLGRIAEA....MRRKE..GFF.LTASLKQ...........DRK...SR.G.......TLL.A...LE.
ENSSSCP00000019848  ---VTFLSPRSYLALPG....ASRED..EVS.ATFQFRT...........WNK...AG.L.......LLF.S...EL.
ENSSSCP00000010319  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000022089  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000007459  S---FVKYR-------L....MENEN..KLE.MKLTMRL...........RTY...SS.H.......AVV.M...YA.
ENSSSCP00000001326  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000001327  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000005851  ----------GYVMLDGv...LPSLH..AVT.CTFWMKS...........SDI...NNyG.......TPI.S...YA.
ENSSSCP00000010214  P---VIRLR----FKRL....QPTR-..-LV.AEFDFRT...........FDP...E-.G.......VLF.F...AG.
ENSSSCP00000025497  A---NVGRPARTLIPPT....FFRD-..-FA.ISVTVKP...........SSA...RG.G.......VLF.A...IT.
ENSSSCP00000030716  -----------------....-----..---.-------...........---...--.-.......FIY.S...QA.
ENSSSCP00000029973  -----------------....-----..---.-------...........---...--.-.......FIY.S...QA.
ENSSSCP00000004541  -----------------....-KNR-..-LT.IEFEVR-...........TEA...ES.G.......LLF.Y...MA.
ENSSSCP00000026569  --PVTFKTKSSYLSLAT....LQAYT..SMH.LFFQFKT...........TSA...DG.F.......ILF.N...SG.
ENSSSCP00000000431  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000020796  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000012801  -----------------....-----..---.-S-----...........---...--.-.......---.-...--.
ENSSSCP00000016666  ---TFVNSSSSYLLLPG....TPQLD..GLS.VSFQFR-...........TWN...QD.G.......LLL.S...TM.
ENSSSCP00000023132  S---FLAFPT-------....LRAYH..TLR.LALEFR-...........ALE...PE.G.......LLL.Y...NG.
ENSSSCP00000019848  -----------YRFDQK....SLSPI..KDI.ISLKFK-...........TTQ...SY.G.......VLL.H...WE.
ENSSSCP00000006241  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000020492  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008085  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000018239  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021088  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000003894  -----------------....-----..---.-------...........PGQ...RA.H.......VIF.Q...SL.
ENSSSCP00000020352  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024007  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000012140  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015856  S---YIKYRL----S-E....NSKEE..DFK.LALRLRT...........LQS...NG.I.......IMY.T...RA.
ENSSSCP00000000096  ----------YARVRKA....LPELY..AFT.VCMWLRSrs.........GGT...GQ.G.......TPF.S...YS.
ENSSSCP00000022990  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009188  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000030087  -----------------....-----..-VE.AVARIRP...........AT-...DT.G.......VLL.A...LV.
ENSSSCP00000012497  ------------VHPAT....PMKLE..AFS.ACIWVKA...........TDV...LN.K.......TIL.F...SY.
ENSSSCP00000031041  A---LVSQPTKYLHPEG....LPSDY..TIS.FLFRVLPd..........TPE...EP.F.......ALW.E...IL.
ENSSSCP00000004838  A---FVNQPTAELHPNG....LPPSY..TII.LLFRLLPe..........TPS...DP.F.......AIW.Q...IT.
ENSSSCP00000025331  S-----AAAIALPPIAK....WPYQN..GFT.LNTWFRM...........DPL...NN.InvdkdkpYLY.C...FR.
ENSSSCP00000006405  A---LVSQPTKYLHPEG....LPSDY..TIS.FLFRVLPd..........TPE...EP.F.......ALW.E...IL.
ENSSSCP00000013851  ----TFESPEAFVALPR....WSAKR..TGS.ISLDFRT...........TEP...NG.L.......LLF.S...QG.
ENSSSCP00000005821  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004541  G---------FAKAVDG....FKVGL..DLL.VEFEFR-...........TTR...TT.G.......VLL.G...IS.
ENSSSCP00000021819  G---------YSVVEKT....LRAT-..-VTqIIMLFS-...........TFS...PN.G.......LLL.Y...LA.
ENSSSCP00000018415  SHMLSRPPGYRGPVYNV....TGEEV..SFS.FS-----...........THS...AP.A.......VLL.Y...VS.
ENSSSCP00000013851  -----------------....-----..---.----LRF...........MSQ...RA.Y.......GLM.M...AT.
ENSSSCP00000010214  -----------------....-----..-VE.AVARIRP...........AT-...DT.G.......VLL.A...LV.
ENSSSCP00000011618  GFVWVPSGSV-------....AAKDS..GCD.VALRFQ-...........-TV...QP.T.......ALL.L...FR.
ENSSSCP00000008984  -----------------....-----..---.MSFQLK-...........TRS...AR.G.......LVL.Y...FD.
ENSSSCP00000004615  V---DFRIPTRQLYPSG....LPEE-..-YS.FLTTFRM...........TGStleKN.W.......SIW.Q...IQ.
ENSSSCP00000030087  -----------------....QPTR-..-LV.AEFDFRT...........FDP...E-.G.......VLF.F...AG.
ENSSSCP00000004918  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000007532  SHIFTFPQNT-------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004775  -----------------....---GL..KFE.IAFEVRP...........RSS...SG.I.......F-V.-...-H.
ENSSSCP00000008985  --------------IQS....SS---..-DE.ITLSFKT...........LQR...NG.L.......MLH.T...GK.
ENSSSCP00000018428  PHPINFGGPHNFVQVPG....FPRRG..RLA.VSFRFRT...........WDL...TG.L.......LLF.S...SL.
ENSSSCP00000004775  A----NSRQEFEHLKGD....FGEK-..-SQ.FSIRLK-...........TRS...SH.G.......MIF.Y...VS.
ENSSSCP00000008158  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000013851  -----------------....-----..TDE.ITLAFRT...........LQR...NG.L.......MLH.T...GK.
ENSSSCP00000026169  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023415  S---GVGQAALSLVPRT....FFRD-..-FS.LLMRVRP...........ASA...GA.G.......VLF.A...VT.
ENSSSCP00000027051  A---QLSAPTKQLFSGGt...FPED-..-FS.ILFTVKP...........KKG...IQ.S.......FLL.S...IY.
ENSSSCP00000026077  -----------------....-----..-SD.LSFQFK-...........TNV...ST.G.......LLL.Y...LD.
ENSSSCP00000004541  G-YALVSRPI-----RW....FPNI-..-ST.VMFKFR-...........TFS...SS.A.......LLM.Y...LA.
ENSSSCP00000027650  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000019848  A---SFNTEASYLHFPT....FHGEL..SAD.VSFFFK-...........TTA...SS.G.......VFL.E...NL.
ENSSSCP00000023361  -----------------....-----..---.-------...........---...--.-.......---.-...-S.
ENSSSCP00000026213  ---VTFLSPRSYLALPG....ASRED..EVS.ATFQFRT...........WNK...AG.L.......LLF.S...EL.
ENSSSCP00000023132  S---YLELKGLHTFERD....LGEK-..-ME.LEVVFL-...........ARG...PS.G.......LLL.Y...NG.
ENSSSCP00000008195  ----------------S....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006241  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000025417  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000016447  RERLLLRPEVLADIPR-....----E..AFT.VEAWVKPeg.........GQN...SP.A.......IIA.G...VF.
ENSSSCP00000021819  -------GGYVELPPRS....LSPE-..-SE.LLATFA-...........TKN...SS.G.......IIL.A...AL.
ENSSSCP00000006241  -----------------....-----..---.-------...........-GA...ET.L.......TLW.Q...SS.
ENSSSCP00000019848  -----------------....-VKLS..RET.IKFSFRT...........TRT...-P.S.......LLL.Y...VS.
ENSSSCP00000021829  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000020853  ----SFNTETSYLHFPT....FRGEL..SAD.VSFFFK-...........TTA...SS.G.......VFV.E...NL.
ENSSSCP00000013851  -----------------....-----..---.LSFSLR-...........TNA...TR.A.......LLL.Y...LD.
ENSSSCP00000016390  -NAASFPNPSSYLHFST....FQGET..SAD.ISFYFK-...........TLI...PR.G.......VFL.E...NL.
ENSSSCP00000004039  -----------------....-----..---.-------...........---...--.-.......---.-...LY.
ENSSSCP00000014354  -----------------....-----..---.-------...........---...--.-.......-VL.G...DT.
ENSSSCP00000020506  -----------------....-----..---.-------...........---...--.Q.......FFY.K...MT.
ENSSSCP00000001881  -----------------....-----..---.-------...........---...--.Q.......FFY.K...MT.
ENSSSCP00000013851  GALITYTW---------....PPNDR..PST.RMDRLAVgfs........THQ...RS.A.......VLV.R...VD.
ENSSSCP00000016666  PVTKNLSLSSSAIYVDA....APSRE..NIA.LSFV---...........TAQ...VP.G.......LLL.Y...VN.
ENSSSCP00000005883  A---RLQAPTTAVIPAT....LGPE-..-LA.LVLSLCS...........HRV...NH.A.......FLF.A...VR.
ENSSSCP00000004543  -----------------....-----..---.-------...........---...--.-.......---.-...-T.
ENSSSCP00000003039  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000018415  -----------LRFP-P....IRANH..SLD.VSFYFRT...........SAP...SG.V.......FLE.N...MG.
ENSSSCP00000027862  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004541  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000018099  S---FWR--------YS....LPKA-..-QN.WHIRFRL...........TTL...QS.Q.......AIL.L...FS.
ENSSSCP00000012904  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000030031  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004614  S---LLIRDTIKVFPKG....LPEHF..AMV.AMFRVRRs..........TKK...ER.W.......FLW.Q...VL.
ENSSSCP00000027678  -----------------....-----..---.----LKK...........EGD...--.-.......---.-...--.
ENSSSCP00000017907  -----------ELSITE....VSSE-..-LS.LQLTFQ-...........TSK...PQ.G.......LLF.L...AA.
ENSSSCP00000027979  ------TSHLLFILPQE....LPKP-..-RS.QFAVDVQ...........TTS...SR.G.......LVF.Y...TG.
ENSSSCP00000004016  ------TSHLLFILPQE....LPKP-..-RS.QFAVDVQ...........TTS...SR.G.......LVF.Y...TG.
ENSSSCP00000003680  Q-AVRIPDGVVSVDP--....---KE..PFT.ISVWMRHgpf........GRK...KE.T.......VLC.S...SD.
ENSSSCP00000001127  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006241  -----------------....-----..---.-----H-...........---...--.-.......---.-...--.
ENSSSCP00000001629  ---VDLSESTSNVFPEG....LPPSY..VFV.STQRFKV...........KKM...--.W.......DLW.R...IL.
ENSSSCP00000005988  ---------RAARLRKP....LPALG..ALT.ACAHVQWda.........ASP...DT.A.......ALF.S...LA.
ENSSSCP00000024916  ---------RAARLRKP....LPALG..ALT.ACAHVQWda.........ASP...DT.A.......ALF.S...LA.
ENSSSCP00000021132  S-----AAAIALPPIAK....WPYQN..GFT.FHTWLRM...........DPV...NN.InvdkdkpYLY.C...FR.
ENSSSCP00000017907  ------------AFPEWk...MPGH-..-GL.LEFALQ-...........TET...QQ.A.......LLL.F...QS.
ENSSSCP00000005893  GEQLRLRADL-------....ELPRD..AFT.LQVWLRAeg.........GQR...SP.A.......VIT.G...LY.
ENSSSCP00000029807  -----------------....-----..---.-------...........---...-R.G.......TLL.A...VE.
ENSSSCP00000011596  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000002048  -----------------....-----..EGI.LEFTLTT...........RSR...QA.P.......LAF.Q...AG.
ENSSSCP00000001310  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000028578  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000012112  -----------------....-----..-WY.LGLAFR-...........TRA...TQ.G.......VLM.Q...VQ.
ENSSSCP00000018222  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000029355  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000003233  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023342  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023857  Q-AVRIPDGVVSVDP--....---KE..PFT.ISVWMRHgpf........GRK...KE.T.......VLC.S...SD.
ENSSSCP00000026405  ----------------R....LPEIT..RFS.AEFDFR-...........TYD...SE.G.......VIL.Y...AE.
ENSSSCP00000023656  ----SVTQPTRRVFPRG....LPGEF..ALV.LTLLLKKh..........THQ...KH.V.......VFV.Q...VT.
ENSSSCP00000001565  -----------------....-----..---.-------...........---...YR.A.......LIC.S...NQ.
ENSSSCP00000003907  ----SVTQPTRRVFPRG....LPGEF..ALV.LTLLLKKh..........THQ...KH.V.......VFV.Q...VT.
ENSSSCP00000012436  Q-GAKIPDGV---VPKN....LTDQ-..-FT.ITMWMKHgpspg......VRA...EK.E.......TIL.C...NS.
ENSSSCP00000001558  -----------------....-----..---.-------...........---...YR.A.......LIC.S...NQ.
ENSSSCP00000004775  SYAVVRDITRRGKFGQV....TR---..---.FDIEVRT...........PAD...NG.L.......VLL.M...-V.
ENSSSCP00000010407  ----------------C....SPEG-..-VT.FSFFWKIq..........GEQ...SR.S.......APF.A...YG.
ENSSSCP00000027979  GGHVILANSV------F....LGPE-..-FK.LVFSIRP...........RSL...T-.G.......ILI.H...IG.
ENSSSCP00000004016  GGHVILANSV------F....LGPE-..-FK.LVFSIRP...........RSL...T-.G.......ILI.H...IG.
ENSSSCP00000026273  ----------------I....TRDL-..-TN.ITFGFR-...........TRD...AN.M.......TIL.Q...AE.
ENSSSCP00000027979  --------------D--....WPSPS..HFQ.ASFGFQT...........FQP...SG.I.......LLN.H...QT.
ENSSSCP00000004016  --------------D--....WPSPS..HFQ.ASFGFQT...........FQP...SG.I.......LLN.H...QT.
ENSSSCP00000015120  -----------------....-----..D--.-------...........---...--.-.......---.-...--.
ENSSSCP00000029926  -----------------....-----..D--.-------...........---...--.-.......---.-...--.
ENSSSCP00000019261  A---RLQAPTTAVIPTV....IPATLgpELA.LVLSLCS...........HRV...NH.A.......FLF.A...--.
ENSSSCP00000027979  -----------------....-----..-NP.FFTQIIQ...........TTV...DS.G.......LLF.F...AE.
ENSSSCP00000004016  -----------------....-----..-NP.FFTQIIQ...........TTV...DS.G.......LLF.F...AE.
ENSSSCP00000019207  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000025417  -----------------....-----..---.-----KA...........TER...AD.Y.......IAL.A...IV.
ENSSSCP00000024968  -----------------....-----..---.--FTLT-...........---...--.-.......---.-...--.
ENSSSCP00000001308  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004775  S---FIASVQKISFFDG....-----..-FE.GGFNFR-...........TLQ...PN.G.......LLF.Y...YA.
ENSSSCP00000025895  -----------------....-----..---.--FTLT-...........---...--.-.......---.-...--.
ENSSSCP00000022922  -----------------....-----..---.--FTLT-...........---...--.-.......---.-...--.
ENSSSCP00000002048  -----------------....-----..---.-QLEFS-...........TSQ...PE.A.......LLL.L...AA.
ENSSSCP00000000712  -QAVQVPLGGTAGLGSGpqdsLSDH-..-FT.LSFWMKHgvtpnk.....GKK...EE.E.......TIV.C...NTv
ENSSSCP00000022455  -----------------....-----..-ME.FEMTFRP...........DSE...DG.-.......VLL.Y...SY.
ENSSSCP00000001310  --------D--------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000028578  --------D--------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000016392  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008559  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000021819  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000003203  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000010021  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000010815  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000020574  -----------------....-----..---.LEVKFR-...........TRS...EN.G.......ILI.H...IQ.
ENSSSCP00000016666  ------YTEASYLHFPT....FHAEF..SAD.ISFFFKT...........TAL...SG.-.......VFL.E...NL.
ENSSSCP00000022958  -----------------....-----..---.-------...........-SS...TE.Q.......TLL.S...PS.
ENSSSCP00000005978  ---------ASFLLNQL....PGPN-..-LT.VSFLLR-...........TRE...PA.G.......LLL.Q...FA.
ENSSSCP00000017851  -----------------....-----..-ME.FEMTFRP...........DSE...DG.-.......VLL.Y...SY.
ENSSSCP00000021247  --------Y--------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000012777  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006241  -------------FQAS....APHN-..-CS.LVFYHYL...........HGS...EA.G.......CLQ.V...FL.
ENSSSCP00000028807  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000013885  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000025417  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004775  -----------------....-----..--S.LSLYMKP...........PPV...KQ.PklagtadFIL.Y...LG.
ENSSSCP00000024968  -----------------....-----..---.LQLEFS-...........TSQ...PE.A.......LLL.L...AA.
ENSSSCP00000000277  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000027978  -QAVQVPLGGTAGLGSGpqdsLSDH-..-LS.LSFWMKHgvtpnk.....GKK...EE.E.......TIV.C...NTv
ENSSSCP00000005978  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014530  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023947  -------------FRHK....VTGLH..SGT.LQVFVKK...........ISA...HG.A.......ALW.G...R-.
ENSSSCP00000025895  -----------------....-----..---.---EFS-...........TSQ...PE.A.......LLL.L...AA.
ENSSSCP00000022922  -----------------....-----..---.---EFS-...........TSQ...PE.A.......LLL.L...AA.
ENSSSCP00000005978  TFSVVAGNPVRAVVPAG....----G..PLG.LALRFR-...........TTV...TS.G.......PLA.T...RS.
ENSSSCP00000026588  -----------------....-----..---.--L----...........---...--.-.......---.-...--.
ENSSSCP00000001308  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000000277  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000004471  -----------------....IPELR..AFT.LCFEANKig.........KED...NE.W.......TAF.S...YS.
ENSSSCP00000004541  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000020853  S-------SSFAVLSHE....DLTLT..RET.VTLSFRT...........TAT...P-.S.......LLL.Y...VS.
ENSSSCP00000006241  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000026906  --------SLLYRFDQK....SLSPI..KDI.ISLKFK-...........TTQ...SY.G.......VLL.H...WE.
ENSSSCP00000016389  -----------------....-----..---.-------...........TTK...AP.C.......ILL.Y...VS.
ENSSSCP00000006954  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000015012  ------------ILSDP....TLNE-..-LY.VISTFKL...........QTK...SS.A.......TIF.G...LY.
ENSSSCP00000016392  TVPVFFNATSYLEVPGR....LNQDL..-FS.VSFQFRT...........WNP...NG.L.......LLF.S...HF.
ENSSSCP00000027979  -----------VRLPND....LEDLK..GYT.SLSLFLQrpesaeh....GST...EN.M.......FVM.Y...LG.
ENSSSCP00000004016  -----------VRLPND....LEDLK..GYT.SLSLFLQrpesaeh....GST...EN.M.......FVM.Y...LG.
ENSSSCP00000020473  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000008195  -----------------....-----..---.------Qr..........GQA...SG.A.......TLM.V...YA.
ENSSSCP00000030974  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000019430  -----------------....-----..---.-------...........---...--.-.......-LI.E...LL.
ENSSSCP00000022637  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000014907  ------------MTSDI....FFDN-..-FI.-------...........---...--.-.......---.-...--.
ENSSSCP00000017077  ------------KWPG-....----S..AFS.FNAWFCLdqdqltlgsanKGG...KR.K.......QLY.S...FF.
ENSSSCP00000010815  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009337  -----------------....-----..-FT.VSLWLYLlhy........CKA...NL.C.......GIL.Y...FV.
ENSSSCP00000019007  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000024991  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000009843  -----------------....FPPPS..GLS.YSSWFCIehfs.......SPP...NN.Hpvrll..TIVrR...AS.
ENSSSCP00000019007  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000023477  GGLILYTWPA-NDRPST....RSDRL..AVG.FSTTVK-...........---...-D.G.......ILV.R...ID.
ENSSSCP00000009452  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000003203  ----------V------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000003203  ----------T------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000022093  -----------------....-----..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000027047  -----------------....--R--..---.-------...........---...--.-.......---.-...--.
ENSSSCP00000006952  -----------------....-----..DIY.LLSTFRL...........PPK...QG.G.......VLF.G...LY.
ENSSSCP00000011072  -----------------....FPPPG..GLT.FSCWFLIsrh........SAV...TE.Ghplrfl.TLV.R...HL.
ENSSSCP00000023964  -----------------....FPPPG..GLT.FSCWFLIsrh........SAV...TE.Ghplrfl.TLV.R...HL.


                                                        90                   100                110 
                                                         |                     |                  | 
d2erfa1               RK......D..........HS........G...QVFSVVS.....NG.......KAGTL.DLSLT......VQ..GK.
ENSSSCP00000029807  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000005158  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015013  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015012  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000014796  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000006952  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004335  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000014907  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000005280  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000024403  --......-..........--........-...-R-----.....--.......-----.-----......--..--.
ENSSSCP00000001201  --......-..........--........-...-R-----.....--.......-----.-----......--..--.
ENSSSCP00000029440  --......-..........--........-...-R-----.....--.......-----.-----......--..--.
ENSSSCP00000001416  --......-..........--........-...--VGIFL.....DY.......EAGTL.SFYNV......TD..--.
ENSSSCP00000029869  --......-..........--........-...--VGIFL.....DY.......EAGTL.SFYNV......TD..--.
ENSSSCP00000030828  --......-..........--........-...--VGIFL.....DY.......EAGTL.SFYNV......TD..--.
ENSSSCP00000026179  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000014929  --......-..........--........F...PYISVMV.....NN.......GS--L.SYDHS......KD..GR.
ENSSSCP00000029385  --......-..........--........-...--V----.....--.......-----.-----......--..--.
ENSSSCP00000001288  --......-..........--........-...--V----.....--.......-----.-----......--..--.
ENSSSCP00000024192  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015699  --......-..........--........-...--VGIFL.....DY.......DASTV.SFYNI......SD..HG.
ENSSSCP00000001200  --......-..........--........-...-------.....--.......-K---.-----......--..--.
ENSSSCP00000008754  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015688  --......-..........--........-...--VGVFL.....DY.......EAHDI.SFYNV......TD..NG.
ENSSSCP00000029029  --......-..........--........-...-----T-.....--.......-----.-----......--..--.
ENSSSCP00000014840  --......-..........--........-...HCIGIFL.....DY.......EAGEI.SFYNV......TN..GS.
ENSSSCP00000021212  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000014732  TV......K..........H-........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000003582  RV......N..........PR........L...HRVGIFL.....DL.......NSRSI.SFYHI......SD..G-.
ENSSSCP00000005042  --......-..........--........-...----LKL.....NN.......NLNKV.-----......--..--.
ENSSSCP00000009237  --......-..........--........-...-------.....D-.......-----.-----......--..--.
ENSSSCP00000006271  --......-..........--........-...------L.....--.......-----.-----......--..--.
ENSSSCP00000006272  --......-..........--........-...----I--.....--.......-----.-----......--..--.
ENSSSCP00000009236  --......-..........--........-...-------.....--.......-A---.-----......--..--.
ENSSSCP00000007533  --......-..........--........-...-------.....--.......E----.-----......--..--.
ENSSSCP00000014615  --......-..........--........-...-------.....-P.......GTKKV.HVIFN......YK..GK.
ENSSSCP00000022095  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000027530  --......-..........--........-...---GIFL.....DY.......EAGYV.SFYNM......TD..GS.
ENSSSCP00000024940  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000002077  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000023787  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004776  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000021310  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004184  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000003925  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000027015  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000008227  --......-..........--........-...H------.....--.......-----.-----......--..--.
ENSSSCP00000005767  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000024925  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000018810  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000014885  --......-..........--........-...SHMGIFL.....DF.......EAGEV.SFYNVn.....NG..SH.
ENSSSCP00000028656  --......-..........--........-...RRVGVFL.....DY.......EAGTV.SFYNV......TN..HG.
ENSSSCP00000030393  --......-..........-G........R...HYWEVVI.....SG.......STW--.-----......--..--.
ENSSSCP00000030993  --......-..........-G........R...HYWEVVI.....SG.......STW--.-----......--..--.
ENSSSCP00000012889  --......-..........-G........R...HYWEVVI.....SG.......STW--.-----......--..--.
ENSSSCP00000029279  --......-..........-G........R...HYWEVVI.....SG.......STW--.-----......--..--.
ENSSSCP00000030659  --......-..........-G........R...HYWEVVI.....SG.......STW--.-----......--..--.
ENSSSCP00000005403  GF......S..........KG........V...HYWELTV.....DR.......YDN--.-----......HP..DP.
ENSSSCP00000001314  --......-..........--........R...-------.....--.......-----.-----......--..--.
ENSSSCP00000009454  GF......G..........HG........R...RYWEVRV.....DG.......ATWAV.GVCMD......T-..--.
ENSSSCP00000001560  --......-..........--........-...-RIGVFL.....DW.......DAKQV.SFYNM......ID..GS.
ENSSSCP00000001564  --......-..........--........-...-RIGVFL.....DW.......DAKQV.SFYNM......ID..GS.
ENSSSCP00000023159  --......-..........--........-...-------.....-C.......-----.-----......--..--.
ENSSSCP00000028586  --......-..........--........-...-RIGVFL.....DW.......DAKQV.SFYNM......ID..GS.
ENSSSCP00000021328  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000021030  --......-..........--........-...-------.....--.......--GTV.SFFN-......--..--.
ENSSSCP00000001553  --......-..........--........-...HRVGVFL.....DH.......EEGDV.SFYNM......TD..GS.
ENSSSCP00000015601  --......-..........--........-...-------.....-C.......-----.-----......--..--.
ENSSSCP00000001716  RN......K..........GA........L...DTHAWSL.....SG.......NKGNV.-----......--..--.
ENSSSCP00000019609  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000022993  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000001312  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000029343  --......-..........--........-...------L.....NS.......EDIFL.LLCVK......VD..DN.
ENSSSCP00000015849  QR......P..........LG........-...-RVGVFL.....DY.......DNGTV.SFYDV......CK..GS.
ENSSSCP00000005434  -P......N..........AN........R...LALDFK-.....KG.......NDVAF.HFNPR......FN..ED.
ENSSSCP00000030635  -P......N..........AN........R...LALDFK-.....KG.......NDVAF.HFNPR......FN..ED.
ENSSSCP00000019990  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000021698  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000025036  GF......S..........KG........V...HYWELTV.....DR.......YDN--.-----......HP..DP.
ENSSSCP00000018810  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015851  QR......P..........LG........-...-RVGVFL.....DY.......DNGTV.SFYDV......CK..GS.
ENSSSCP00000013361  --......-..........--........-...--LGVLL.....DY.......DNNM-.-----......--..--.
ENSSSCP00000009456  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000018791  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000010821  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000000129  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000011201  DN......D..........H-........-...--IAVEL.....YQ.......GH--V.RVSYD......PG..SY.
ENSSSCP00000015852  --......-..........--........-...------L.....NS.......EDIFL.LLCVK......VD..DN.
ENSSSCP00000017851  DSpm....R..........PN........S...DFISLGL.....RD.......GA--L.VFSYN......LG..SG.
ENSSSCP00000009455  --......S..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000012112  RL......N..........EK........H...DFLALEL.....VA.......GQ--V.RLTYS......TG..ES.
ENSSSCP00000006826  TK......T..........Q-........-...-YNEILL.....FR.......GKTAV.YSISV......GG..AD.
ENSSSCP00000029570  TK......T..........Q-........-...-YNEILL.....FR.......GKTAV.YSISV......GG..AD.
ENSSSCP00000018163  VP......G..........QA........-...NEL-VLI.....EW.......GNNPM.EIL--......IN..DK.
ENSSSCP00000005380  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000000853  HL......D..........H-........-...RYLELES.....SG.......HRNEV.RLHYR......SG..SH.
ENSSSCP00000009453  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000008124  VP......G..........QA........-...NEI-VLI.....EW.......GNNPI.ELL--......IN..DK.
ENSSSCP00000025878  --......-..........--........-...---Q---.....--.......-----.-----......--..--.
ENSSSCP00000026387  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000019654  TK......K..........QP........-...NEILIFW.....SK.......GRGYI.LGV--......RG..TE.
ENSSSCP00000024906  QS......G..........PV........E...DFVSLAM.....VG.......GH--L.EFRYE......LG..SG.
ENSSSCP00000015599  SS......D..........SG........P...LTLSLGV.....PP.......RRIGV.FL---......--..--.
ENSSSCP00000024988  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000024616  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000021918  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000009325  DK......D..........H-........-...IAVELY-.....-R.......GR--V.RASYD......TG..SH.
ENSSSCP00000022455  DSpm....R..........PN........S...DFISLGL.....RD.......GA--L.VFSYN......LG..SG.
ENSSSCP00000010821  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000001973  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000017851  NE......H..........GR........G...DFMALAI.....IR.......RSLQF.RFN--......CG..TG.
ENSSSCP00000022455  NE......H..........GR........G...DFMALAI.....IR.......RSLQF.RFN--......CG..TG.
ENSSSCP00000013885  --......-..........--........-...-------.....-T.......TKPHV.ICNTL......QG..GH.
ENSSSCP00000006160  NE......-..........QG........I...QQIGLEM.....-G.......RSPVF.LYEDH......TGkpGP.
ENSSSCP00000023414  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000029303  T-......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000008285  T-......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000024906  ES......G..........RG........K...DFISLGL.....QD.......GH--L.VFSYQ......LG..SGe
ENSSSCP00000005158  RK......D..........HS........G...QVFSVVS.....NG.......KAGTL.DLSLT......VQ..GK.
ENSSSCP00000029039  SA......Q..........G-........V...RQLGLEL.....-G.......RPIRF.LYEDQ......TGrpQP.
ENSSSCP00000018428  GA......Q..........GD........-...-YVTLEL.....QG.......AHLVL.HMSLGssp...IQprPG.
ENSSSCP00000006832  TR......S..........TD........-...NELLLFV.....NKv......GEYIL.Y----......VG..GT.
ENSSSCP00000006161  NE......-..........QG........I...QQIGLEM.....-G.......RSPVF.LYEDH......TGkpGP.
ENSSSCP00000018218  --......-..........-G........R...HYWEVRA.....SS.......HSVTL.-----......--..--.
ENSSSCP00000018024  DN......D..........P-........-...--LALEL.....YQ.......GH--V.RLVYDs.....LS..SP.
ENSSSCP00000001598  SA......Q..........G-........V...RQLGLEL.....-G.......RPIRF.LYEDQ......TGrpQP.
ENSSSCP00000030976  SA......Q..........G-........V...RQLGLEL.....-G.......RPIRF.LYEDQ......TGrpQP.
ENSSSCP00000011839  DE......N..........QK........G...KVARLVSpvvysQN.......SAHCM.TFWYH......--..--.
ENSSSCP00000030667  --......-..........--........-...---GVHV.....NH.......EGGEV.VFY--......--..--.
ENSSSCP00000001317  --......-..........--........-...---GVHV.....NH.......EGGEV.VFY--......--..--.
ENSSSCP00000003232  --......-..........--........-...-------.....--.......--LYV.RMNSR......QN..GS.
ENSSSCP00000013851  GN......G..........ND........F...IVIELV-.....--.......-KGYI.HYVFDl.....GN..GP.
ENSSSCP00000023132  AT......E..........R-........A...DYIALAI.....VD.......GH--L.QLTYD......LG..SQ.
ENSSSCP00000016666  GQ......R..........G-........-...DQITLEL.....QK.......GRLAL.HLNLD......DS..KP.
ENSSSCP00000004335  GP......G..........AT........R...RQFEIVS.....NG.......PADTL.DLTYW......VD..GA.
ENSSSCP00000019848  QL......V..........SG........-...-GLLLFL.....ND.......GKLKL.NLY--......RP..GK.
ENSSSCP00000010319  --......-..........--........-...-------.....--.......-----.-----......T-..--.
ENSSSCP00000022089  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000007459  RG......T..........D-........-...-YSILEI.....HS.......GR--L.QYKFD......CG..SG.
ENSSSCP00000001326  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000001327  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000005851  LE......N..........GS........D...NTFLLT-.....DY.......NGWVL.YV---......NG..KE.
ENSSSCP00000010214  GR......Q..........DS........-...TWIVLGL.....RA.......GRLEL.QLRYQ......--..-G.
ENSSSCP00000025497  DA......F..........QK........V...IYLGLRL.....SAved....GRQRV.ILYYT......EP..GS.
ENSSSCP00000030716  DE......N..........QK........G...KVARLVSpvvysQN.......SAHCM.TFWYH......--..--.
ENSSSCP00000029973  DE......N..........QK........G...KVARLVSpvvysQN.......SAHCM.TFWYH......--..--.
ENSSSCP00000004541  RI......N..........HA........-...DFATVQL.....RN.......GLP--.YFSYD......LG..SG.
ENSSSCP00000026569  DG......N..........D-........F...IAVELV-.....--.......-KGYI.HYVFD......LG..NG.
ENSSSCP00000000431  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000020796  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000012801  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000016666  LS......E..........GS........G...-TLLLSL.....EG.......GRLRL.VIQKM......TE..RA.
ENSSSCP00000023132  NA......R..........GK........-...DFLALAL.....LG.......GR--V.QLRFD......TG..SG.
ENSSSCP00000019848  GL......N..........GD........-...-HITLEL.....RR.......GK--L.YFLIN......SG..DA.
ENSSSCP00000006241  --......-..........--........-...-------.....--.......----L.RLAMR......RE..GE.
ENSSSCP00000020492  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000008085  --......-..........--........-...-------.....--.......-----.-----......--..S-.
ENSSSCP00000018239  --......-..........--........-...-------.....--.......----V.YL---......LG..RN.
ENSSSCP00000021088  --......-..........--........-...-------.....--.......----V.YL---......LG..RN.
ENSSSCP00000003894  SE......N..........DT........HcvqFSYFLYS.....RDgh.....SPGTL.GIYVR......VN..GG.
ENSSSCP00000020352  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000024007  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000012140  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015856  N-......-..........--........-...PCIILKI.....VD.......GK--L.WFQLD......CG..SG.
ENSSSCP00000000096  VP......E..........QA........-...NEI-VLL.....EA.......GHDPM.ELL--......IN..DK.
ENSSSCP00000022990  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000009188  --......-..........--........-...-------.....-T.......-----.-----......--..--.
ENSSSCP00000030087  GG......D..........QA........-...VVLSVALvd...YH.......STKKL.KKQLVv.....LA..AE.
ENSSSCP00000012497  GT......K..........RN........P...YEIQLYL.....SY.......QSTVL.V----......VG..GE.
ENSSSCP00000031041  NK......N..........SD........-...PLVGVIL.....DN.......GGKTLtYFNYD......YS..GD.
ENSSSCP00000004838  DR......D..........YK........-...PQVGVIA.....DP.......SSKTL.SFFNKd.....TR..GE.
ENSSSCP00000025331  TS......K..........G-........-...VGYSAHF.....VG.......NC-LI.VTSLK......SK..GK.
ENSSSCP00000006405  NK......N..........SD........-...PLVGVIL.....DN.......GGKTLtYFNYD......YS..GD.
ENSSSCP00000013851  RR......AgagasshstaQR........A...DYFAMEL.....LD.......GY--L.YLLLD......MG..SG.
ENSSSCP00000005821  --......-..........N-........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004541  SQ......K..........MD........G...--MGIEM.....ID.......EK--L.MFHVD......NG..AG.
ENSSSCP00000021819  SN......G..........TK........-...DFLSIEL.....VH.......GR--V.KVTVD......LG..SG.
ENSSSCP00000018415  SF......V..........RD........-...-YMAVLI.....-K.......EDGTL.QLRYQ......LG..TS.
ENSSSCP00000013851  TS......R..........ES........A...DTLRLEL.....DG.......GQMKL.TVNLDclrvgcAP..SK.
ENSSSCP00000010214  GG......D..........QA........-...VVLSVALvd...YH.......STKKL.KKQLVv.....LA..AE.
ENSSSCP00000011618  GD......G..........DT........-...-FLALEL.....LS.......GY--V.HVSVQ......VG..HQ.
ENSSSCP00000008984  DE......G..........F-........C...DFLELILt....RG.......GRLQL.SFSIF......CA..EP.
ENSSSCP00000004615  DS......S..........GK........-...EQVGVKI.....NG.......QTKSV.AFSYKg.....LD..GS.
ENSSSCP00000030087  GR......Q..........DS........-...TWIVLGL.....RA.......GRLEL.QLRYQ......--..-G.
ENSSSCP00000004918  --......-..........--........-...------Y.....HN.......GEQTL.TLSSF......TQ..GD.
ENSSSCP00000007532  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004775  GH......S..........VN........G...EYLNVHM.....KN.......GQVIV.KVNNG......IR..DF.
ENSSSCP00000008985  S-......-..........--........A...DYVNLAL.....KN.......GA--V.SLVIN......LG..SG.
ENSSSCP00000018428  GD......G..........L-........-...GHVELIL.....SE.......GQVNV.SIVQT......GR..KK.
ENSSSCP00000004775  DP......E..........EN........-...DFMTLFL.....AH.......GRLVF.MFN--......VG..HK.
ENSSSCP00000008158  --......-..........-A........L...HGVGIFL.....DQ.......GAGEV.SFYSA......AE..GE.
ENSSSCP00000013851  SA......-..........--........-...DYVNLSL.....KS.......GA--V.WLVIN......LG..SG.
ENSSSCP00000026169  --......-..........-A........L...HGVGIFL.....DQ.......GAGEV.SFYSA......AE..GE.
ENSSSCP00000023415  DA......A..........QA........V...VLVGVKLaaa..RG.......GQQQV.QLLYT......EP..GA.
ENSSSCP00000027051  NE......H..........G-........I...QQVGIEV.....-G.......RSPVF.LYEDH......MG..KP.
ENSSSCP00000026077  DG......G..........V-........C...DFLCLSL.....VD.......GRVRL.RFSMDc.....AE..TE.
ENSSSCP00000004541  TR......D..........LK........-...DFMSVEL.....TD.......GH--I.KVSYD......LG..SG.
ENSSSCP00000027650  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000019848  GI......T..........D-........Y...IRIELRS.....--.......-PAVV.TFSFD......VG..NG.
ENSSSCP00000023361  SS......D..........SG........P...LTLSLGV.....PP.......RRIGV.FLEY-......--..--.
ENSSSCP00000026213  QL......V..........SG........-...-GLLLFL.....ND.......GKLKL.NLY--......RP..GK.
ENSSSCP00000023132  QKt.....D..........GK........G...DFVSLAL.....HN.......RL--L.EFRYD......LG..RG.
ENSSSCP00000008195  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000006241  --......G..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000025417  --......-..........--........-...-------.....--.......-----.--RFD......TG..SG.
ENSSSCP00000016447  DNcshti.S..........DK........G...WALGIRS.....GKdvgr...RDARF.FFSLR......TDrvKK.
ENSSSCP00000021819  GQ......D..........SEkqshqqayE...PFFSIVL.....IE.......GLIEV.HVNAG......-D..GT.
ENSSSCP00000006241  GP......W..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000019848  SF......Y..........KE........-...-YLSVIIa....RN.......GSLQI.RYKLN......RY..QE.
ENSSSCP00000021829  --......-..........--........-...-------.....--.......----L.NVYVK......VN..GG.
ENSSSCP00000020853  GI......T..........D-........F...IRLELRA.....PA.......E---V.TFSFD......VG..NG.
ENSSSCP00000013851  D-......G..........GD........C...DFLELLL.....VD.......GRLRL.RFTLS......CA..EP.
ENSSSCP00000016390  GN......T..........D-........F...IKLEL--.....-K.......SATEV.SFSFDv.....GN..GP.
ENSSSCP00000004039  NS......G..........HE........N...DQLDIYI.....--.......-----.-----......--..--.
ENSSSCP00000014354  LI......N..........GG........E...QYWEVRY.....EP.......DSKAF.GVGVAyrsl..GR..FE.
ENSSSCP00000020506  GS......S..........SD........R...LVVWVRR.....DD.......GTGNV.R----......--..--.
ENSSSCP00000001881  GS......S..........SD........R...LVVWVRR.....DD.......GTGNV.R----......--..--.
ENSSSCP00000013851  SA......S..........GL........G...DYLQLHI.....DQ.......GTVGV.IFNVG......TD..D-.
ENSSSCP00000016666  SS......S..........QD........S...LAV-LIC.....KN.......GS--L.QVRYQl.....SK..EE.
ENSSSCP00000005883  SR......K..........HK........-...LQLGLQF.....LP.......GKTVV.HL---......--..GP.
ENSSSCP00000004543  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000003039  --......-..........--........-...D------.....--.......-----.-----......--..--.
ENSSSCP00000018415  GPhc....Q..........WR........R...PYVRVEL.....NT.......SRDVV.FAFDVg.....NG..DE.
ENSSSCP00000027862  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004541  --......-..........-G........Q...AYYAIFL.....NK.......GRLEV.HLSTG......AR..TM.
ENSSSCP00000018099  NK......T..........--........-...AWLSLKL.....VD.......GEL--.RLEYR......CP..GG.
ENSSSCP00000012904  --......-..........--........-...-------.....--.......--LCL.LFHYRl.....AG..N-.
ENSSSCP00000030031  --......-..........--........-...-------.....--.......--LCL.LFHYRl.....AG..N-.
ENSSSCP00000004614  NQ......Q..........N-........M...PQVSIVI.....DG.......GKKVV.EFMFRa.....AE..GD.
ENSSSCP00000027678  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000017907  GK......S..........D-........Y...FIIELL-.....-A.......GNLRV.RVNL-......GA..GE.
ENSSSCP00000027979  TK......T..........S-........-...-FMALYL.....SK.......GRLVF.AL--G......AE..GK.
ENSSSCP00000004016  TK......T..........S-........-...-FMALYL.....SK.......GRLVF.AL--G......AE..GK.
ENSSSCP00000003680  KT......D..........MN........R...HHYSLYI.....HG.......CRLIF.LLRQDps....EE..KK.
ENSSSCP00000001127  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000006241  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000001629  TM......D..........GR........-...PQIAVTL.....NG.......VDKTL.LFTTTs.....VI..NG.
ENSSSCP00000005988  VPal....A..........NA........L...QLRAFAE.....PG.......GAVHL.ALVVR......GH..HA.
ENSSSCP00000024916  VPal....A..........NA........L...QLRAFAE.....PG.......GAVHL.ALVVR......GH..HA.
ENSSSCP00000021132  TS......K..........G-........-...LGYSAHF.....VG.......GCLII.TSIKS......KG..KG.
ENSSSCP00000017907  GQ......E..........GD........-...-FIALEI.....AK.......G--LL.KAH--......VG..RN.
ENSSSCP00000005893  DKcsyasrD..........R-........G...WVVGIHTvsdq.GN.......RDPRY.FFSLK......TD..RA.
ENSSSCP00000029807  RK......D..........HS........G...QVFSVVS.....NG.......KAGTL.DLSLT......VQ..GK.
ENSSSCP00000011596  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000002048  GR......H..........GD........F...IYVDIFE.....GH.......LRAVV.-----......EK..GQ.
ENSSSCP00000001310  --......-..........--........-...--I----.....--.......-----.-----......--..--.
ENSSSCP00000028578  --......-..........--........-...--I----.....--.......-----.-----......--..--.
ENSSSCP00000012112  AG......P..........HS........T...LLCQL--.....--.......DRGLL.SVTVTk.....GS..GR.
ENSSSCP00000018222  --......-..........--........-...---CLQW.....NG.......RS---.-----......--..--.
ENSSSCP00000029355  --......-..........--........-...---CLQW.....NG.......RS---.-----......--..--.
ENSSSCP00000003233  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000023342  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000023857  KT......D..........MN........R...HHYSLYI.....HG.......CRLIF.LLRQDps....EE..KK.
ENSSSCP00000026405  SS......D..........HS........-...AWFLIAL.....RD.......GKIEI.QFK--......-N..EH.
ENSSSCP00000023656  DG......D..........GT........-...RSISLEV.....NS.......QERSL.ELRARg.....QD..GD.
ENSSSCP00000001565  DI......S..........QE........-...ELVQIEK.....DP.......QKIVI.FLGYE......-D..GD.
ENSSSCP00000003907  DG......D..........GT........-...RSISLEV.....NS.......QERSL.ELRARg.....QD..GD.
ENSSSCP00000012436  DKt.....E..........MN........R...HHYALYV.....HN.......CRLVF.LLRKDfd....QA..DT.
ENSSSCP00000001558  DI......S..........QE........-...ELVQIEK.....DP.......QKIVI.FLGYE......-D..GD.
ENSSSCP00000004775  NG......S..........--........-...MFFSLEM.....RN.......GYLHV.FYDFG......FS..SG.
ENSSSCP00000010407  GQ......V..........IS........-...NLFKVCS.....RG.......GKGSV.ELYTH......DN..SM.
ENSSSCP00000027979  SQ......P..........GE........-...-HLCVYL.....EA.......GKVTA.SVSSE......AG..G-.
ENSSSCP00000004016  SQ......P..........GE........-...-HLCVYL.....EA.......GKVTA.SVSSE......AG..G-.
ENSSSCP00000026273  KE......P..........E-........F...LHVSI--.....--.......RESRL.LFQLQ......SG..NG.
ENSSSCP00000027979  RS......S..........--........-...-SLQVTL.....ED.......GHIEL.S----......TR..DS.
ENSSSCP00000004016  RS......S..........--........-...-SLQVTL.....ED.......GHIEL.S----......TR..DS.
ENSSSCP00000015120  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000029926  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000019261  --......-..........--........-...--LGLQF.....LP.......GKTVV.HL---......--..GP.
ENSSSCP00000027979  NQ......D..........C-........-...-FMSLNI.....EG.......GRL--.MVRYK......VD..SG.
ENSSSCP00000004016  NQ......D..........C-........-...-FMSLNI.....EG.......GRL--.MVRYK......VD..SG.
ENSSSCP00000019207  --......-..........--........-...------Y.....HN.......GEQTL.TLSSF......TQ..GD.
ENSSSCP00000025417  DG......S..........G-........-...-HTGLTL.....GG.......GPQGV.VLWGE......EQ..RA.
ENSSSCP00000024968  TR......S..........RQ........-...APLAFQA.....GG.......RHGDF.IYVDI......FE..GH.
ENSSSCP00000001308  --......-..........--........-...IGVALDY.....DG.......GK--V.AFT--......--..--.
ENSSSCP00000004775  SG......S..........D-........-...-VFSISL.....DN.......GTVTM.DV---......--..KG.
ENSSSCP00000025895  TR......S..........RQ........-...APLAFQA.....GG.......RHGDF.IYVDI......FE..GH.
ENSSSCP00000022922  TR......S..........RQ........-...APLAFQA.....GG.......RHGDF.IYVDI......FE..GH.
ENSSSCP00000002048  GP......V..........DH........-...LLLQLYS.....GR.......LQVRL.IL---......GR..EE.
ENSSSCP00000000712  QN......E..........DG........F...SHYSLTV.....HG.......CRIAF.LYWPL......LE..SA.
ENSSSCP00000022455  DT......G..........SK........-...DFLSITM.....AG.......GHVEF.RFDCG......SG..T-.
ENSSSCP00000001310  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000028578  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000016392  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000008559  --......-..........--........-...-------.....--.......-----.-F---......--..--.
ENSSSCP00000021819  --......-..........--........-...-------.....--.......-RGKV.AFLWD......LG..SG.
ENSSSCP00000003203  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000010021  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000010815  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000020574  ES......S..........N-........-...-YTTVKI.....KN.......GK--V.HFTSDag....IA..GK.
ENSSSCP00000016666  GI......K..........D-........-...-FIRLEI.....SX.......KKKIF.XLVDV......FQ..GP.
ENSSSCP00000022958  EK......P..........R-........-...-RFGVYL.....DY.......EAGRL.GFYN-......--..--.
ENSSSCP00000005978  ND......S..........A-........-...AGLTVFL.....SE.......GQIRA.EV---......LG..SP.
ENSSSCP00000017851  DT......G..........SK........-...DFLSITM.....AG.......GHVEF.RFDCG......SG..TG.
ENSSSCP00000021247  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000012777  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000006241  QAr.....S..........SG........A...PQTPVLL.....RG.......RRGE-.-----......--..--.
ENSSSCP00000028807  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000013885  --......-..........--........-...---TLRA.....SF.......ADRTL.AWVSR......WG..GK.
ENSSSCP00000025417  --......-..........-K........G...DFVSLAL.....HN.......RL--L.EFRYD......LG..KG.
ENSSSCP00000004775  SK......H..........AK........K...EYMGLAI.....KN.......DN--L.VYVYN......LG..TK.
ENSSSCP00000024968  GP......V..........DH........-...LLLQLYS.....GR.......LQVRL.IL---......GR..EE.
ENSSSCP00000000277  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000027978  QN......E..........DG........F...SHYSLTV.....HG.......CRIAF.LYWPL......LE..SA.
ENSSSCP00000005978  --......-..........--........-...--IWLAV.....RN.......GSLAA.--GVR......SG..PS.
ENSSSCP00000014530  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000023947  NG......G..........HG........W...RQTHITL.....RG.......-----.-----......--..--.
ENSSSCP00000025895  GP......V..........DH........-...LLLQLYS.....GR.......LQVRL.IL---......GR..EE.
ENSSSCP00000022922  GP......V..........DH........-...LLLQLYS.....GR.......LQVRL.IL---......GR..EE.
ENSSSCP00000005978  DT......Q..........DS........-...LELALV-.....-G.......AM--L.QATLRs.....RG..NN.
ENSSSCP00000026588  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000001308  --......-..........--........-...-------.....--.......-----.-LNSQ......TA..NG.
ENSSSCP00000000277  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000004471  DA......S..........FS........-...QLLSF--.....-G.......KTKSG.YFLYI......SG..SK.
ENSSSCP00000004541  --......-..........--........-...-------.....--.......-KGKV.SFLWD......VG..SG.
ENSSSCP00000020853  SF......H..........E-........-...EYLSVIL.....AP.......NEVLL.-----......--..--.
ENSSSCP00000006241  --......-..........--........-...-------.....--.......----L.-----......--..--.
ENSSSCP00000026906  GL......N..........GD........H...ITLEL--.....RR.......GK---.-----......--..--.
ENSSSCP00000016389  SL......T..........TD........-...-FLAVLV.....KP.......-TGSL.QIRYN......LG..GT.
ENSSSCP00000006954  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000015012  SS......A..........DN........S...KYFEFTV.....MG.......RLNKA.ILRYLk.....ND..GK.
ENSSSCP00000016392  AD......N..........LG........N...VEIDLT-.....--.......-----.-----......--..--.
ENSSSCP00000027979  NK......D..........AS........R...DYIGMAV.....VD.......GQ--L.MCVYN......--..--.
ENSSSCP00000004016  NK......D..........AS........R...DYIGMAV.....VD.......GQ--L.MCVYN......--..--.
ENSSSCP00000020473  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000008195  SV......L..........GS........I...R------.....--.......-----.-----......--..--.
ENSSSCP00000030974  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000019430  FA......D..........MN........R...HHYSLCI.....--.......----F.LLRQDps....EE..KK.
ENSSSCP00000022637  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000014907  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000017077  TG......S..........G-........-...-------.....-MgfeafitHSGTL.VVAVC......TK..RE.
ENSSSCP00000010815  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000009337  DS......N..........EM........Y...GTPSVFLt....EE.......GHLHI.QMHLV......KG..DD.
ENSSSCP00000019007  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000024991  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000009843  SS......E..........QH........Y...VCLAVVL.....SA.......KDRSL.IVSTK......--..EE.
ENSSSCP00000019007  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000023477  SA......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000009452  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000003203  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000003203  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000022093  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000027047  --......-..........--........-...-------.....--.......-----.-----......--..--.
ENSSSCP00000006952  SR......Q..........DN........T...RWLEASV.....VG.......KINKV.LVRYQr.....ED..GK.
ENSSSCP00000011072  SRt.....E..........QP........F...VCFSVSL.....CP.......EDLSL.VVSTE......EK..EF.
ENSSSCP00000023964  SRt.....E..........QP........F...VCFSVSL.....CP.......EDLSL.VVSTE......EK..EF.


                                                       120           130                            
                                                         |             |                            
d2erfa1               Q..HV.VSVE...EA....................L....LATGQWKSITLF.....V...Q.....E..........
ENSSSCP00000029807  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005158  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000015013  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000015012  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000014796  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006952  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004335  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000014907  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005280  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000024403  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001201  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029440  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001416  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029869  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030828  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000026179  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000014929  W..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029385  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001288  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000024192  -..--.----...--....................-....----T-------.....-...-.....-..........
ENSSSCP00000015699  S..LI.YSF-...--....................-....------------.....-...-.....-..........
ENSSSCP00000001200  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000008754  -..T-.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000015688  A..HI.FTFP...HY....................-....------------.....-...-.....-..........
ENSSSCP00000029029  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000014840  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000021212  -..--.----...--....................-....--------VVLD.....M...D.....E..........
ENSSSCP00000014732  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003582  S..HI.FTF-...--....................-....------------.....-...-.....-..........
ENSSSCP00000005042  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009237  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006271  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006272  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009236  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000007533  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000014615  N..-V.LINK...DI....................R....CKDDEFTHL---.....-...-.....-..........
ENSSSCP00000022095  -..--.----...--....................-....----------LD.....Y...E.....A..........
ENSSSCP00000027530  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000024940  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000002077  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000023787  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004776  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000021310  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004184  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003925  -..--.----...--....................-....---------N--.....-...-.....-..........
ENSSSCP00000027015  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000008227  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005767  -..--.----...--....................-....-H----------.....-...-.....-..........
ENSSSCP00000024925  -..-S.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000018810  -..--.----...--....................-....-------ELSFL.....V...Q.....S..........
ENSSSCP00000014885  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000028656  F..PI.YTFS...KY....................-....------------.....-...-.....-..........
ENSSSCP00000030393  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030993  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000012889  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029279  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030659  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005403  A..FG.VARI...DV....................-....-M----KDVMLG.....K...D.....D..........
ENSSSCP00000001314  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009454  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001560  -..HI.HSFT...GI....................P....------------.....-...-.....-..........
ENSSSCP00000001564  -..HI.HSFT...GI....................P....------------.....-...-.....-..........
ENSSSCP00000023159  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000028586  -..HI.HSFT...GI....................P....------------.....-...-.....-..........
ENSSSCP00000021328  -..--.----...--....................-....-----W------.....-...-.....-..........
ENSSSCP00000021030  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001553  -..HI.FSFT...GV....................-....------------.....-...-.....-..........
ENSSSCP00000015601  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001716  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000019609  -..--.----...--....................-....------------.....-...-.....E..........
ENSSSCP00000022993  -..--.----...--....................-....------------.....-...-.....E..........
ENSSSCP00000001312  -..--.----...-A....................-....------------.....-...-.....-..........
ENSSSCP00000029343  F..HL.FS--...--....................-....------------.....-...-.....-..........
ENSSSCP00000015849  L..IY.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005434  N..RR.VIVC...NS....................K....L-DNNW------.....-...-.....-..........
ENSSSCP00000030635  N..RR.VIVC...NS....................K....L-DNNW------.....-...-.....-..........
ENSSSCP00000019990  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000021698  -..--.----...--....................P....------------.....-...-.....-..........
ENSSSCP00000025036  A..FG.VARI...DV....................-....-M----KDVMLG.....K...D.....D..........
ENSSSCP00000018810  -..--.E---...--....................-....------------.....-...-.....-..........
ENSSSCP00000015851  L..IY.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000013361  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009456  -..--.----...--....................-....------------.....-...N.....-..........
ENSSSCP00000018791  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000010821  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000000129  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000011201  P..SS.AIYS...AE....................T....INDGQFHTVELV.....T...F.....D..........
ENSSSCP00000015852  F..HL.FS--...--....................-....------------.....-...-.....-..........
ENSSSCP00000017851  V..AS.ILV-...NG....................S....FNDGRWHRVKAV.....R...D.....G..........
ENSSSCP00000009455  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000012112  N..TV.VSPTv..PG....................G....LSDGQWHTVHLR.....Y...Y.....Nkprtdalgga
ENSSSCP00000006826  -..VI.FKPH...QS....................-....---SEPMHFCMT.....W...Est...S..........
ENSSSCP00000029570  -..VI.FKPH...QS....................-....---SEPMHFCMT.....W...Est...S..........
ENSSSCP00000018163  V..AK.L---...PF....................V....INDGKWHHICIT.....W...Ttr...D..........
ENSSSCP00000005380  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000000853  H..PH.TEVF...PY....................I....LADDKWHKLSLA.....I...S.....A..........
ENSSSCP00000009453  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000008124  V..AQ.L---...PL....................F....VSDGKWHHICVT.....W...Ttr...D..........
ENSSSCP00000025878  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000026387  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000019654  V..LF.KSPE...NT....................-....---AAPTHICAS.....W...Esa...S..........
ENSSSCP00000024906  L..AI.LRS-...SE....................P....LALGRWHHVSAE.....R...F.....N..........
ENSSSCP00000015599  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000024988  -..--.----...--....................G....------------.....-...-.....-..........
ENSSSCP00000024616  -..--.----...--....................G....------------.....-...-.....-..........
ENSSSCP00000021918  -..--.----...--....................G....------------.....-...-.....-..........
ENSSSCP00000009325  P..AS.AIYS...VE....................T....INDGNFHIVELL.....A...L.....D..........
ENSSSCP00000022455  V..AS.ILV-...NG....................S....FNDGRWHRVKAV.....R...D.....G..........
ENSSSCP00000010821  -..--.----...--....................-....F-----------.....-...-.....-..........
ENSSSCP00000001973  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000017851  V..AI.ITS-...ET....................K....IKLGAWHTVTLY.....R...D.....G..........
ENSSSCP00000022455  V..AI.ITS-...ET....................K....IKLGAWHTVTLY.....R...D.....G..........
ENSSSCP00000013885  W..QA.E---...--....................-....---ARWPHLALQ.....R...G.....A..........
ENSSSCP00000006160  E..DY.PLFR...GI....................N....LSDGKWHRVALS.....V...H.....K..........
ENSSSCP00000023414  -..--.----...--....................-....-------K----.....-...-.....-..........
ENSSSCP00000029303  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000008285  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000024906  A..RL.VS--...ED....................P....INDGEWHRVTAL.....R...E.....G..........
ENSSSCP00000005158  Q..QV.VSVE...EA....................L....LATGQWKSITLF.....V...Q.....E..........
ENSSSCP00000029039  P..AQ.PVFR...GL....................S....LADGKWHRVAVA.....V...K.....G..........
ENSSSCP00000018428  H..TT.VSA-...GG....................V....LNDQHWHYVRVD.....R...F.....G..........
ENSSSCP00000006832  G..VT.F---...KV....................P....PSPDTPAHLCAS.....W...Esa...S..........
ENSSSCP00000006161  E..DY.PLFR...GI....................N....LSDGKWHRVALS.....V...H.....K..........
ENSSSCP00000018218  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000018024  P..TT.VY--...SVe...................T....VNDGQFHSVELV.....M...L.....N..........
ENSSSCP00000001598  P..AQ.PVFR...GL....................S....LADGKWHRVAVA.....V...K.....G..........
ENSSSCP00000030976  P..AQ.PVFR...GL....................S....LADGKWHRVAVA.....V...K.....G..........
ENSSSCP00000011839  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030667  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001317  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003232  W..NCeVKSS...DM....................P....FADGQPFELHIL.....V...L.....Q..........
ENSSSCP00000013851  S..LM.KGNS...DK....................P....VNDNQWHNVVVS.....R...Dp....G..........
ENSSSCP00000023132  P..VV.LR-S...TV....................A....VNTNRWLRVRAH.....R...D.....Q..........
ENSSSCP00000016666  R..LS.SSPP...SA....................TlgslLDDQHWHSVLLE.....R...V.....G..........
ENSSSCP00000004335  Q..HV.ISLE...DV....................G....LADAQWKNVTVQ.....V...T.....G..........
ENSSSCP00000019848  L..PS.DITA...GV....................G....LNDGQWHSVSLF.....A...K.....R..........
ENSSSCP00000010319  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000022089  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000007459  P..GI.VSVQ...SI....................Q....VNDGLWHAVSLE.....V...N.....G..........
ENSSSCP00000001326  -..--.----...--....................-....-------RIHVN.....H...E.....G..........
ENSSSCP00000001327  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005851  K..IT.----...DC....................Pa...VNDGNWHHIAIT.....W...Tsv...D..........
ENSSSCP00000010214  V..GR.VTSS...GP....................V....INHGVWQTISVE.....E...L.....E..........
ENSSSCP00000025497  Q..VS.HEAAsf.PV....................P....VMTHRWNRFAVV.....V...Q.....G..........
ENSSSCP00000030716  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029973  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004541  D..TN.TMI-...PT....................K....INDGQWHKIKIM.....R...I.....K..........
ENSSSCP00000026569  P..NV.IKGNs..DR....................P....LNDNQWHNVVIT.....R...Dn....S..........
ENSSSCP00000000431  -..--.----...--....................T....YAQRKWH-----.....-...-.....-..........
ENSSSCP00000020796  -..--.----...--....................T....YAQRKWH-----.....-...-.....-..........
ENSSSCP00000012801  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000016666  A..EI.LT--...GR....................N....LNDGLWHLLSIN.....A...R.....R..........
ENSSSCP00000023132  P..AV.LTS-...SV....................P....VQPGRWHRLELS.....R...H.....W..........
ENSSSCP00000019848  K..LA.SSHA...PTsltlg...............Sl...LDDQHWHSVLIQ.....R...L.....G..........
ENSSSCP00000006241  A..DT.HLWL...RS....................G....THGNRWH-----.....-...-.....-..........
ENSSSCP00000020492  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000008085  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000018239  P..YS.WCLE...WD....................S....LKFSVWHNN---.....-...-.....-..........
ENSSSCP00000021088  P..YS.WCLE...WD....................S....LKFSVWHNN---.....-...-.....-..........
ENSSSCP00000003894  P..LG.SAVW...NM....................Tg...SHGRQWHQAELA.....V...S.....-..........
ENSSSCP00000020352  -..--.----...--....................-....-------RVEIL.....C...E.....H..........
ENSSSCP00000024007  -..--.----...--....................-....-------RVEIL.....C...E.....H..........
ENSSSCP00000012140  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000015856  P..GI.LGIS...GR....................A....VNDGSWHSVFLE.....L...N.....R..........
ENSSSCP00000000096  V..AQ.LPL-...--....................-....LKDSGWHHICIA.....Wit.R.....D..........
ENSSSCP00000022990  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009188  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030087  S..VT.LALM...EI....................K....VCDGQEHVVTVS.....V...N.....K..........
ENSSSCP00000012497  E..NR.LVA-...NT....................V....ISPGTWTHLCST.....W...Nse...Q..........
ENSSSCP00000031041  F..QT.VTFE...GPeir.................K....IFYGSFHKLHII.....V...S.....K..........
ENSSSCP00000004838  V..QT.VTFD...TDevk.................T....LFYGSFHKVHIV.....V...T.....S..........
ENSSSCP00000025331  G..FQ.HCV-...KY....................D....FQPRKWYMISIVhiynrW...R.....N..........
ENSSSCP00000006405  F..QT.VTFE...GPeir.................K....IFYGSFHKLHII.....V...S.....K..........
ENSSSCP00000013851  G..IK.LRAS...SR....................K....VNDGEWCHVDFQ.....R...D.....G..........
ENSSSCP00000005821  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004541  W..FT.AVYDt..GI....................Pgh..LCDGKWHKVVAK.....K...I.....K..........
ENSSSCP00000021819  P..LA.LIT-...DR....................R....YNNGTWYKIAFQ.....R...N.....K..........
ENSSSCP00000018415  P..YV.YQLT...TR....................P....VTDGQPHSVNIT.....R...V.....Y..........
ENSSSCP00000013851  G..PE.TLFA...GH....................K....LNDNEWHTVRVV.....R...R.....G..........
ENSSSCP00000010214  S..VT.LALM...EI....................K....VCDGQEHVVTVS.....V...N.....K..........
ENSSSCP00000011618  P..KV.VLFI...AQ....................N....ASDGEWHSVEVT.....F...A.....E..........
ENSSSCP00000008984  A..TL.LA--...DT....................P....VNDGAWHSVRIR.....R...Q.....F..........
ENSSSCP00000004615  L..QT.AAFS...NL....................Ps...LFDSQWHKIMIG.....V...E.....R..........
ENSSSCP00000030087  V..GR.VTSS...GP....................V....INHGVWQTISVE.....E...L.....E..........
ENSSSCP00000004918  F..IT.C---...--....................-....------------.....-...-.....-..........
ENSSSCP00000007532  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004775  S..TS.VAP-...KQ....................S....LCDGRWHRITVI.....R...D.....S..........
ENSSSCP00000008985  A..FE.ALVE...PV....................Ngk..FNDNAWHDVKVT.....R...Nlr...Q..........
ENSSSCP00000018428  L..QF.AA--...GY....................R....LNDGFWHEVNFV.....A...Q.....E..........
ENSSSCP00000004775  K..LK.I-RS...QE....................K....YNDGLWHDVIFI.....R...E.....K..........
ENSSSCP00000008158  H..LH.TFSC...P-....................-....------------.....-...-.....-..........
ENSSSCP00000013851  A..FE.ALVE...PV....................Ngk..FNDNAWHDVRVT.....R...Nl....R..........
ENSSSCP00000026169  H..LH.TFSC...P-....................-....------------.....-...-.....-..........
ENSSSCP00000023415  T..RT.RTAA...SFtl..................P....ALHGRWTHLALS.....V...D.....G..........
ENSSSCP00000027051  ApeDY.PLFR...TV....................N....IADGKWHRVAIS.....V...E.....K..........
ENSSSCP00000026077  -..--.-VLS...HK....................Q....VNDSSWHFLMVS.....R...D.....R..........
ENSSSCP00000004541  M..AS.VVS-...NQ....................N....HNDGKWKSFTLS.....RiqkQ.....A..........
ENSSSCP00000027650  -..--.----...--....................G....------------.....-...-.....-..........
ENSSSCP00000019848  P..SE.ISVQs..PT....................H....FNDNQWHHVRVE.....R...N.....I..........
ENSSSCP00000023361  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000026213  L..PS.DITA...GV....................G....LNDGQWHSVSLF.....A...K.....R..........
ENSSSCP00000023132  R..RS.SG-S...KE....................P....VALGVWTRVSLE.....R...N.....G..........
ENSSSCP00000008195  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006241  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000025417  P..AV.LTS-...SV....................P....VQPGRWHRLELS.....R...H.....W..........
ENSSSCP00000016447  -..AT.VVMG...HS....................R....YQPGKWTHVAVT.....Y...D.....G..........
ENSSSCP00000021819  S..LK.RALP...-Raptg................T....YSDGQEHSISLI.....R...S.....G..........
ENSSSCP00000006241  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000019848  P..DV.VNFD...FK....................N....MADGQLHHIKIN.....R...E.....E..........
ENSSSCP00000021829  P..QG.NPVW...NV....................Sg...VVTEGWV-----.....-...-.....-..........
ENSSSCP00000020853  P..CE.VTVPs..PT....................P....FNDNRWHHVKAE.....R...N.....I..........
ENSSSCP00000013851  A..TL.QL--...DT....................P....VADDRWHMVLLT.....R...D.....A..........
ENSSSCP00000016390  V..EI.VVRS...PS....................P....LNDDQWHRVTAE.....R...N.....V..........
ENSSSCP00000004039  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000014354  Q..LG.KTAA...SW....................C....LHVNNWLQVSFT.....A...-.....-..........
ENSSSCP00000020506  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001881  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000013851  I..TI.DEP-...NA....................I....VSDGKYHVVRFT.....R...S.....G..........
ENSSSCP00000016666  I..HV.FTID...TE....................N....FANRRLHHLKIN.....R...E.....G..........
ENSSSCP00000005883  R..RS.VAF-...DL....................D....VHDGRWHHLALE.....L...R.....G..........
ENSSSCP00000004543  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003039  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000018415  N..LT.VHSD...DF....................E....FNDDEWHLVRAE.....I...N.....V..........
ENSSSCP00000027862  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004541  R..KI.VVKP...EP....................Sl...FHDGREHSVHVE.....R...T.....R..........
ENSSSCP00000018099  F..DG.NLSS...RV....................H....VNDQEWHSVLVE.....V...T.....D..........
ENSSSCP00000012904  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030031  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004614  V..LN.FIFK...NRelr.................S....LFDRQWHKLGIG.....I...Q.....S..........
ENSSSCP00000027678  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000017907  Q..VL.LSEQ...RL....................R....MDDLVWHFVELF.....C...V.....K..........
ENSSSCP00000027979  K..LK.L-KS...KE....................R....CNDGKWHTVVFG.....H...D.....G..........
ENSSSCP00000004016  K..LK.L-KS...KE....................R....CNDGKWHTVVFG.....H...D.....G..........
ENSSSCP00000003680  Y..KP.AEFH...WKlh..................Q....VCDEEWHHYVLN.....V...D.....I..........
ENSSSCP00000001127  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006241  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001629  S..QV.VTFA...DPrvk.................T....LYDEGWHQIRLL.....V...T.....E..........
ENSSSCP00000005988  P..FR.AAF-...--....................-....RADGHWHHVCAT.....W...Eql...G..........
ENSSSCP00000024916  P..FR.AAF-...--....................-....RADGHWHHVCAT.....W...Eql...G..........
ENSSSCP00000021132  F..QH.CV--...KF....................D....FKPQKWYMVTIVhiynrW...K.....N..........
ENSSSCP00000017907  K..NN.TELS...SF....................Sl...VSDNQWHVIQFK.....F...T.....E..........
ENSSSCP00000005893  R..QV.TTINa..HR....................S....YLPGQWVYLAAT.....Y...D.....G..........
ENSSSCP00000029807  Q..QV.VSVE...EA....................L....LATGQWKSITLF.....V...Q.....E..........
ENSSSCP00000011596  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000002048  G..TV.LLHN...SV....................P....VADGQPHEVSIH.....V...D.....A..........
ENSSSCP00000001310  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000028578  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000012112  A..AH.LLLD...EV....................T....VSDGRWHDLRLE.....L...Q.....Eepggrr....
ENSSSCP00000018222  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029355  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003233  -..--.----...--....................-....---G--------.....-...-.....-..........
ENSSSCP00000023342  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000023857  Y..KP.AEFH...WKlh..................Q....VCDEEWHHYVLN.....V...D.....I..........
ENSSSCP00000026405  T..TK.ITTG...GR....................V....INDGLWNMVCFT.....-...-.....-..........
ENSSSCP00000023656  F..VS.CIFL...VP....................Q....LFDLRWHKLVLS.....V...A.....E..........
ENSSSCP00000001565  I..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003907  F..VS.CIFL...VP....................Q....LFDLRWHKLVLS.....V...A.....E..........
ENSSSCP00000012436  F..RP.AEFH...WKld..................Q....ICDKEWHYYVIN.....V...E.....F..........
ENSSSCP00000001558  I..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004775  PvhLE.DTMK...KA....................Q....INDAKYHEISII.....Y...Hn....D..........
ENSSSCP00000010407  T..WE.ATFS...PP....................G....---PYWTHVLFT.....W...Kf....K..........
ENSSSCP00000027979  I..LT.SVTP...KQ....................S....LCDGQWHSVAVT.....I...K.....Q..........
ENSSSCP00000004016  I..LT.SVTP...KQ....................S....LCDGQWHSVAVT.....I...K.....Q..........
ENSSSCP00000026273  V..HM.LSLA...SL....................Qp...VNDGLWHHVTLS.....M...T.....Dpraqa.....
ENSSSCP00000027979  S..GP.ILTS...PQ....................T....YMDGLLHYVSVI.....S...D.....N..........
ENSSSCP00000004016  S..GP.ILTS...PQ....................T....YMDGLLHYVSVI.....S...D.....N..........
ENSSSCP00000015120  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000029926  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000019261  R..RS.VAF-...DL....................D....VHDGRWHHLALE.....L...R.....G..........
ENSSSCP00000027979  P..PK.EKEI...GA....................I....VNDGKDHLISVR.....I...Srl...Q..........
ENSSSCP00000004016  P..PK.EKEI...GA....................I....VNDGKDHLISVR.....I...Srl...Q..........
ENSSSCP00000019207  F..IT.CV--...--....................-....------------.....-...-.....-..........
ENSSSCP00000025417  T..LM.ASRH...PS....................P....------------.....R...D.....Q..........
ENSSSCP00000024968  L..RA.VVXLlhnSV....................P....VADGQPHEVSIH.....V...D.....A..........
ENSSSCP00000001308  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004775  I..KV.QSA-...DK....................Q....YNDGLSHFIITS.....V...S.....P..........
ENSSSCP00000025895  L..RA.VVXLlhnSV....................P....VADGQPHEVSIH.....V...D.....A..........
ENSSSCP00000022922  L..RA.VVXLlhnSV....................P....VADGQPHEVSIH.....V...D.....A..........
ENSSSCP00000002048  V..RL.QTLA...EM....................L....LSDSVPHTVGLT.....V...S.....D..........
ENSSSCP00000000712  R..PV.KFLW...KL....................Eq...VCDDEWHHYALN.....L...E.....F..........
ENSSSCP00000022455  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001310  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000028578  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000016392  -..--.----...GS....................L....LDDHHWHSVVIE.....R...Q.....G..........
ENSSSCP00000008559  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000021819  S..AR.VEFP...DF....................P....IDDSRWHSIYVT.....R...F.....G..........
ENSSSCP00000003203  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000010021  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000010815  -..--.----...--....................-....-----W------.....-...-.....-..........
ENSSSCP00000020574  V..ER.NIP-...EV....................Y....VADGHWHTFLIG.....K...N.....G..........
ENSSSCP00000016666  P..LY.LVGS...PL....................Slm..FKDTNWGTVRR-.....-...E.....N..........
ENSSSCP00000022958  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000005978  A..LL.L---...PG....................R....WDDGLRHLVMLS.....F...G.....P..........
ENSSSCP00000017851  V..LS.DT--...--....................-....------------.....-...-.....-..........
ENSSSCP00000021247  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000012777  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006241  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000028807  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000013885  K..LI.PA--...PF....................L....FYPQRFFEVLLL.....C...Q.....E..........
ENSSSCP00000025417  A..AV.IRS-...KE....................P....VALGVWTRVSLE.....R...N.....G..........
ENSSSCP00000004775  D..VE.IP--...--....................-....------------.....-...-.....-..........
ENSSSCP00000024968  V..RL.QTLA...EM....................L....LSDSVPHTVGLT.....V...S.....D..........
ENSSSCP00000000277  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000027978  R..PV.KFLW...KL....................Eq...VCDDEWHHYALN.....L...E.....F..........
ENSSSCP00000005978  LpgAV.LPAP...GP....................R....VADGAWHRVRLA.....M...E.....Rpeaaa.....
ENSSSCP00000014530  -..--.----...-I....................N....LTDGRWHRVAVS.....V...N.....G..........
ENSSSCP00000023947  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000025895  V..RL.QTLA...EM....................L....LSDSVPHTVGLT.....V...S.....D..........
ENSSSCP00000022922  V..RL.QTLA...EM....................L....LSDSVPHTVGLT.....V...S.....D..........
ENSSSCP00000005978  V..LV.LRLL...DM....................A....LNDGYWHQVEVA.....L...R.....L..........
ENSSSCP00000026588  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000001308  Y..LS.VSPN...GK....................Sm...VFTGLWM-----.....-...-.....-..........
ENSSSCP00000000277  -..--.----...--....................-....--------V---.....-...-.....-..........
ENSSSCP00000004471  C..SL.NSVL...PVkdkd................D....IFTENFEQLCFV.....W...N.....N..........
ENSSSCP00000004541  V..GR.VEYP...DL....................T....IDDSYWYRIEAS.....R...T.....G..........
ENSSSCP00000020853  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006241  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000026906  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000016389  R..EP.YNIDve.HR....................N....MANGQPHSVNIT.....R...H.....E..........
ENSSSCP00000006954  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000015012  I..HL.VVFN...NL....................Q....LADGRRHRLLLR.....L...T.....Nlhrga.....
ENSSSCP00000016392  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000027979  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000004016  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000020473  -..--.----...--....................-....------HSVNIT.....R...H.....E..........
ENSSSCP00000008195  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000030974  -..--.----...-T....................R....SADERW------.....-...-.....-..........
ENSSSCP00000019430  Y..KP.AEFH...WKlh..................Q....VCDEEWHHYVLN.....V...D.....I..........
ENSSSCP00000022637  -..--.----...RT....................P....VNDGKYHVVRFT.....R...N.....G..........
ENSSSCP00000014907  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000017077  Y..AT.VMLP...DH....................S....FCDSLWHNITIV.....H...M.....Pgkrpfgq...
ENSSSCP00000010815  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009337  L..AV.KT--...KF....................T....IPLKEWLRLDIS.....F...N.....G..........
ENSSSCP00000019007  -..--.----...--....................-....---------V--.....-...-.....-..........
ENSSSCP00000024991  -..--.----...--....................-....LNDGQWHEVRFL.....A...K.....E..........
ENSSSCP00000009843  L..LQ.NYVD...DFseessfyeilpccarfrcgeL....IVEGQWHHLVLV.....M...SkgmlkN..........
ENSSSCP00000019007  -..--.----...--....................-....-------R----.....-...-.....-..........
ENSSSCP00000023477  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000009452  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003203  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000003203  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000022093  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000027047  -..--.----...--....................-....------------.....-...-.....-..........
ENSSSCP00000006952  V..HA.VNLQ...QA....................G....LADGRTHTALLR.....L...R.....G..........
ENSSSCP00000011072  Q..PL.DVME...PEddlepsagrqlrvrcgq...L....LACGQWHHLAVV.....V...SkemkrN..........
ENSSSCP00000023964  Q..PL.DVME...PEddlepsagrqlrvrcgq...L....LACGQWHHLAVV.....V...SkemkrN..........


                                      140                    150                     160         170
                                        |                      |                       |           |
d2erfa1               ......DR........AQLYI....DC...E..KM..E.N.A.E..........LDV..PIQS.VFTRDLA..SIARL
ENSSSCP00000029807  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005158  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015013  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015012  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000014796  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006952  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004335  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000014907  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005280  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024403  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001201  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029440  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001416  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029869  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030828  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000026179  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000014929  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029385  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001288  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024192  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015699  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001200  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000008754  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015688  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029029  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000014840  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021212  ......GT........LSFVV....DG...Q..YL..G.V.A.F..........RGL..K---.-------..-----
ENSSSCP00000014732  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003582  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005042  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009237  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006271  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006272  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009236  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000007533  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000014615  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000022095  ......GV........ISFYV....TG...R..S-..-.-.-.-..........---..----.-------..-----
ENSSSCP00000027530  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024940  ......--........-----....D-...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000002077  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..----V
ENSSSCP00000023787  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..----V
ENSSSCP00000004776  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021310  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004184  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003925  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000027015  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..--L--
ENSSSCP00000008227  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005767  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024925  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000018810  ......SQ........FQVTV....NG...R..LF..V.Q.Y.T..........HRV..PFHR.VDTIS--..-----
ENSSSCP00000014885  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000028656  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030393  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030993  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000012889  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029279  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030659  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005403  ......KA........WAMYV....DN...N..RS..W.F.M.H..........NNS..----.-------..-----
ENSSSCP00000001314  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009454  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001560  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001564  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000023159  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000028586  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021328  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021030  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001553  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015601  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001716  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019609  ......GV........WALQL....NC...G..QY..W.-.-.-..........---..----.-------..-----
ENSSSCP00000022993  ......GV........WALQL....NC...G..QY..W.-.-.-..........---..----.-------..-----
ENSSSCP00000001312  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029343  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015849  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005434  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030635  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019990  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021698  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000025036  ......KA........WAMYV....DN...N..RS..W.F.M.H..........NNS..----.-------..-----
ENSSSCP00000018810  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015851  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000013361  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009456  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000018791  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000010821  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000000129  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000011201  ......QM........VNLSI....DG...G..SP..M.T.M.D..........NFG..K---.--HYTLN..SEAPL
ENSSSCP00000015852  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000017851  ......QS........GKITV....DD...Y..GA..R.T.-.-..........--G..KSPG.MM-RQLN..INGAL
ENSSSCP00000009455  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000012112  qgpskdKV........AVLSV....DD...C..DV..AvA.L.QfgaeignyscAAA..GTQT.SSKKSLD..LTGPL
ENSSSCP00000006826  ......GI........TELWV....DG...K..PM..V.R.R.S..........LKR..----.--GYSLG..TQASI
ENSSSCP00000029570  ......GI........TELWV....DG...K..PM..V.R.R.S..........LKR..----.--GYSLG..TQASI
ENSSSCP00000018163  ......GV........WEAYQ....DG...T..QG..G.N.-.-..........-GE..NLAP.YHP--IK..PQGVL
ENSSSCP00000005380  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000000853  ......SH........LILHI....DC...N..KI..Y.E.R.V..........VEK..P---.--STDLP..VGTTF
ENSSSCP00000009453  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000008124  ......GM........WEAFQ....DG...E..KL..G.T.-.-..........-GE..NLAP.WHP--IK..PGGVL
ENSSSCP00000025878  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000026387  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019654  ......GI........AEFWV....DG...K..PK..V.R.K.S..........LEK..----.--GASVE..AEASI
ENSSSCP00000024906  ......KD........GSLRV....NG...G..RP..V.L.R.S..........SPG..KSQG.-----LN..LHTLL
ENSSSCP00000015599  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024988  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024616  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021918  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009325  ......QS........LSLSV....DG...G..SP..K.I.I.T..........-NL..SK--.--QSTLN..FDSPL
ENSSSCP00000022455  ......QS........GKITV....DD...Y..GA..R.T.-.-..........--G..KSPG.MM-RQLN..INGAL
ENSSSCP00000010821  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001973  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000017851  ......LN........GLLQL....NN...G..TP..V.T.G.Q..........SQG..QY--.--S-KIT..FRTPL
ENSSSCP00000022455  ......LN........GLLQL....NN...G..TP..V.T.G.Q..........SQG..QY--.--S-KIT..FRTPL
ENSSSCP00000013885  ......SF........LILFL....FG...N..EE..M.K.V.S..........VN-..----.-------..-----
ENSSSCP00000006160  ......KN........VTLIL....DC...K..KK..T.T.K.F..........LDR..SD--.--HPIID..VNGII
ENSSSCP00000023414  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029303  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000008285  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024906  ......RR........GSIQV....DG...E..EL..V.S.G.Q..........SPG..P---.--NVAVN..TKGSV
ENSSSCP00000005158  ......DR........AQLYI....DC...E..KM..E.N.A.E..........LDV..PIQS.IFTRDLA..SIANL
ENSSSCP00000029039  ......QS........VTLIL....DC...K..KR..V.T.R.P..........LPR..SA--.--HPVLD..THGVI
ENSSSCP00000018428  ......RD........ANLTL....DG...Y..V-..H.R.F.V..........LNG..DFERlNLDNEMF..IGGLV
ENSSSCP00000006832  ......GI........AELWV....NG...K..PV..G.R.K.G..........LKR..----.--GYTVK..EKASI
ENSSSCP00000006161  ......KN........VTLIL....DC...K..KK..T.T.K.F..........LDR..SD--.--HPIID..VNGII
ENSSSCP00000018218  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000018024  ......QT........LNLVV....DK...G..AP..K.S.LgK..........LQK..----.--QPAVS..INSPL
ENSSSCP00000001598  ......QS........VTLIL....DC...K..KR..V.T.R.P..........LPR..SA--.--HPVLD..THGVI
ENSSSCP00000030976  ......QS........VTLIL....DC...K..KR..V.T.R.P..........LPR..SA--.--HPVLD..THGVI
ENSSSCP00000011839  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030667  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001317  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003232  ......NE........YQVMV....NG...Q..HY..Y.S.F.P..........HRL..SPQS.-------..-----
ENSSSCP00000013851  ......NV........HTLKI....DS...R..TV..T.Q.H.S..........NGA..----.---RNLD..LKGEL
ENSSSCP00000023132  ......RE........GSLQV....GN...E..AP..V.T.G.S..........SPL..G---.--ATQLD..TDGAL
ENSSSCP00000016666  ......KQ........VNFTV....DK...H..TQ..H.F.R.T..........KGE..ADAL.DIDYELS..FGGIP
ENSSSCP00000004335  ......ET........YSLYV....GC...D..LM..D.S.F.T..........LDE..PFYE.QLKTE--..-QSRM
ENSSSCP00000019848  ......NY........LSVTV....DG...Q..VA..S.A.A.P..........SMG..----.--PEHIY..SGGSY
ENSSSCP00000010319  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000022089  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000007459  ......NY........ARLVL....DQ...V..HT..A.S.G.T..........APGtlKTLN.LDNHVFF..GGHIR
ENSSSCP00000001326  ......GE........VVFY-....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001327  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005851  ......GA........WKVYI....DG...K..LS..D.G.-.-..........-GM..GLS-.-IGSAIP..GGGAL
ENSSSCP00000010214  ......RN........LVVKV....NR...D..AV..M.K.I.A..........VAG..ELF-.-------..-----
ENSSSCP00000025497  ......EE........ASLLV....EC...E..EQ..G.H.V.S..........FPR..SSQ-.--ALAFE..PSAGI
ENSSSCP00000030716  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029973  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004541  ......QE........GILDV....DG...A..SN..R.T.I.-..........-SP..KK--.--ADILD..VVGML
ENSSSCP00000026569  ......NT........HSLKV....DT...K..VV..T.Q.V.I..........NGA..KN--.-----LD..LKGDL
ENSSSCP00000000431  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020796  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000012801  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000016666  ......NR........ITLTL....DN...D..AA..S.-.-.-..........---..PAQD.TSRMQIY..SGNSY
ENSSSCP00000023132  ......RR........GTLSV....GG...R..RP..R.G.V.Q..........CHS..GLRE.---GVPL..TPGPH
ENSSSCP00000019848  ......RQ........VNLTV....DE...H..KH..H.F.H.A..........QGE..FGYL.HLDYEIS..FGGIP
ENSSSCP00000006241  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020492  ......--........-----....--...-..--..-.-.-.-..........---..----.-WEVDVD..SSWDW
ENSSSCP00000008085  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000018239  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021088  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003894  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020352  ......PR........FRVFV....DG...H..QL..F.D.F.Y..........HRI..QTLS.AIDT---..-----
ENSSSCP00000024007  ......PR........FRVFV....DG...H..QL..F.D.F.Y..........HRI..QTLS.AIDT---..-----
ENSSSCP00000012140  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000015856  ......NF........TSLSL....DD...S..YV..E.R.R.R..........APL..YFQT.-----LS..TESTI
ENSSSCP00000000096  ......GL........WSAYQ....DG...E..LR..G.S.-.-..........-GE..NLAA.WHP--IK..PHGIL
ENSSSCP00000022990  ......--........-----....D-...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009188  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030087  ......DE........ATLEV....DG...T..RG..Q.R.D.V..........SPA..GLQE.-------..--RLV
ENSSSCP00000012497  ......GH........VALWV....NG...D..LI..A.T.K.V..........D--..---M.ATGHIVP..EGGIL
ENSSSCP00000031041  ......TM........AKVVI....DC...K..EV..G.E.K.A..........INA..SSNItSDGVEVL..GRMVR
ENSSSCP00000004838  ......KS........VKIYI....DC...Y..EI..I.E.K.N..........IQE..----.--AGNIT..TDGYE
ENSSSCP00000025331  ......SE........IRCYV....NG...Q..LV..S.Y.G.D..........MAW..HVNT.NDSYD--..---KC
ENSSSCP00000006405  ......TM........AKVVI....DC...K..EV..G.E.K.A..........INA..SSNItSDGVEVL..GRMVR
ENSSSCP00000013851  ......RK........GSISV....NS...R..ST..P.F.L.A..........TGE..SEI-.-----LD..LESEL
ENSSSCP00000005821  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004541  ......HR........VELTV....DG...N..QV..E.A.Q.S..........PNP..A---.--STSAD..TNDPV
ENSSSCP00000021819  ......KQ........GLLAVidahDT...S..YK..E.T.K.Q..........GET..PGAS.-SDLNRL..DKDPI
ENSSSCP00000018415  ......RN........LFIQV....DY...F..PL..T.E.Q.K..........FSL..----.LVDSQLD..SPKAL
ENSSSCP00000013851  ......KS........LQLSV....DN...V..TV..E.G.Q.M..........AGA..HTRL.--EFHNI..ETGIM
ENSSSCP00000010214  ......DE........ATLEV....DG...T..RG..Q.R.D.V..........SPA..GLQE.-------..--RLV
ENSSSCP00000011618  ......AV........TVALR....DD...S..CT..G.S.C.I..........SKA..PSPF.GSDRSAC..ALQNS
ENSSSCP00000008984  ......RN........TTLFI....DQ...V..EA..K.W.V.E..........VKS..K---.--RRDMT..VFSGL
ENSSSCP00000004615  ......NS........ATLFV....DC...N..RI..E.S.L.P..........IKP..----.--RGQID..VDGFA
ENSSSCP00000030087  ......RN........LVVKV....NR...D..AV..M.K.I.A..........VAG..ELFQ.-------..-----
ENSSSCP00000004918  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000007532  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004775  ......NV........VQLDV....DS...E..V-..N.H.V.V..........GPL..N---.--PKPVD..HREPV
ENSSSCP00000008985  ......-Hsgigham.VTISV....DG...I..LT..T.T.G.Y..........TQE..DY--.---TMLG..SDDFF
ENSSSCP00000018428  ......NH........AVISI....DD...V..EG..A.E.V.R..........VSY..PLLI.RTGTSYF..FGGCP
ENSSSCP00000004775  ......SS........GRLII....DG...L..RV..L.E.E.S..........LPP..T---.--GATWK..IKGPI
ENSSSCP00000008158  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000013851  ......-QhagighamVTISV....DG...I..LT..T.T.G.Y..........TQE..D---.--YTMLG..SDDFF
ENSSSCP00000026169  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000023415  ......AH........VALFV....DC...E..EV..Q.L.E.P..........LSR..SLR-.--ALQLE..PDARL
ENSSSCP00000027051  ......KT........VTMIV....DC...K..KK..T.T.K.P..........LDR..SE--.--RAIVD..TNGIT
ENSSSCP00000026077  ......LR........TVLVL....DG...E..GQ..S.G.E.L..........QPQ..----.--RPYMD..VVSDL
ENSSSCP00000004541  ......NI........SIVDI....DT...N..QE..E.T.I.A..........TTS..PGN-.NFGLDLK..ADDKI
ENSSSCP00000027650  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019848  ......KE........ASVQV....DQ...L..SP..R.R.Q.P..........APA..DG--.--HVLLQ..LNSQL
ENSSSCP00000023361  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000026213  ......NY........LSVTV....DG...Q..VA..S.A.A.P..........SMG..----.--PEHIY..SGGSY
ENSSSCP00000023132  ......RK........GAMRV....GD...G..P-..-.-.R.V..........LGE..SPVP.--HTILN..LKEPL
ENSSSCP00000008195  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006241  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000025417  ......RR........GTLSV....DD...E..TP..V.L.-.-..........-GQ..SPSG.TDGLN--..LDTDL
ENSSSCP00000016447  ......QR........MALYV....DG...T..RV..A.S.S.P..........DQS..GPLN.--SPFMA..SCRSL
ENSSSCP00000021819  ......RI........ITVQL....DE...T..TP..V.D.M.K..........LGP..STE-.---SRTI..NVSNL
ENSSSCP00000006241  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019848  ......AV........VFVEI....DE...N..AR..R.Q.V.H..........LAS..----.--GTELS..AIRSL
ENSSSCP00000021829  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020853  ......KE........ASLQV....VS...F..PY..H.L.-.-..........NSE..PAGG.IIRIGLG..SNVCF
ENSSSCP00000013851  ......RR........TALAV....DG...E..AR..A.A.E.V..........RSK..----.--RREMQ..VASDL
ENSSSCP00000016390  ......KQ........ASLQV....DR...L..PQ..Q.V.R.K..........APT..EGHT.RL-----..-----
ENSSSCP00000004039  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000014354  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020506  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001881  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000013851  ......GN........ATLQV....DS...W..PV..N.E.R.Y..........PAG..----.-------..-----
ENSSSCP00000016666  ......RG........LTIQV....DE...Q..LR..L.S.Y.N..........FSP..----.--EAEFR..AGKSL
ENSSSCP00000005883  ......RS........VTLVT....AC...G..Q-..R.R.V.P..........VSL..PFHR.--DPALD..PEGLF
ENSSSCP00000004543  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003039  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000018415  ......KQ........ARLRV....DH...R..PW..V.L.R.P..........MPL..QTYI.WLEYD--..--RPL
ENSSSCP00000027862  ......--........-----....G-...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004541  ......GI........FTVQV....DE...D..RR..H.M.Q.N..........LTV..----.--EQAIE..VKKLF
ENSSSCP00000018099  ......TS........IRLLV....DS...T..GT..A.F.L.V..........LPE..TCQG.-----LR..PEGDL
ENSSSCP00000012904  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030031  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004614  ......QG........ISLYM....DC...N..LV..A.S.Q.N..........TDG..----.--KGALD..FRGRT
ENSSSCP00000027678  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000017907  ......DS........ISLVI....DK...H..YE..M.T.G.Q..........ITG..GRH-.----SLH..FQHGI
ENSSSCP00000027979  ......ER........GRLVM....DG...L..RA..R.E.G.S..........LPG..----.--NSTIS..LRAPV
ENSSSCP00000004016  ......ER........GRLVM....DG...L..RA..R.E.G.S..........LPG..----.--NSTIS..LRAPV
ENSSSCP00000003680  ......PS........VVLYV....DGas.H..EP..F.S.V.T..........EDY..PLHPsSIETQLV..VGACW
ENSSSCP00000001127  ......-T........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006241  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001629  ......QD........VTLYI....DD...Q..QI..E.N.K.P..........LHP..----.--VLGIF..ISGQT
ENSSSCP00000005988  ......GR........WALFA....DG...R..RR..A.G.A.Rg.........LGA..----.--GHPLP..PGGVL
ENSSSCP00000024916  ......GR........WALFA....DG...R..RR..A.G.A.Rg.........LGA..----.--GHPLP..PGGVL
ENSSSCP00000021132  ......SE........LRCYV....NG...E..LA..S.Y.-.-..........---..----.-------..-----
ENSSSCP00000017907  ......RY........LDLMV....DE...Q..GV..R.T.L.-..........---..--LP.LQSQPFV..SEGPL
ENSSSCP00000005893  ......RL........MKLYV....NG...A..QV..A.T.S.G..........E--..QVGG.IFSPLTQ..KCKVL
ENSSSCP00000029807  ......DR........AQLYI....DC...E..KM..E.N.A.E..........LDV..PIQS.IFTRDLA..SIANL
ENSSSCP00000011596  ......--........-----....--...-..--..-.-.-.-..........--W..----.-------..-----
ENSSSCP00000002048  ......HR........LEISV....DQ...Y..PT..-.-.R.T..........SNR..GVLS.----SLE..PRGSL
ENSSSCP00000001310  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000028578  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000012112  ......GHhvlmvsldFSLFQ....DT...L..AV..G.S.E.L..........QGL..KVK-.----RLH..VGGLP
ENSSSCP00000018222  ......--........FS---....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029355  ......--........FS---....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003233  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000023342  ......GH........YLVVV....NG...D..PF..Y.E.F.G..........HRI..PVQL.VTHLQVD..GDLT-
ENSSSCP00000023857  ......PS........VVLYV....DGas.H..EP..F.S.V.T..........EDY..PLHP.-----SS..IETQL
ENSSSCP00000026405  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000023656  ......RV........ASVHV....DC...T..SA..S.S.Q.P..........LGP..----.--RRPIR..PVGHV
ENSSSCP00000001565  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003907  ......RV........ASVHV....DC...T..SA..S.S.Q.P..........LGP..----.--RRPIR..PVGHV
ENSSSCP00000012436  ......PV........VTLYM....DG...AtyEP..Y.L.V.T..........NDW..PIHPsHIAMQLT..VGACW
ENSSSCP00000001558  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004775  ......KK........MILVV....DR...R..HV..K.S.M.D..........NE-..----.--KMKIP..FTDIY
ENSSSCP00000010407  ......EG........LKVYV....NG...T..LS..N.S.D.P..........SGK..EA--.--HAYGE..PNANL
ENSSSCP00000027979  ......HI........VHLEL....DS...E..HS..Y.T.A.G..........---..----.-------..-----
ENSSSCP00000004016  ......HI........VHLEL....DS...E..HS..Y.T.A.G..........---..----.-------..-----
ENSSSCP00000026273  ......SR........WQMEV....DH...Pa.PL..V.T.S.A..........VAA..GSLD.FLKDDID..----I
ENSSSCP00000027979  ......SG........LRLLI....DD...Q..PL..K.N.-.-..........-NQ..KLRD.F----SD..SQQSL
ENSSSCP00000004016  ......SG........LRLLI....DD...Q..PL..K.N.-.-..........-NQ..KLRD.F----SD..SQQSL
ENSSSCP00000015120  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000029926  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019261  ......RS........VTLVT....AC...G..Q-..R.R.V.P..........VSL..PFHR.--DPALD..PEGLF
ENSSSCP00000027979  ......KR........MRIRM....DS...L..SS..IeG.D.A..........FDF..----.--STYYL..GGIPI
ENSSSCP00000004016  ......KR........MRIRM....DS...L..SS..IeG.D.A..........FDF..----.--STYYL..GGIPI
ENSSSCP00000019207  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000025417  ......RE........GSLQV....GN...E..AP..V.T.G.S..........SPL..G---.--ATQXD..TDGAL
ENSSSCP00000024968  ......HR........LEISV....DQ...Y..PT..-.-.R.T..........SNR..GVLS.----SLE..PRGSL
ENSSSCP00000001308  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004775  ......AR........YELIV....DK...S..RL..G.S.-.-..........-KN..PTKG.KVEQTQA..GEKKF
ENSSSCP00000025895  ......HR........LEISV....DQ...Y..PT..-.-.R.T..........SNR..GVLS.----SLE..PRGSL
ENSSSCP00000022922  ......HR........LEISV....DQ...Y..PT..-.-.R.T..........SNR..GVLS.----SLE..PRGSL
ENSSSCP00000002048  ......SW........ASLSV....DG...L..LN..A.S.A.L..........VQG..G---.----PLE..VPYGL
ENSSSCP00000000712  ......PT........VTLYA....DG...I..SF..D.P.A.L..........I--..---H.DNGLIHPprREPAL
ENSSSCP00000022455  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001310  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000028578  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000016392  ......RS........INLTL....DR...S..MQ..H.F.R.T..........NGE..FDYL.DLDYEIT..FGGIP
ENSSSCP00000008559  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021819  ......NT........GSLSV....KE...M..SA..S.Q.K.P..........PPRtsKSPGtANVLDVN..NSTLM
ENSSSCP00000003203  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000010021  ......--........-----....--...-..E-..-.-.-.-..........---..----.-------..-----
ENSSSCP00000010815  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020574  ......TA........TVLSI....DR...I..YN..R.D.I.I..........H--..----.-------..-----
ENSSSCP00000016666  ......NL........KITYV....QQ...T..NL..G.SsW.R..........TGS..Q---.KTHILFP..TNCNM
ENSSSCP00000022958  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000005978  ......DH........L----....--...-..--..-.-.-.-..........---..---Q.SLGQQVH..VGGRL
ENSSSCP00000017851  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000021247  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000012777  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006241  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000028807  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-TLIV
ENSSSCP00000013885  ......GG........LKLAL....NG...Q..GL..G.A.T.S..........LGP..QAL-.-------..-----
ENSSSCP00000025417  ......RK........GAMRV....GD...G..PRvlG.E.S.P..........KSR..KVP-.--HTILN..LKEPL
ENSSSCP00000004775  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024968  ......SW........ASLSV....DG...L..LN..A.S.A.L..........VQG..G---.--PLEVP..YGLPY
ENSSSCP00000000277  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000027978  ......PT........VTLYA....DG...I..SF..D.P.A.-..........---..----.-------..-----
ENSSSCP00000005978  ......SR........WLLWL....DG...A..AT..P.V.A.L..........RG-..----.-----LA..GDLDF
ENSSSCP00000014530  ......RT........ATLVA....DC...E..PQ..S.P.V.L..........VQG..----.--PRFIS..TAGLT
ENSSSCP00000023947  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000025895  ......SW........ASLSV....DG...L..LN..A.S.A.L..........VQG..G---.--PLEVP..YGLPY
ENSSSCP00000022922  ......SW........ASLSV....DG...L..LN..A.S.A.L..........VQG..G---.--PLEVP..YGLPY
ENSSSCP00000005978  ......GVle......LRLWH....EG...C..PA..R.L.C.M..........ASS..PVA-.--LPPLA..SQAPM
ENSSSCP00000026588  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000001308  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000000277  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004471  ......SL........GSIGV....NF...K..RN..Y.E.-.-..........-EV..SCDS.TVSKVIP..GNGKL
ENSSSCP00000004541  ......RN........GTISVral.DGpkaS..MV..P.S.T.Y..........HSA..SPPG.YTILDVD..ANAML
ENSSSCP00000020853  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006241  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000026906  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000016389  ......KT........IILKV....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006954  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..G----
ENSSSCP00000015012  ......GS........VELYL....DC...T..QV..D.S.-.-..........---..----.-------..-----
ENSSSCP00000016392  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000027979  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000004016  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000020473  ......KT........IILKL....DH...Y..PS..V.S.Y.H..........LPS..SS--.--DTLFN..SPKSL
ENSSSCP00000008195  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000030974  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000019430  ......PS........VVLYV....DGas.H..EP..F.S.V.T..........EDY..PLHP.-----SS..IETQL
ENSSSCP00000022637  ......GN........ATLQV....DN...W..PV..N.E.H.-..........---..----.-------..-----
ENSSSCP00000014907  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000017077  ......SL........VYIYD....NG...Q..QK..V.Y.A.P..........LRF..----.-------..-----
ENSSSCP00000010815  ......--........-----....--...-..--..-.-.-.-..........LRV..GWAS.TEGYSPY..PGGGE
ENSSSCP00000009337  ......GQ........IVVTA....SS...G..QD..L.E.N.Yhn........QTI..SFRE.DFHY-ND..TDGYF
ENSSSCP00000019007  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000024991  ......NF........AILTI....DG...D..EA..S.A.V.R..........TNS..PLQV.KTG----..-----
ENSSSCP00000009843  ......ST........AALYI....DG...Q..LV..G.T.V.K..........LHY..----.-------..-----
ENSSSCP00000019007  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000023477  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000009452  ......GS........LILSQ....DG...K..TA..T.F.Q.R..........RNV..PI--.-------..-----
ENSSSCP00000003203  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000003203  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000022093  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000027047  ......--........-----....--...-..--..-.-.-.-..........---..----.-------..-----
ENSSSCP00000006952  ......PSrpspa...LQLYV....DC...K..L-..-.-.-.-..........---..----.-------..-----
ENSSSCP00000011072  ......CT........VSTYL....DG...Q..VI..G.T.A.-..........---..----.-------..-----
ENSSSCP00000023964  ......CT........VSTYL....DG...Q..VI..G.T.A.-..........---..----.-------..-----


                                                                          180                    190
                                                                            |                      |
d2erfa1               RIAK........G.........................GVN.........D...NFQ.............GVLQNVRF
ENSSSCP00000029807  ----........-.........................---.........-...---.............--------
ENSSSCP00000005158  ----........-.........................---.........-...---.............--------
ENSSSCP00000015013  ----........-.........................---.........-...---.............--------
ENSSSCP00000015012  ----........-.........................---.........-...---.............--------
ENSSSCP00000014796  ----........-.........................---.........-...---.............--------
ENSSSCP00000006952  ----........-.........................---.........-...---.............--------
ENSSSCP00000004335  ----........-.........................---.........-...---.............--------
ENSSSCP00000014907  ----........-.........................---.........-...---.............--------
ENSSSCP00000005280  ----........-.........................---.........-...---.............--------
ENSSSCP00000024403  ----........-.........................---.........-...---.............--------
ENSSSCP00000001201  ----........-.........................---.........-...---.............--------
ENSSSCP00000029440  ----........-.........................---.........-...---.............--------
ENSSSCP00000001416  ----........-.........................---.........-...---.............--------
ENSSSCP00000029869  ----........-.........................---.........-...---.............--------
ENSSSCP00000030828  ----........-.........................---.........-...---.............--------
ENSSSCP00000026179  ----........M.........................NPD.........D...TFE.............VLIDQIVV
ENSSSCP00000014929  ----........-.........................---.........-...---.............--------
ENSSSCP00000029385  ----........-.........................---.........-...---.............--------
ENSSSCP00000001288  ----........-.........................---.........-...---.............--------
ENSSSCP00000024192  ----........-.........................---.........-...---.............--------
ENSSSCP00000015699  ----........-.........................---.........-...---.............--------
ENSSSCP00000001200  ----........-.........................---.........-...---.............--------
ENSSSCP00000008754  ----........-.........................---.........-...---.............--------
ENSSSCP00000015688  ----........-.........................---.........-...---.............--------
ENSSSCP00000029029  ----........-.........................---.........-...---.............--------
ENSSSCP00000014840  ----........-.........................---.........-...---.............--------
ENSSSCP00000021212  ----........-.........................---.........-...---.............--------
ENSSSCP00000014732  ----........-.........................---.........-...---.............--------
ENSSSCP00000003582  ----........-.........................---.........-...---.............--------
ENSSSCP00000005042  ----........-.........................---.........-...---.............--------
ENSSSCP00000009237  ----........-.........................---.........-...---.............--------
ENSSSCP00000006271  ----........-.........................---.........-...---.............--------
ENSSSCP00000006272  ----........-.........................---.........-...---.............--------
ENSSSCP00000009236  ----........-.........................---.........-...---.............--------
ENSSSCP00000007533  ----........-.........................---.........-...---.............--------
ENSSSCP00000014615  ----........-.........................---.........-...---.............--------
ENSSSCP00000022095  ----........-.........................---.........-...---.............--------
ENSSSCP00000027530  ----........-.........................---.........-...---.............--------
ENSSSCP00000024940  ----........-.........................---.........-...---.............--------
ENSSSCP00000002077  ----........-.........................---.........-...---.............--------
ENSSSCP00000023787  ----........-.........................---.........-...---.............--------
ENSSSCP00000004776  ----........-.........................---.........-...---.............--------
ENSSSCP00000021310  ----........-.........................---.........-...---.............--------
ENSSSCP00000004184  ----........-.........................---.........-...---.............--------
ENSSSCP00000003925  ----........-.........................---.........-...---.............--------
ENSSSCP00000027015  ----........-.........................---.........-...---.............--------
ENSSSCP00000008227  ----........-.........................---.........-...---.............--------
ENSSSCP00000005767  ----........-.........................---.........-...---.............--------
ENSSSCP00000024925  ----........-.........................---.........-...---.............--------
ENSSSCP00000018810  ----........-.........................---.........-...---.............--------
ENSSSCP00000014885  ----........-.........................---.........-...---.............--------
ENSSSCP00000028656  ----........-.........................---.........-...---.............--------
ENSSSCP00000030393  ----........-.........................---.........-...---.............--------
ENSSSCP00000030993  ----........-.........................---.........-...---.............--------
ENSSSCP00000012889  ----........-.........................---.........-...---.............--------
ENSSSCP00000029279  ----........-.........................---.........-...---.............--------
ENSSSCP00000030659  ----........-.........................---.........-...---.............--------
ENSSSCP00000005403  ----........-.........................---.........-...---.............--------
ENSSSCP00000001314  ----........-.........................---.........-...---.............--------
ENSSSCP00000009454  ----........-.........................---.........-...---.............--------
ENSSSCP00000001560  ----........-.........................---.........-...---.............--------
ENSSSCP00000001564  ----........-.........................---.........-...---.............--------
ENSSSCP00000023159  ----........-.........................---.........-...---.............--------
ENSSSCP00000028586  ----........-.........................---.........-...---.............--------
ENSSSCP00000021328  ----........-.........................---.........-...---.............--------
ENSSSCP00000021030  ----........-.........................---.........-...---.............--------
ENSSSCP00000001553  ----........-.........................---.........-...---.............--------
ENSSSCP00000015601  ----........-.........................---.........-...---.............--------
ENSSSCP00000001716  ----........-.........................---.........-...---.............--------
ENSSSCP00000019609  ----........-.........................---.........-...---.............--------
ENSSSCP00000022993  ----........-.........................---.........-...---.............--------
ENSSSCP00000001312  ----........-.........................---.........-...---.............--------
ENSSSCP00000029343  ----........-.........................---.........-...---.............--------
ENSSSCP00000015849  ----........-.........................---.........-...---.............--------
ENSSSCP00000005434  ----........-.........................---.........-...---.............--------
ENSSSCP00000030635  ----........-.........................---.........-...---.............--------
ENSSSCP00000019990  ----........-.........................---.........-...---.............--------
ENSSSCP00000021698  ----........-.........................---.........-...---.............--------
ENSSSCP00000025036  ----........-.........................---.........-...---.............--------
ENSSSCP00000018810  ----........-.........................---.........-...---.............--------
ENSSSCP00000015851  ----........-.........................---.........-...---.............--------
ENSSSCP00000013361  ----........-.........................---.........-...---.............--------
ENSSSCP00000009456  ----........-.........................---.........-...---.............--------
ENSSSCP00000018791  -S--........-.........................---.........-...---.............--------
ENSSSCP00000010821  ----........-.........................---.........-...RFQ.............VDLQ----
ENSSSCP00000000129  ----........-.........................---.........-...---.............--------
ENSSSCP00000011201  YVGG........Mpvdvnsaafrlwqi...........LNG.........S...SFH.............GCIRNLYI
ENSSSCP00000015852  ----........-.........................---.........-...---.............--------
ENSSSCP00000017851  YVGGmkeial..H.........................TNR.........-...---.............--------
ENSSSCP00000009455  ----........-.........................---.........-...---.............--------
ENSSSCP00000012112  LLGGv.......Pnlpenfp..................VSH.........K...DFV.............GCMRDLHI
ENSSSCP00000006826  ILGQeq......D.........................AFA.........G...GFEknqclv.......GDIGDVNM
ENSSSCP00000029570  ILGQeq......D.........................AFA.........G...GFEknqclv.......GDIGDVNM
ENSSSCP00000018163  VLGQeq......D.........................TLG.........G...GFDatqafv.......GELAHFNI
ENSSSCP00000005380  ----........-.........................---.........-...---.............--------
ENSSSCP00000000853  WLGQr.......N.........................NAH.........G...YFK.............GIMQDVQL
ENSSSCP00000009453  ----........-.........................---.........-...-F-.............--------
ENSSSCP00000008124  ILGQeq......D.........................TVG.........G...RFDatqafv.......GELSQFNI
ENSSSCP00000025878  ----........-.........................---.........-...---.............--------
ENSSSCP00000026387  -V--........-.........................---.........-...---.............--------
ENSSSCP00000019654  ILGQeq......D.........................TFA.........G...EYEknqclv.......GDIGDVNM
ENSSSCP00000024906  YLGGve......Psvqlppat.................NVS.........A...HFH.............GCIGEVSV
ENSSSCP00000015599  ----........-.........................---.........-...---.............--------
ENSSSCP00000024988  ----........-.........................---.........-...---.............--------
ENSSSCP00000024616  ----........-.........................---.........-...---.............--------
ENSSSCP00000021918  ----........-.........................---.........-...---.............--------
ENSSSCP00000009325  YVGG........Mpgknnvaaalrqapg..........HNG.........T...SFH.............GCIRNLYI
ENSSSCP00000022455  YVGGmkeial..H.........................TN-.........-...---.............--------
ENSSSCP00000010821  ----........-.........................---.........-...---.............--------
ENSSSCP00000001973  ----........-.........................---.........-...---.............--------
ENSSSCP00000017851  YVGG........Apsvywlvrat...............GTN.........R...GFQ.............GCVQSLTV
ENSSSCP00000022455  YVGG........Apsvywlvrat...............GTN.........R...GFQ.............GCVQSLTV
ENSSSCP00000013885  ----........-.........................---.........-...---.............--------
ENSSSCP00000006160  VFGT........R.........................ILD.........Ee..VFE.............GDIQQLLF
ENSSSCP00000023414  ----........-.........................---.........-...---.............--------
ENSSSCP00000029303  ----........-.........................---.........-...---.............--------
ENSSSCP00000008285  ----........-.........................---.........-...---.............--------
ENSSSCP00000024906  YIGGapdva...A.........................LTG.........G...RFSsgit.........GCIKNLVL
ENSSSCP00000005158  RIAK........G.........................GVN.........D...NFQ.............GVLQNVRF
ENSSSCP00000029039  IFGA........R.........................ILD.........Ee..VFE.............GDVQELVI
ENSSSCP00000018428  GAAQkn......L.........................AYR.........H...NFR.............GCIENVIF
ENSSSCP00000006832  ILGQeq......D.........................SFG.........G...GFDakqsfv.......GEIWDVSL
ENSSSCP00000006161  VFGT........R.........................ILD.........Ee..VFE.............GDIQQLLF
ENSSSCP00000018218  ----........-.........................---.........-...---.............--------
ENSSSCP00000018024  YLGGi.......Ptstglsalrqg..............ADRpl.......G...GFH.............GCIHEVRI
ENSSSCP00000001598  IFGA........R.........................ILD.........Ee..VFE.............GDVQELVI
ENSSSCP00000030976  IFGA........R.........................ILD.........Ee..VFE.............GDVQELVI
ENSSSCP00000011839  ----........-.........................---.........-...---.............--------
ENSSSCP00000030667  ----........-.........................---.........-...---.............--------
ENSSSCP00000001317  ----........-.........................---.........-...---.............--------
ENSSSCP00000003232  ----........-.........................---.........-...---.............--------
ENSSSCP00000013851  YIGGl.......Sknmfnnlpklv..............ASR.........D...GFQ.............GCLASVDL
ENSSSCP00000023132  WLGGle......Klpggqalpk................AYS.........T...GFV.............GCLRDVVV
ENSSSCP00000016666  VPGKpg......T.........................FLK.........K...NFH.............GCMENLY-
ENSSSCP00000004335  YVAK........G.........................SAR.........Es..HFR.............GLLQNVFL
ENSSSCP00000019848  YFGG........Cpdnsvask.................C-Rspl......S...GFQ.............GCMR----
ENSSSCP00000010319  ----........-.........................---.........-...---.............--------
ENSSSCP00000022089  ----........-.........................---.........-...---.............--------
ENSSSCP00000007459  QQGSrhgrs...P.........................QVG.........N...GFR.............GCMDSIYL
ENSSSCP00000001326  ----........-.........................---.........-...---.............--------
ENSSSCP00000001327  ----........-.........................---.........-...---.............--------
ENSSSCP00000005851  VLGQeq......Dikgeg....................FNP.........Ae..SFV.............GSISQLNL
ENSSSCP00000010214  ----........-.........................---.........-...---.............--------
ENSSSCP00000025497  FVGN........A.........................GAT.........Gle.RFT.............GSIQQLTV
ENSSSCP00000030716  ----........-.........................---.........-...---.............--------
ENSSSCP00000029973  ----........-.........................---.........-...---.............--------
ENSSSCP00000004541  YVGGlpinytt.R.........................RIG.........PvtySID.............GCIRNFQM
ENSSSCP00000026569  YMAGl.......Aqgmysnlpklv..............ASR.........D...GFQ.............GCLASVDL
ENSSSCP00000000431  ----........-.........................---.........-...---.............--------
ENSSSCP00000020796  ----........-.........................---.........-...---.............--------
ENSSSCP00000012801  ----........-.........................---.........-...---.............--------
ENSSSCP00000016666  YFGG........Cpdnltdsqcl...............NPT.........K...AFQ.............GCMRLIFI
ENSSSCP00000023132  LGGRvle.....R.........................TSV.........Sv..GLR.............GCIRLLDV
ENSSSCP00000019848  APGKsv......S.........................FPH.........K...NFH.............GCLENLY-
ENSSSCP00000006241  ----........-.........................---.........-...---.............--------
ENSSSCP00000020492  AVGVcr......D.........................SWL.........R...KFD.............GLLS----
ENSSSCP00000008085  ----........-.........................---.........-...---.............--------
ENSSSCP00000018239  ----........-.........................---.........-...---.............--------
ENSSSCP00000021088  ----........-.........................---.........-...---.............--------
ENSSSCP00000003894  ----........-.........................---.........-...---.............--------
ENSSSCP00000020352  ----........-.........................---.........-...---.............--------
ENSSSCP00000024007  ----........-.........................---.........-...---.............--------
ENSSSCP00000012140  ----........-.........................---.........-...--N.............--------
ENSSSCP00000015856  YFGAlvqa....Dnirsltdt.................RVTqvl......S...GFQ.............GCLDSVVL
ENSSSCP00000000096  ILGQeq......D.........................TLG.........G...RFDatqafv.......GDIAQFNL
ENSSSCP00000022990  ----........-.........................---.........-...---.............--------
ENSSSCP00000009188  ----........-.........................---.........-...---.............--------
ENSSSCP00000030087  LLGR........H.........................LQG.........Svl.TFI.............GGLPDVPV
ENSSSCP00000012497  QIGQekng....C.........................CVG.........G...GFDeilafs.......GRLTGFNI
ENSSSCP00000031041  SRGP........N.........................GNS.........A...PFQ.............--LQMFDI
ENSSSCP00000004838  ILGKllk.....G.........................-ER.........Ksa.TFQ.............--IQNFDI
ENSSSCP00000025331  FLGSse......T.........................-AD.........Anr.VFC.............GQLGAVYV
ENSSSCP00000006405  SRGP........N.........................GNS.........A...PFQ.............--LQMFDI
ENSSSCP00000013851  YLGGl.......Peggrvdlplppevwta.........ALR.........A...GYV.............GCVRDLFI
ENSSSCP00000005821  ----........-.........................---.........-...---.............--------
ENSSSCP00000004541  FVGGfp......Dglnqfg...................LTT.........Ni..RFR.............GCIRFLRL
ENSSSCP00000021819  YVGGvp......Rsrvvrkg..................VSS.........K...SYL.............GCIKNLEI
ENSSSCP00000018415  YLGRv.......Metgvidpeiqr..............YNT.........P...GFS.............GCLSGVRF
ENSSSCP00000013851  TERRfi......S.........................VVP.........S...NFI.............GHLSGL--
ENSSSCP00000010214  LLGR........H.........................LQG.........Svl.TFI.............GGLPDVPV
ENSSSCP00000011618  FLGGlpe.....Gtirslpvdtl...............PS-.........Tp..SLV.............GCLQDIEI
ENSSSCP00000008984  FVGGl.......Ppelraaalkltlasv..........RER.........E...PFK.............GWIRDVRV
ENSSSCP00000004615  VLGKl.......V.........................DNP.........Qv..SVP.............FELQWMLI
ENSSSCP00000030087  ----........-.........................---.........-...---.............--------
ENSSSCP00000004918  ----........-.........................---.........-...---.............--------
ENSSSCP00000007532  ----........-.........................---.........-...---.............--------
ENSSSCP00000004775  FVGGv.......Peslltpr..................LAP.........Gr..PFT.............GCIRHFVI
ENSSSCP00000008985  YVGG........Spstadlpgs................PVS.........N...NFM.............GCL-----
ENSSSCP00000018428  KPASrwg.....C.........................HSN.........Qt..AFH.............GCMELLKV
ENSSSCP00000004775  YLGGva......Pgravknv..................QIN.........Svy.SFS.............GCLSNLQL
ENSSSCP00000008158  ----........-.........................---.........-...---.............--------
ENSSSCP00000013851  YIGG........Spntadlpgs................PVS.........N...NFM.............GCLKDVV-
ENSSSCP00000026169  ----........-.........................---.........-...---.............--------
ENSSSCP00000023415  FVAQag......R.........................ADP.........D...KFQ.............GMISELRV
ENSSSCP00000027051  VFGT........R.........................ILD.........Ee..VFE.............--------
ENSSSCP00000026077  FLGGv.......P.........................---.........-...---.............--------
ENSSSCP00000004541  YFGGlptl....R.........................NLSmkarpevnlK...KYS.............GCLKDIEI
ENSSSCP00000027650  ----........-.........................---.........-...---.............--------
ENSSSCP00000019848  FVGG........-.........................---.........-...---.............--------
ENSSSCP00000023361  ----........-.........................---.........-...---.............--------
ENSSSCP00000026213  YFG-........-.........................---.........-...---.............--------
ENSSSCP00000023132  YIGG........Apdfsrlaraa...............AVS.........S...GFD.............GAIQLVAL
ENSSSCP00000008195  ----........-.........................---.........-...---.............--------
ENSSSCP00000006241  ----........-.........................---.........-...---.............--------
ENSSSCP00000025417  FVGGv.......Pedqaavvlert..............SVS.........V...GLR.............GCIRLLDV
ENSSSCP00000016447  LLGG........D.........................SSE.........Dgh.CFR.............GHLGTLVF
ENSSSCP00000021819  YIGGv.......Pegveapvl.................KMR.........S...SFQ.............GCIQNLIF
ENSSSCP00000006241  ----........-.........................---.........-...---.............--------
ENSSSCP00000019848  VLGRil......Ehsevdqeta................LAG.........Aq..GFL.............GCLSAV--
ENSSSCP00000021829  ----........-.........................---.........-...---.............--------
ENSSSCP00000020853  VGGT........A.........................GRQ.........R...GFL.............GCMRSLQL
ENSSSCP00000013851  FVGGi.......Ppdvrlsaltlstv............KYE.........P...PFR.............GLLANL--
ENSSSCP00000016390  ----........-.........................---.........-...---.............--------
ENSSSCP00000004039  ----........-.........................---.........-...---.............--------
ENSSSCP00000014354  ----........-.........................---.........-...---.............--------
ENSSSCP00000020506  ----........-.........................---.........-...---.............--------
ENSSSCP00000001881  ----........-.........................---.........-...---.............--------
ENSSSCP00000013851  ----........-.........................---.........-...---.............--------
ENSSSCP00000016666  TLGK........-.........................---.........-...---.............--------
ENSSSCP00000005883  LFGK........M.........................SPH.........Av..QFE.............GALCQFSI
ENSSSCP00000004543  ----........-.........................---.........-...---.............--------
ENSSSCP00000003039  ----........-.........................---.........-...---.............--------
ENSSSCP00000018415  YVGS........A.........................ELK.........Rr..PFI.............GCLRAMRL
ENSSSCP00000027862  ----........-.........................---.........-...---.............--------
ENSSSCP00000004541  IGGAppefqp..P.........................PLR.........Tip.SFE.............GCIWNLVI
ENSSSCP00000018099  FLGGlvlshss.P.........................NVS.........Q...GFE.............GCLDAVVI
ENSSSCP00000012904  ----........-.........................---.........-...---.............--------
ENSSSCP00000030031  ----........-.........................---.........-...---.............--------
ENSSSCP00000004614  IIMA........R.........................ASD.........Gk..PVD.............VELHQLKI
ENSSSCP00000027678  ----........-.........................---.........-...---.............--------
ENSSSCP00000017907  YIAGhggldv..P.........................YLD.........GelpNFR.............GCMEDVVF
ENSSSCP00000027979  YLGAspsgks..K.........................SLP.........Qn..SFV.............GCLRNFQL
ENSSSCP00000004016  YLGAspsgks..K.........................SLP.........Qn..SFV.............GCLRNFQL
ENSSSCP00000003680  QGGD........L.........................HMT.........Q...FFR.............GNLAGLTI
ENSSSCP00000001127  ----........-.........................---.........-...---.............--------
ENSSSCP00000006241  ----........-.........................---.........-...---.............--------
ENSSSCP00000001629  QIGK........Y.........................SGK.........Ee..TVQ.............FDVQKLRI
ENSSSCP00000005988  VLGQdq......Dslgggf...................SAR.........D...AFS.............GNLTDFHL
ENSSSCP00000024916  VLGQdq......Dslgggf...................SAR.........D...AFS.............GNLTDFHL
ENSSSCP00000021132  ----........-.........................---.........-...---.............--------
ENSSSCP00000017907  FVGGl.......Gnhkgeevkrlqlafvprk.......SAR.........Gl..SFK.............GCIRGL--
ENSSSCP00000005893  MLGG........S.........................ALN.........H...NYR.............GYVERFSL
ENSSSCP00000029807  RIAK........G.........................GVN.........D...NFQ.............GVLQNVRF
ENSSSCP00000011596  ----........-.........................---.........-...---.............--------
ENSSSCP00000002048  LLGGl.......D.........................AEA.........Sr..PLQehrlglavnvsllGCLEDLSV
ENSSSCP00000001310  ----........-.........................---.........-...---.............--------
ENSSSCP00000028578  ----........-.........................---.........-...---.............--------
ENSSSCP00000012112  PGSE........E.........................EAP.........Q...GLV.............GCIQGVWL
ENSSSCP00000018222  ----........-.........................---.........-...---.............--------
ENSSSCP00000029355  ----........-.........................---.........-...---.............--------
ENSSSCP00000003233  ----........-.........................---.........-...---.............--------
ENSSSCP00000023342  ----........-.........................---.........-...---.............--------
ENSSSCP00000023857  VVGA........CwqeysgvendnetepepmasaggdlHMT.........Q...FFR.............GNLAGLTI
ENSSSCP00000026405  ----........-.........................---.........-...---.............--------
ENSSSCP00000023656  FLGL........D.........................AEQ.........Gk..PVS.............FDLQQAHI
ENSSSCP00000001565  ----........-.........................---.........-...---.............--------
ENSSSCP00000003907  FLGL........D.........................AEQ.........Gk..PVS.............FDLQQAHI
ENSSSCP00000012436  QGGEvtk.....P.........................RFA.........Q...FFH.............GSLASLTI
ENSSSCP00000001558  ----........-.........................---.........-...---.............--------
ENSSSCP00000004775  IGGA........Ppeilqssrtlrah............LPL.........Ei..NFR.............GCMKGFQF
ENSSSCP00000010407  VIGSe.......Q.........................DQT.........K...RYDn............GAFDEFII
ENSSSCP00000027979  ----........-.........................---.........-...---.............--------
ENSSSCP00000004016  ----........-.........................---.........-...---.............--------
ENSSSCP00000026273  HVGG........Q.........................ATD.........Ntq.GLR.............GCLSTIDI
ENSSSCP00000027979  RL--........-.........................-GG.........S...QFE.............GCISNVFV
ENSSSCP00000004016  RL--........-.........................-GG.........S...QFE.............GCISNVFV
ENSSSCP00000015120  ----........-.........................---.........-...---.............--------
ENSSSCP00000029926  ----........-.........................---.........-...---.............--------
ENSSSCP00000019261  LFGK........M.........................SPH.........Av..QFE.............GALCQFSI
ENSSSCP00000027979  SIRErf......N.........................IST.........P...AFR.............GCMKNLR-
ENSSSCP00000004016  SIRErf......N.........................IST.........P...AFR.............GCMKNLR-
ENSSSCP00000019207  ----........-.........................---.........-...---.............--------
ENSSSCP00000025417  WLGGle......Klpggqalpk................AYS.........T...GFV.............GCLRDVVV
ENSSSCP00000024968  LLGGl.......D.........................AEA.........Sr..PLQehrlglavnvsllGCLEDLSV
ENSSSCP00000001308  ----........-.........................---.........-...---.............--------
ENSSSCP00000004775  YFGGs.......P.........................ISP.........Qya.NFT.............GCISNAYF
ENSSSCP00000025895  LLGGl.......D.........................AEA.........Sr..PLQehrlglavnvsllGCLEDLSV
ENSSSCP00000022922  LLGGl.......D.........................AEA.........Sr..PLQehrlglavnvsllGCLEDLSV
ENSSSCP00000002048  FLGGt.......Gsldlpylr.................GAS.........R...PLR.............GCLHTATL
ENSSSCP00000000712  MIGA........CwaeeknkekekggdnstdatpgdplPIH.........H...YFH.............GYLAGFSV
ENSSSCP00000022455  ----........-.........................---.........-...---.............--------
ENSSSCP00000001310  ----........-.........................---.........-...---.............--------
ENSSSCP00000028578  ----........-.........................---.........-...---.............--------
ENSSSCP00000016392  FSGK........P.........................SSS.........Srk.NFK.............GCMESIN-
ENSSSCP00000008559  ----........-.........................---.........-...---.............--------
ENSSSCP00000021819  FVGGlggqikksP.........................AVK.........Vt..HFK.............GCMGEAFL
ENSSSCP00000003203  -FGR........P.........................WQS.........G...DVV.............GCM-----
ENSSSCP00000010021  ----........-.........................---.........-...---.............--------
ENSSSCP00000010815  ----........-.........................---.........-...---.............--------
ENSSSCP00000020574  ----........-.........................---.........-...---.............--------
ENSSSCP00000016666  DLGG........T.........................SSR.........Qk..GFL.............GCIRSLHL
ENSSSCP00000022958  ----........-.........................---.........-...---.............--------
ENSSSCP00000005978  FPADa.......Q.........................PWG.........G...PFR.............GCIQDLRL
ENSSSCP00000017851  ----........-.........................---.........-...---.............--------
ENSSSCP00000021247  ----........-.........................---.........-...---.............--------
ENSSSCP00000012777  ----........-.........................PVN.........A...FYN.............GCM-----
ENSSSCP00000006241  ----........-.........................---.........-...---.............--------
ENSSSCP00000028807  LRGHv.......P.........................SDS.........D...RFQ.............VDLQ----
ENSSSCP00000013885  ----........-.........................---.........-...---.............--------
ENSSSCP00000025417  YIGG........-.........................---.........-...---.............--------
ENSSSCP00000004775  ----........-.........................---.........-...---.............--------
ENSSSCP00000024968  LRGA........-.........................--S.........R...PLR.............GCLHTATL
ENSSSCP00000000277  ----........-.........................---.........-...---.............--I-----
ENSSSCP00000027978  ----........-.........................---.........-...---.............--------
ENSSSCP00000005978  LRGPgaar....V.........................LLA.........E...NFT.............GCLGRVAL
ENSSSCP00000014530  VLGTq.......D.........................LEE.........E...TFE.............GDIQELLI
ENSSSCP00000023947  ----........-.........................---.........-...---.............--------
ENSSSCP00000025895  LRGA........-.........................--S.........R...PLR.............GCLHTATL
ENSSSCP00000022922  LRGA........-.........................--S.........R...PLR.............GCLHTATL
ENSSSCP00000005978  PAGFcs......S.........................QLG.........Gg..AFA.............GCLQDVHV
ENSSSCP00000026588  ----........-.........................---.........-...---.............--------
ENSSSCP00000001308  ----........-.........................---.........-...---.............--------
ENSSSCP00000000277  ----........-.........................---.........-...---.............--------
ENSSSCP00000004471  LLGS........N.........................QNE.........Ia..SLK.............GDIYNFRL
ENSSSCP00000004541  FVGGltgklkkaD.........................AVR.........Vi..TFT.............GCMGETYF
ENSSSCP00000020853  ----........-.........................---.........-...---.............--------
ENSSSCP00000006241  ----........-.........................---.........-...---.............--------
ENSSSCP00000026906  ----........-.........................---.........-...---.............--------
ENSSSCP00000016389  ----........-.........................---.........-...---.............--------
ENSSSCP00000006954  ----........-.........................---.........-...---.............--------
ENSSSCP00000015012  ----........-.........................---.........-...---.............--------
ENSSSCP00000016392  ----........-.........................---.........-...---.............--------
ENSSSCP00000027979  ----........-.........................---.........-...---.............--------
ENSSSCP00000004016  ----........-.........................---.........-...---.............--------
ENSSSCP00000020473  FLGK........Vietgkidqeihk.............YNT.........P...GFT.............GCLSRVQF
ENSSSCP00000008195  ----........-.........................---.........-...---.............--------
ENSSSCP00000030974  ----........-.........................---.........-...---.............--------
ENSSSCP00000019430  VVGA........CwqeysgvendnetepepmasaggdlHMT.........Q...FFR.............GNLAGLTI
ENSSSCP00000022637  ----........-.........................---.........-...---.............--------
ENSSSCP00000014907  ----........-.........................---.........-...---.............--------
ENSSSCP00000017077  ----........-.........................---.........-...---.............--------
ENSSSCP00000010815  EWGG........N.........................GVG.........Dd..LFS.............YGFDGLHL
ENSSSCP00000009337  IIGGs.......R.........................YVA.........Gie.GF-.............--------
ENSSSCP00000019007  ----........-.........................---.........-...---.............--------
ENSSSCP00000024991  ----........-.........................---.........-...---.............--------
ENSSSCP00000009843  ----........-.........................---.........-...---.............--------
ENSSSCP00000019007  ----........-.........................---.........-...---.............--------
ENSSSCP00000023477  ----........-.........................---.........-...---.............--------
ENSSSCP00000009452  ----........-.........................---.........-...---.............--------
ENSSSCP00000003203  ----........-.........................---.........-...---.............--------
ENSSSCP00000003203  ----........-.........................---.........-...---.............--------
ENSSSCP00000022093  ----........-.........................--Q.........P...SFQ.............GCMQLIQV
ENSSSCP00000027047  ----........-.........................---.........-...---.............--------
ENSSSCP00000006952  ----........-.........................---.........-...---.............--------
ENSSSCP00000011072  ----........-.........................---.........-...---.............--------
ENSSSCP00000023964  ----........-.........................---.........-...---.............--------


                                 200                                                                
                                   |                                                                
d2erfa1               VFG.T..T.PEDIL..RN.KGCS.......................................................
ENSSSCP00000029807  ---.-..-.-----..--.----mwkqvtqsywdtnptraqgysglsvkvvnsttgpgehlrnalwhtgntpgqvrtl
ENSSSCP00000005158  ---.-..-.-----..--.----mwkqvtqsywdtnptraqgysglsvkvvnsttgpgehlrnalwhtgntpgqvrtl
ENSSSCP00000015013  ---.-..-.-----..--.----kqteqtywqatpfravaepgiqlkavksktgpgehlrnslwhtgdtsdqvrllwk
ENSSSCP00000015012  ---.-..-.-----..--.----kqteqtywqatpfravaepgiqlkavksktgpgehlrnslwhtgdtsdqvrllwk
ENSSSCP00000014796  ---.-..-.-----..--.----meqtywqanpfravaepgiqlkavksstgpgeqlrnalwhtgdtasqvrllwkdp
ENSSSCP00000006952  ---.-..-.-----..--.----kqteqtywqatpfravaqpglqlkavtsvsgpgehlrnalwhtghtpdqvrllwt
ENSSSCP00000004335  ---.-..-.-----..--.----tywedqptraygysgvslkvvnsttgtgehlrnalwhtgntegqvrtlwhdpkni
ENSSSCP00000014907  ---.-..-.-----..--.----knpktgvyeekhakrpdadlktyftdkkthlytlilnpdnsfeilvdqavvnsgn
ENSSSCP00000005280  ---.-..-.-----..--.----gvgiffdsfdndgkknnpaiviignngqiqydhqndganqalascqrdfrnkpyp
ENSSSCP00000024403  ---.-..-.-----..--.----vgifldyesgdisfynmtdgshiysfpsasfsgplrpffclwscgkkplticpi.
ENSSSCP00000001201  ---.-..-.-----..--.----vgifldyesgdisfynmtdgshiysfpsasfsgplrpffclwscgkkplticpi.
ENSSSCP00000029440  ---.-..-.-----..--.----vgifldyesgdisfynmtdgshiysfpsasfsgplrpffclwscgkkplticpi.
ENSSSCP00000001416  ---.-..-.-----..--.----rshiytftdtfteklwplfypgiragrknaapltirpp.................
ENSSSCP00000029869  ---.-..-.-----..--.----rshiytftdtfteklwplfypgiragrknaapltirpp.................
ENSSSCP00000030828  ---.-..-.-----..--.----rshiytftdtfteklwplfypgiragrknaapltirpp.................
ENSSSCP00000026179  NKG.S..L.LED--..--.----vvppinppkeiedpn........................................
ENSSSCP00000014929  ---.-..-.-----..--.----telagctadlrnrnhdtflavrysrgrltvmtdledknewknciditgvrlptgy
ENSSSCP00000029385  ---.-..-.-----..--.----gifldydagevsfynvterchtftfshatfcgpvrpyfslsysggksaapliicp
ENSSSCP00000001288  ---.-..-.-----..--.----gifldydagevsfynvterchtftfshatfcgpvrpyfslsysggksaapliicp
ENSSSCP00000024192  ---.-..-.-----..--.----flviryvkrhltimmdidgkhewrdcievpgvrlprgyyfgtssitgdlsdnhdv
ENSSSCP00000015699  ---.-..-.-----..--.----secafagpvrpffnpgfndggrnappltlcpl.......................
ENSSSCP00000001200  ---.-..-.-----..--.----geilllpqngfwtlemfgnqyralsspekivplkerlhrvgifldyeagdvsfyn
ENSSSCP00000008754  ---.-..-.-----..--.----elggctaivrnlhydtflviryvkrhltimmdidgkhewrdcievpgvrlprgyy
ENSSSCP00000015688  ---.-..-.-----..--.----pfpgrllpyfspcysiganntapltics...........................
ENSSSCP00000029029  ---.-..-.-----..--.----spetqlipkehparvcifleyeegrisfynmtdkshihtfsqgsfegplkpffrl
ENSSSCP00000014840  ---.-..-.-----..--.----yiytfnqlfsgflrpyfficdttplilppltk.......................
ENSSSCP00000021212  ---.-..-.-----..--.----gkklypvvsavwghcevtmryingldpeplplmdlcrrsir..............
ENSSSCP00000014732  ---.-..-.-----..--.----eqkmdcgggyikifpadvdqknlngksqyyimfgpdicgfdikkvhvilyfknqy
ENSSSCP00000003582  ---.-..-.-----..--.----tklptaeplrpffspgsatrdaqcflricpv........................
ENSSSCP00000005042  ---.-..-.-----..--.----giyldyeggqvsfynaktmnhiytfsstfmeklypyfcpclndggenkeplhivh
ENSSSCP00000009237  ---.-..-.-----..--.----yeagdvsfynmtdgshiftfpqntfygvlrplfrlwssds...............
ENSSSCP00000006271  ---.-..-.-----..--.----dyeagdvsfynmtdgshiftfpqntfygvlrplfrlwssds..............
ENSSSCP00000006272  ---.-..-.-----..--.----flnyeagdvsfynmtdgshiftfpqntfcgvlrplfrlwsfdsgsl.........
ENSSSCP00000009236  ---.-..-.-----..--.----gdvsfynmtdgshiftfpqntfygvlrplfrlwssdsgsl...............
ENSSSCP00000007533  ---.-..-.-----..--.----agdvsfynmtdgshiftfpqntfygvlrplfrlwssdsgsl..............
ENSSSCP00000014615  ---.-..-.-----..--.----ytlivrpdntyevkidnsqvesgsleddwdflppkkikdpda.............
ENSSSCP00000022095  ---.-..-.-----..--.----hiltfthsffgplrpffesclhdggkniaplvics....................
ENSSSCP00000027530  ---.-..-.-----..--.----hifsfsqnkfsgvlkpffrlwssdsgflticp.......................
ENSSSCP00000024940  ---.-..-.-----..--.----cdagklsffnvtdgshiftftdtfsetlcayfrprahdgskhpdplticpl....
ENSSSCP00000002077  ---.-..-.-----..--.----lvgnghnpdeplgdgasrvlgschrafrnrpnpfraritywrqrlrlslnsgltp
ENSSSCP00000023787  ---.-..-.-----..--.----lvgnghnpdeplgdgasrvlgschrafrnrpnpfraritywrqrlrlslnsgltp
ENSSSCP00000004776  ---.-..-.-----..--.----irmkagtiytfsvletripvspglchvgvfldieleeikffdvsndvliythnnl
ENSSSCP00000021310  ---.-..-.-----..--.----irmkagtiytfsvletripvspglchvgvfldieleeikffdvsndvliythnnl
ENSSSCP00000004184  ---.-..-.-----..--.----yimfgldicgfgnnkvgvilcyqgkyhennktikcrdhkdthlytliihpnatye
ENSSSCP00000003925  ---.-..-.-----..--.----vrdkldkvgvfldydqgllifynaddmswlytfrekfpgklcsyfspgqshangk
ENSSSCP00000027015  ---.-..-.-----..--.----gyaiggtylgpafrglkgrtlypavsavwgqchvrisyl................
ENSSSCP00000008227  ---.-..-.-----..--.----rigvylhyeqgeltffdadrpddlrllytfqadfqgklypildtcwhergsnslp
ENSSSCP00000005767  ---.-..-.-----..--.----dgqrsrlrlrddpdrlgvfldyeagvlafydvsggmshlhtfraafqeplypalr
ENSSSCP00000024925  ---.-..-.-----..--.----wcvewfntkisawhnnvektlpstkstrvgvllncdhgfviffavadkvhllykf
ENSSSCP00000018810  ---.-..-.-----..--.----vtgivqlsyisfqnth.......................................
ENSSSCP00000014885  ---.-..-.-----..--.----lhtysqpafpgplqpffclgapk................................
ENSSSCP00000028656  ---.-..-.-----..--.----yfpstlcpyfnpcncvvpmt...................................
ENSSSCP00000030393  ---.-..-.-----..--.----yaiglayksapkhewigknsaswalcrchntwvvrhnskevpiepaphlrrvgil
ENSSSCP00000030993  ---.-..-.-----..--.----yaiglayksapkhewigknsaswalcrchntwvvrhnskevpiepaphlrrvgil
ENSSSCP00000012889  ---.-..-.-----..--.----yaiglayksapkhewigknsaswalcrchntwvvrhnskevpiepaphlrrvgil
ENSSSCP00000029279  ---.-..-.-----..--.----yaiglayksapkhewigknsaswalcrchntwvvrhnskevpiepaphlrrvgil
ENSSSCP00000030659  ---.-..-.-----..--.----yaiglayksapkhewigknsaswalcrchntwvvrhnskevpiepaphlrrvgil
ENSSSCP00000005403  ---.-..-.-----..--.----htnrteggitkgatigvlldlnrktltffindeqqgpvafdnveglffpavslnr
ENSSSCP00000001314  ---.-..-.-----..--.----wqvevqlgegggctvgvvgeevrrkgeqglsaeegvwavilshqqcwastspgtd
ENSSSCP00000009454  ---.-..-.-----..--.----aprarsrhmegqscywtvgqrrgdyqawgpagilplelkedpcgigvyldyelgv
ENSSSCP00000001560  ---.-..-.-----..--.----iheplypyfslrgagtsltic..................................
ENSSSCP00000001564  ---.-..-.-----..--.----iheplypyfslrgagtsltic..................................
ENSSSCP00000023159  ---.-..-.-----..--.----eagtvsffnvtnygsliyrfskcsfsqnvypyfnpwncpapmtlcpp........
ENSSSCP00000028586  ---.-..-.-----..--.----iheplypyfslrgagtsltic..................................
ENSSSCP00000021328  ---.-..-.-----..--.----gkeqrdshmcfspgsevklivtfeedgfkvklpdghqltfpnrlgyshlsylsvq
ENSSSCP00000021030  ---.-..-.-----..--.----vtnygsliyrfskcsfsqnvypyfnpwncpapmtlcpp.................
ENSSSCP00000001553  ---.-..-.-----..--.----sfsgalcpyfklragdvsmtics................................
ENSSSCP00000015601  ---.-..-.-----..--.----eagtvsffnvtnygsliyrfskcsfsqnvypyfnpwncpapmtlcpp........
ENSSSCP00000001716  ---.-..-.-----..--.----wqqahvpinpsgpfqiifegvrgsgylgdiaiddvtlkkgec.............
ENSSSCP00000019609  ---.-..-.-----..--.----avtspertplscghlsrvrvalglevgavsfyaaedmrhiytfrvnfqervfplf
ENSSSCP00000022993  ---.-..-.-----..--.----avtspertplscghlsrvrvalglevgavsfyaaedmrhiytfrvnfqervfplf
ENSSSCP00000001312  ---.-..-.-----..--.----tcvlahsgftegrhtwvvsvdlahggsctvgvvsqdirrkgelrmrpeegvwavr
ENSSSCP00000029343  ---.-..-.-----..--.----tspllpyyiqrpqgwigvfldyecgiisfinvaksslicnflscsfsfplrpfiw
ENSSSCP00000015849  ---.-..-.-----..--.----sflpssfssplrpflclr.....................................
ENSSSCP00000005434  ---.-..-.-----..--.----greerqmvfpfecgkpfkiqvlvepdhfkvavndahllqynhrmrnlreisklgi
ENSSSCP00000030635  ---.-..-.-----..--.----greerqmvfpfecgkpfkiqvlvepdhfkvavndahllqynhrmrnlreisklgi
ENSSSCP00000019990  ---.-..-.-----..--.----lgnlqaplgydkfsyswrskkgtkfhqsigkhyssgygqgdvlgfyinlpedtet
ENSSSCP00000021698  ---.-..-.-----..--.----aacgiyyfevkivskgrdgymgiglsaqgvsmnrlpgwdkhsygyhgddghsfcs
ENSSSCP00000025036  ---.-..-.-----..--.----htnrteggitkgatigvlldlnrktltffindeqqgpvafdnveglffpavslnr
ENSSSCP00000018810  ---.-..-.-----..--.----erglprkmpfsrgqsflvwilceshcfkvavdgqhlfeyyhrlkhlptinslevg
ENSSSCP00000015851  ---.-..-.-----..--.----sflpssfssplrpylff......................................
ENSSSCP00000013361  ---.-..-.-----..--.----lsfydpanslhlhtfdvtfilpvcptftiwnkslmilsglpa.............
ENSSSCP00000009456  ---.-..-.-----..--.----srrigvfldcelgevsfynliersllysfsaiftgklmpyfsvgssst.......
ENSSSCP00000018791  ---.-..-.-----..--.----gqrywevdtqrcshwavgvasrgmrrdqilgrtsdswcvewngasqlsawhvvkq
ENSSSCP00000010821  ---.-..-.-----..--.----cgnsvkpradvafhfnprfkrancivcntlknekwgweeivydmpfkkeksfeiv
ENSSSCP00000000129  ---.-..-.-----..--.----safpfqpgsvvevcisfgqtdltiklpdgyefsfpnrlnleaieylaadgdfkik
ENSSSCP00000011201  NNE.-..-.-----..--.----lqdftktrmkpgvvpgc......................................
ENSSSCP00000015852  ---.-..-.-----..--.----tspllpyyiqrpqgwigvfldyecgiisfinvaksslicnflscsfsfplrpfiw
ENSSSCP00000017851  ---.-..-.-----..--.----qymrglvgcishft.........................................
ENSSSCP00000009455  ---.-..-.-----..--.----gnschigvfldyelgevsfynlydrsnlytfsaiftgklmpyfsvrpss......
ENSSSCP00000012112  DGR.-..-.-----..--.----qvdmagfvanngtmagcqak...................................
ENSSSCP00000006826  WDY.V..L.SPEEI..--.----ntvyaggtfspnvlnwralryemsgevyvkpql......................
ENSSSCP00000029570  WDY.V..L.SPEEI..--.----ntvyaggtfspnvlnwralryemsgevyvkpql......................
ENSSSCP00000018163  WDR.K..L.TPGEV..YNlATC-stkalsgnviswaeshieiyggatk..............................
ENSSSCP00000005380  ---.-..-.-----..--.----yhmygqhigvlnvylrlkgqttienplwsssgnkgqrwneahvniypitsfqlif
ENSSSCP00000000853  LVM.P..Q.-----..--.----gfiaqcpdlnrtc..........................................
ENSSSCP00000009453  ---.-..-.-----..--.----wqvegrglgelslgvckesfprnvpipptpdngcwkiqvwattpdtgvsgnschi
ENSSSCP00000008124  WDR.V..L.RAQEIi.GI.ANC-stnmagniipwvdnnvdvfggaskw..............................
ENSSSCP00000025878  ---.-..-.-----..--.----vegrglvewslgvckesfprnvpipptpdngcwriqlrattpgtgdsgnscrigv
ENSSSCP00000026387  ---.-..-.-----..--.----nllcgeepgseaalhfnprldessvvfnslehgawgreergpgipfqrgqpfdvl
ENSSSCP00000019654  WDY.V..L.SPEEI..--.----stvyaggtfspnvlnwralsyemsgevyvkpqlwp....................
ENSSSCP00000024906  NGK.-..-.-----..--.----rldltysflgsrgi.........................................
ENSSSCP00000015599  ---.-..-.-----..--.----eyeagtvsffnitnhgsliyrfsscpfsqatfpyfnpmkchipmilcs.......
ENSSSCP00000024988  ---.-..-.-----..--.----lcndswakkndmalesegifllfciqenqqcslftsspltpqyvqrplgqvgvfl
ENSSSCP00000024616  ---.-..-.-----..--.----lcndswakkndmalesegifllfciqenqqcslftsspltpqyvqrplgqvgvfl
ENSSSCP00000021918  ---.-..-.-----..--.----lcndswakkndmalesegifllfciqenqqcslftsspltpqyvqrplgqvgvfl
ENSSSCP00000009325  NSE.-..-.-----..--.----lqdfrkvpmqtgilpgc......................................
ENSSSCP00000022455  ---.-..-.-----..--.----rqymrglvgcishft........................................
ENSSSCP00000010821  ---.-..-.-----..--.----lqeswgeeernitcfpfspgmyfemiiycdvrefkvaingvhsleykhrfrelsn
ENSSSCP00000001973  ---.-..-.-----..--.----eflhnkttpdiritvspkkigilldyensklsffnvglsqhlytfscqlhqfvhp
ENSSSCP00000017851  NGK.-..-.-----..--.----rmdlrpwplgkalsgadvgecssg...............................
ENSSSCP00000022455  NGK.-..-.-----..--.----rmdlrpwplgkalsgadvgecssg...............................
ENSSSCP00000013885  ---.-..-.-----..--.----glhflhyryrlplsrvdtlgiygdilvtavg........................
ENSSSCP00000006160  VSD.H..R.AAYDY..CE.H---yspdc..................................................
ENSSSCP00000023414  ---.-..-.-----..--.----kndmalesegifllfciqenqqcslftsspltpqyvqrplgqvgvfldheaglvs
ENSSSCP00000029303  ---.-..-.-----..--.----perrpsrigiylsfadgvlsfydasdadalellfafherlpgpvypffdvcwhdk
ENSSSCP00000008285  ---.-..-.-----..--.----perrpsrigiylsfadgvlsfydasdadalellfafherlpgpvypffdvcwhdk
ENSSSCP00000024906  HS-.-..-.-----..--.----arp....................................................
ENSSSCP00000005158  VFG.T..T.PEDIL..RN.KGCS.......................................................
ENSSSCP00000029039  IPG.V..Q.AAYES..CE.Q---keldc..................................................
ENSSSCP00000018428  ---.-..-.-----..--.----n......................................................
ENSSSCP00000006832  WNR.V..L.PL---..--.----knmctscypgniltwqaltykargyvvvkpkv.......................
ENSSSCP00000006161  VSD.H..R.AAYDY..CE.H---yspdc..................................................
ENSSSCP00000018218  ---.-..-.-----..--.----gvaypelkrrklgphtdnigrgptswglciqedrtqawhngvaqrlpgvsgrllg
ENSSSCP00000018024  NNE.-..-.-----..--.----lqdfkalppqalgvspgc.....................................
ENSSSCP00000001598  IPG.V..Q.AAYES..CE.Q---keldc..................................................
ENSSSCP00000030976  IPG.V..Q.AAYES..CE.Q---keldc..................................................
ENSSSCP00000011839  ---.-..-.-----..--.----msgshvgtlrvklryqkpeeydqlvwmaighqgdhwkegrvllhkslklyqvife
ENSSSCP00000030667  ---.-..-.-----..--.----dsitssriytfhtsfpgqvlpffrllfpg..........................
ENSSSCP00000001317  ---.-..-.-----..--.----dsitssriytfhtsfpgqvlpffrllfpg..........................
ENSSSCP00000003232  ---.-..-.-----..--.----vklmqvwrdvslssv........................................
ENSSSCP00000013851  ---.-..-.-----..--.----n......................................................
ENSSSCP00000023132  GRR.P..L.-----..--.----hlledavtkpelrpcp.......................................
ENSSSCP00000016666  ---.-..-.-----..--.----yn.....................................................
ENSSSCP00000004335  VFE.N..S.VEDLL..SK.KGC-.......................................................
ENSSSCP00000019848  ---.-..-.-----..--.----lis....................................................
ENSSSCP00000010319  ---.-..-.-----..--.----rsgfwyvcrtrgvdgdhcvtsdpatsplvpaiprrlrveleceegelsfydaerh
ENSSSCP00000022089  ---.-..-.-----..--.----vrrkgrvglcpagavwavegrggrlwaltapeptllggagppprrirvdldwerg
ENSSSCP00000007459  NGQ.-..-.-----..--.----elplnnkprsyahieesvdvspgcllt............................
ENSSSCP00000001326  ---.-..-.-----..--.----dsitssriytfhtsfpgqvlpffrllfpg..........................
ENSSSCP00000001327  ---.-..-.-----..--.----svrrkgrvglcpagavwavegrggrlwaltapeptllggagppprrirvdldwer
ENSSSCP00000005851  WDY.V..L.SPQQV..--.----kslatscpeelskgnvlawpdflsgivgrvkidsk....................
ENSSSCP00000010214  ---.-..-.-----..--.----qldrglyhlnltvggipfkekdlvqpmnprldgcmrswnw...............
ENSSSCP00000025497  HPD.P..R.TPEEL..CE.----.......................................................
ENSSSCP00000030716  ---.-..-.-----..--.----msgshvgtlrvklryqkpeeydqlvwmaighqgdhwkegrvllhkslklyqvife
ENSSSCP00000029973  ---.-..-.-----..--.----msgshvgtlrvklryqkpeeydqlvwmaighqgdhwkegrvllhkslklyqvife
ENSSSCP00000004541  T--.-..-.-----..--.----eapadlerptssyhvgt......................................
ENSSSCP00000026569  ---.-..-.-----..--.----n......................................................
ENSSSCP00000000431  ---.-..-.-----..--.----tmlanekapiegigqpekvgllleyeaqklslvdvnrvavvhtlqtdfrgpvvpa
ENSSSCP00000020796  ---.-..-.-----..--.----tmlanekapiegigqpekvgllleyeaqklslvdvnrvavvhtlqtdfrgpvvpa
ENSSSCP00000012801  ---.-..-.-----..--.----tptgpggrqervgllslpleptlepvclsfwyymygenvyklsinisndqnmeki
ENSSSCP00000016666  ---.-..-.-----..--.----d......................................................
ENSSSCP00000023132  NNQ.-..-.-----..--.----rlelsawqgsatrssrvgecgdhpcvpspc.........................
ENSSSCP00000019848  ---.-..-.-----..--.----yn.....................................................
ENSSSCP00000006241  ---.-..-.-----..--.----eawatlhhpqdtsakyqllfeglrdgyhgtmalddvavrpgpc............
ENSSSCP00000020492  ---.-..-.-----..--.----dsnrdsfllvcvkednhyrlwatapttplyiqkpvgrvgmfldfhtgslsfvdva
ENSSSCP00000008085  ---.-..-.-----..--.----asivantfqggrwgqeevstvfplvlgepfemevssdaehfhvhaqehkvlqfah
ENSSSCP00000018239  ---.-..-.-----..--.----tqtvlhggyhrtlgvaldcgagclsfygvavaggvsliyrflaafleplypavmv
ENSSSCP00000021088  ---.-..-.-----..--.----tqtvlhggyhrtlgvaldcgagclsfygvavaggvsliyrflaafleplypavmv
ENSSSCP00000003894  ---.-..-.-----..--.----tfwpneyqvlfealispdrrgymglddilllsypc....................
ENSSSCP00000020352  ---.-..-.-----..--.----ikingdlqitkl...........................................
ENSSSCP00000024007  ---.-..-.-----..--.----ikingdlqitkl...........................................
ENSSSCP00000012140  ---.-..-.-----..--.----qeegvgdthnsyaydgnrvrkwnvtttnygkawaagdivsclidlddgtlsfcln
ENSSSCP00000015856  NNN.-..-.-----..--.----elplqnkr...............................................
ENSSSCP00000000096  WDH.A..L.TPAQVl.GL.ANC-tgpllgnilpwedklvevfggat................................
ENSSSCP00000022990  ---.-..-.-----..--.----gnrvrkwnvtttnygkawaagdivsclidlddgtlsfclngvslgtafenlsrgl
ENSSSCP00000009188  ---.-..-.-----..--.----dkfgfgfggtgkkshnkqfdnygeeftmhdtigcyldidkghvkfskngkdlgla
ENSSSCP00000030087  TSA.P..V.-----..--.----tafyrgcmtlevngkaldldeatykhsditahscppv..................
ENSSSCP00000012497  WDR.V..L.STEEI..KK.----tggaeschirgnvvgwg......................................
ENSSSCP00000031041  VCS.T..S.WAN--..KD.KCC-.......................................................
ENSSSCP00000004838  VCS.P..V.WTS--..RD.RCCD.......................................................
ENSSSCP00000025331  FS-.-..-.-----..--.----eal....................................................
ENSSSCP00000006405  VCS.T..S.WAN--..KD.KCC-.......................................................
ENSSSCP00000013851  DGR.S..-.-----..--.----rdlrglaeaqgavgvapfc....................................
ENSSSCP00000005821  ---.-..-.-----..--.----kvkaldvtvpekigvfcdfdggqlsfydanskqllysfktkftqpvlpgfmvwcg
ENSSSCP00000004541  TKG.-..-.-----..--.----tgkplevnfakalelrgvqpvscp...............................
ENSSSCP00000021819  SRS.-..-.-----..--.----tfdllrnsygvrkgcvlep....................................
ENSSSCP00000018415  ---.-..-.-----..--.----n......................................................
ENSSSCP00000013851  ---.-..-.-----..--.----vfn....................................................
ENSSSCP00000010214  TSA.P..V.-----..--.----tafyrgcmtlevngkaldldeatykhsditahscppv..................
ENSSSCP00000011618  GSN.P..I.TPE--..--.----sissgwslnvkagcvrkdwceshpc..............................
ENSSSCP00000008984  ---.-..-.-----..--.----n......................................................
ENSSSCP00000004615  HCD.P..L.RP---..--.----s......................................................
ENSSSCP00000030087  ---.-..-.-----..--.----ldrglyhlnltvggipfkekdlvqpmnprldgcmrswnw................
ENSSSCP00000004918  ---.-..-.-----..--.----vldmeartisfgkngeepklafedvdaaelypcvmfyssnpgekvkicdmqmrgt
ENSSSCP00000007532  ---.-..-.-----..--.----fygvlrplfrlwssdsgsln...................................
ENSSSCP00000004775  DGR.P..V.-----..--.----sfskaalvsgavsinscpa....................................
ENSSSCP00000008985  ---.-..-.-----..--.----k......................................................
ENSSSCP00000018428  ---.-..-.-----..--.----d......................................................
ENSSSCP00000004775  NGA.S..-.-----..--.----issasqt................................................
ENSSSCP00000008158  ---.-..-.-----..--.----vsnlrpffwlsplaslfi.....................................
ENSSSCP00000013851  ---.-..-.-----..--.----yknndfkl...............................................
ENSSSCP00000026169  ---.-..-.-----..--.----vsnlrpffwlsplaslfi.....................................
ENSSSCP00000023415  RGD.P..Q.VSPLQ..C-.----r......................................................
ENSSSCP00000027051  ---.-..-.-----..--.----.......................................................
ENSSSCP00000026077  ---.-..-.-----..--.----adirpsaltldgvqampgfkglildlk............................
ENSSSCP00000004541  SRT.P..-.-----..--.----ynilsspdyvgvtkgcsle....................................
ENSSSCP00000027650  ---.-..-.-----..--.----dkfaendvigcfvdfecgndvelsftkngkwmgiafriqkealggqalyphvlvk
ENSSSCP00000019848  ---.-..-.-----..--.----ta.....................................................
ENSSSCP00000023361  ---.-..-.-----..--.----eagtvsffnitnhgsliyrfsscpfsqatfpyfnpmkchipmilcs.........
ENSSSCP00000026213  ---.-..-.-----..--.----.......................................................
ENSSSCP00000023132  NGR.Q..L.LT---..--.----rehv...................................................
ENSSSCP00000008195  ---.-..-.-----..--.----frlvsrpfcapavicvtftyhmyglgqgtklrlllgspagsppsslwervgpqsp
ENSSSCP00000006241  ---.-..-.-----..--.----fpehfykgelrvllssaqgqlavwgtgghlrhqwlegrvqvasaeefqivfeatl
ENSSSCP00000025417  NN-.-..-.-----..--.----qrlelsawq..............................................
ENSSSCP00000016447  WST.A..R.-----..--.----pqshlq.................................................
ENSSSCP00000021819  N--.-..-.-----..--.----melldftgaigyehvdldscsps................................
ENSSSCP00000006241  ---.-..-.-----..--.----rpgwqellvttgrirgdfrvtfsatrnathrgavalddmafgr............
ENSSSCP00000019848  ---.-..-.-----..--.----ql.....................................................
ENSSSCP00000021829  ---.-..-.-----..--.----kaelaistfwphfyqvifesvslkghpgyiavdevrvlahpc.............
ENSSSCP00000020853  NG-.-..-.-----..--.----laldleeratmtpgvepgcpghcss..............................
ENSSSCP00000013851  ---.-..-.-----..--.----k......................................................
ENSSSCP00000016390  ---.-..-.-----..--.----elysqlfvg..............................................
ENSSSCP00000004039  ---.-..-.-----..--.----reysgdnvngililveeikdiplgswqlyhvtlkvtnkfrvvfrgvrgagdslgg
ENSSSCP00000014354  ---.-..-.-----..--.----khankakvldapvpdclgvhcdfhqglltfynartkqllhtfkakftqpllpaft
ENSSSCP00000020506  ---.-..-.-----..--.----klvkmktfqgdfdqnwkiahvplreekkfrylfqgtkgdpqnsnggiylddvtlt
ENSSSCP00000001881  ---.-..-.-----..--.----klvkmktfqgdfdqnwkiahvplreekkfrylfqgtkgdpqnsnggiylddvtlt
ENSSSCP00000013851  ---.-..-.-----..--.----nfdnerlaiarqripyrlgrvvdewlldkgrqltifnsqaaikiggrdqgrpfqg
ENSSSCP00000016666  ---.-..-.-----..--.----vtetlgldaevakanilgfigclasvqyn..........................
ENSSSCP00000005883  YPV.T..R.VAHNY..CT.----hlrkqc.................................................
ENSSSCP00000004543  ---.-..-.-----..--.----gftgrdwlraelavstfwpneyqvifeaevsggrsgyiaiddiqvlsypc.....
ENSSSCP00000003039  ---.-..-.-----..--.----eyscaydgcrqliwynarskphlhpcwkegdtvgflldlnekqmifflngnqlpp
ENSSSCP00000018415  NG-.-..-.-----..--.----vtlnlegranasegtspnctg..................................
ENSSSCP00000027862  ---.-..-.-----..--.----ctevsllrvgwsvdfshpqlgedefsygfdgrglkaengqfeefgqtfgendvig
ENSSSCP00000004541  NSV.-..-.-----..--.----pmdfaqpvsfknadigrcah...................................
ENSSSCP00000018099  NGE.A..-.-----..--.----lellahgkkaagllerraltpcc................................
ENSSSCP00000012904  ---.-..-.-----..--.----kvgklrvfvknsnsalawektrsaderwkmgkiqlyrgvgtpksiifeaergkgr
ENSSSCP00000030031  ---.-..-.-----..--.----kvgklrvfvknsnsalawektrsaderwkmgkiqlyrgvgtpksiifeaergkgr
ENSSSCP00000004614  YCD.L..-.-----..--.----nfiaqetcc..............................................
ENSSSCP00000027678  ---.-..-.-----..--.----teepllwrrrgeqsiswlkalieyscerqhqiifeairgvsirsdiaiddikfqa
ENSSSCP00000017907  NQR.-..-.-----..--.----ei.....................................................
ENSSSCP00000027979  DLK.P..L.-----..--.----etpsaslgvspc...........................................
ENSSSCP00000004016  DLK.P..L.-----..--.----etpsaslgvspc...........................................
ENSSSCP00000003680  RSG.K..L.ADKKVidCL.YTC-.......................................................
ENSSSCP00000001127  ---.-..-.-----..--.----cfytknghslgiaftdlppnlyptvglqtpgevvdanfgqhpfvfdiedymrewr
ENSSSCP00000006241  ---.-..-.-----..--.----lslrnpgtlrvhveeakrrqvlsisthggfawrlgsvdvqaerawrvvfeavaag
ENSSSCP00000001629  YCD.P..E.QNN--..RE.TAC-.......................................................
ENSSSCP00000005988  WAR.T..L.SPVQLn.RA.RSC-applggllfrwdl..........................................
ENSSSCP00000024916  WAR.T..L.SPVQLn.RA.RSC-applggllfrwdl..........................................
ENSSSCP00000021132  ---.-..-.-----..--.----geitwfvnts.............................................
ENSSSCP00000017907  ---.-..-.-----..--.----eanskkralkdallskdiaagc.................................
ENSSSCP00000005893  WKV.A..R.TQQEV..--.----lldme..................................................
ENSSSCP00000029807  VFG.T..T.PEDIL..RN.KGCS.......................................................
ENSSSCP00000011596  ---.-..-.-----..--.----slttsgmllgeeefsygyslkgiktcncetedygekfdendvitcfanfesdeve
ENSSSCP00000002048  N--.-..-.-----..--.----gqrwglrdalltrsmaagc....................................
ENSSSCP00000001310  ---.-..-.-----..--.----aldyeggtvtftnaesqeliytfkatftrrllpflwlrwpg..............
ENSSSCP00000028578  ---.-..-.-----..--.----aldyeggtvtftnaesqeliytfkatftrrllpflwlrwpg..............
ENSSSCP00000012112  GST.P..L.-----..--.----gspallppshrvnvepgcvvtna................................
ENSSSCP00000018222  ---.-..-.-----..--.----vwfhgleaalphpfsptvgicleyadralafyavqdgkmsllrrlk.........
ENSSSCP00000029355  ---.-..-.-----..--.----vwfhgleaalphpfsptvgicleyadralafyavqdgkmsllrrlk.........
ENSSSCP00000003233  ---.-..-.-----..--.----qplelrilvldseyqvlvnnrptysfghylppqsvkmmqlkgdv...........
ENSSSCP00000023342  ---.-..-.-----..--.----lqsinfiggqp............................................
ENSSSCP00000023857  RSG.K..L.ADKKVidCL.YTC-.......................................................
ENSSSCP00000026405  ---.-..-.-----..--.----efikni.................................................
ENSSSCP00000023656  YCD.P..E.-----..--.----fvleegcc...............................................
ENSSSCP00000001565  ---.-..-.-----..--.----sfysmtdgahiysfthcnffgqispyvklk.........................
ENSSSCP00000003907  YCD.P..E.-----..--.----fvleegcc...............................................
ENSSSCP00000012436  RPGrM..D.SQKVIs.CL.QAC-.......................................................
ENSSSCP00000001558  ---.-..-.-----..--.----sfysmtdgahiysfthcnffgqispyv............................
ENSSSCP00000004775  ---.-..-.-----..--.----qkkdfnlleqtetlgigygcpe.................................
ENSSSCP00000010407  WER.A..L.TPDEI..--.----amyft..................................................
ENSSSCP00000027979  ---.-..-.-----..--.----rhpfspartkehlhigdvpgnscadfpptrgcvggllkiqvnhvpipvteatqvq
ENSSSCP00000004016  ---.-..-.-----..--.----rhpfspartkehlhigdvpgnscadfpptrgcvggllkiqvnhvpipvteatqvq
ENSSSCP00000026273  S--.-..-.-----..--.----gihlsyfenvpg...........................................
ENSSSCP00000027979  RRL.-..-.-----..--.----mespkvldlaskstkrdvslggcs...............................
ENSSSCP00000004016  RRL.-..-.-----..--.----mespkvldlaskstkrdvslggcs...............................
ENSSSCP00000015120  ---.-..-.-----..--.----avspryeqdsghdsgsedacfdssqpftlvtigmkkffipksptssnepenrvlp
ENSSSCP00000029926  ---.-..-.-----..--.----avspryeqdsghdsgsedacfdssqpftlvtigmkkffipksptssnepenrvlp
ENSSSCP00000019261  YPV.T..R.VAHNY..CT.----hlrkqc.................................................
ENSSSCP00000027979  ---.-..-.-----..--.----ktsgvvrlndtvgvtkrc.....................................
ENSSSCP00000004016  ---.-..-.-----..--.----ktsgvvrlndtvgvtkrc.....................................
ENSSSCP00000019207  ---.-..-.-----..--.----ldmeartisfgkngeepklafedvdaaelypcvmfyssnpgekvkicdmqmrgtp
ENSSSCP00000025417  GRR.P..L.-----..--.----hlledavtkpelrpc........................................
ENSSSCP00000024968  N--.-..-.-----..--.----gqrwglrdallt...........................................
ENSSSCP00000001308  ---.-..-.-----..--.----narthefiyefsssfsgrifpflwlncmr..........................
ENSSSCP00000004775  ---.-..-.-----..--.----tsykhrldrdv............................................
ENSSSCP00000025895  N--.-..-.-----..--.----gqrwglrdallt...........................................
ENSSSCP00000022922  N--.-..-.-----..--.----gqrwglrdallt...........................................
ENSSSCP00000002048  NGR.-..-.-----..--.----sl.....................................................
ENSSSCP00000000712  RSG.R..LeSREVIe.CL.YAC-.......................................................
ENSSSCP00000022455  ---.-..-.-----..--.----gvlrsqtaitlgkdhnikkisqtaksglllliwhnhqlvtesqkdgiftflsvnn
ENSSSCP00000001310  ---.-..-.-----..--.----wkcvtysglyqssylhpqqfecepgvlgskgftwgkvywevevereg........
ENSSSCP00000028578  ---.-..-.-----..--.----wkcvtysglyqssylhpqqfecepgvlgskgftwgkvywevevereg........
ENSSSCP00000016392  ---.-..-.-----..--.----ynginitdlarrkklepsnvgnlsfsc............................
ENSSSCP00000008559  ---.-..-.-----..--.----hteyscgtaairgtkelaegqhfweikmtspvygtdmmvgigtsdg.........
ENSSSCP00000021819  NGQ.SigL.WNYME..RE.GKC-hgcfgs.................................................
ENSSSCP00000003203  ---.-..-.-----..--.----idltentiiftlngevlmsdsgsetafrdievgdgflpvcslgpgqvghlnlgqd
ENSSSCP00000010021  ---.-..-.-----..--.----knrlpanslpqegdvvgitydhvelnvylngknmhcpasgirgtvypvvyvddsa
ENSSSCP00000010815  ---.-..-.-----..--.----hqgnehygrswqagdvvgcmvdmtehtmmftlngeillddsgselafkdfdvgdg
ENSSSCP00000020574  ---.-..-.-----..--.----ptqdfggldvltislggip....................................
ENSSSCP00000016666  NGQ.-..-.-----..--.----kldleerakvtsgvrpgcpghcss...............................
ENSSSCP00000022958  ---.-..-.-----..--.----aetlahvhtfsaaflgervfpffrvlskgtrik......................
ENSSSCP00000005978  NG-.-..-.-----..--.----lhlpffppl..............................................
ENSSSCP00000017851  ---.-..-.-----..--.----sqhsvelptweslkkis......................................
ENSSSCP00000021247  ---.-..-.-----..--.----arlisppvhlprspvcmefqyqatggrgvalqvvreasqeskllwviredqgsew
ENSSSCP00000012777  ---.-..-.-----..--.----dviingvpldldeaiakhndirahscpsv..........................
ENSSSCP00000006241  ---.-..-.-----..--.----lgaawvrdrvdiqsgrpfrillaaqtgpggvvglddlilsdhc............
ENSSSCP00000028807  ---.-..-.-----..--.----cgnsvkpradvafhfnprfkranciv.............................
ENSSSCP00000013885  ---.-..-.-----..--.----erlrelhisgsiqlycvhy....................................
ENSSSCP00000025417  ---.-..-.-----..--.----apdfsrlara.............................................
ENSSSCP00000004775  ---.-..-.-----..--.----ldskpvsswpahfsivkiervgkhgkvfltvpslsstaeekfikkgefagddsll
ENSSSCP00000024968  NGR.-..-.-----..--.----sl.....................................................
ENSSSCP00000000277  ---.-..-.-----..--.----mgcgimfprdyildsegdsddscdtvilsptaravrnvrnvmylhqegeeeeeee
ENSSSCP00000027978  ---.-..-.-----..--.----lihdnglihpprrepalmigac.................................
ENSSSCP00000005978  ---.-..-.-----..--.----gglplplarp.............................................
ENSSSCP00000014530  STD.P..Q.AAFQA..CE.Q---ylpgc..................................................
ENSSSCP00000023947  ---.-..-.-----..--.----advksvifkgekrrghtgeialddvslrkghct......................
ENSSSCP00000025895  NGR.-..-.-----..--.----sl.....................................................
ENSSSCP00000022922  NGR.-..-.-----..--.----sl.....................................................
ENSSSCP00000005978  DGH.L..L.LP---..--.----ed.....................................................
ENSSSCP00000026588  ---.-..-.-----..--.----rfyyaiygflkmsdtlavyifeenhmvqekiwsvlesprgvwmqaeitfkkpmst
ENSSSCP00000001308  ---.-..-.-----..--.----nkyqhgqrfdpepgvlgskgftwgkvywevkvdriw...................
ENSSSCP00000000277  ---.-..-.-----..--.----sfdvqtaqifftkngkrvgstimpmspdglfpavgmhslgeevrlhl........
ENSSSCP00000004471  WNF.T..M.NSKTL..SN.LSC-nvkgnvvdwqndfwnip......................................
ENSSSCP00000004541  DSK.P..-.-----..--.----iglwnfrevegdckgc.......................................
ENSSSCP00000020853  ---.-..-.-----..--.----tqvnisvhmnklvlqfilkdd..................................
ENSSSCP00000006241  ---.-..-.-----..--.----hlayyfqsqpqgflelvvvegsrrelvwqapvhspvgwkmdtillgarhrpfrpp
ENSSSCP00000026906  ---.-..-.-----..--.----lyf....................................................
ENSSSCP00000016389  ---.-..-.-----..--.----sicylsivhdivmqslssvilg.................................
ENSSSCP00000006954  ---.-..-.-----..--.----mgkillgagassnagltgrdgpatsctvplpprlgicldyergrvsfldavsfrg
ENSSSCP00000015012  ---.-..-.-----..--.----ih.....................................................
ENSSSCP00000016392  ---.-..-.-----..--.----eskvgvhinitqt..........................................
ENSSSCP00000027979  ---.-..-.-----..--.----lgeqeaelqvdqtltksetqeavmdrvkfqriyqfarlnytqkatsskpeapqlh
ENSSSCP00000004016  ---.-..-.-----..--.----lgeqeaelqvdqtltksetqeavmdrvkfqriyqfarlnytqkatsskpeapqlh
ENSSSCP00000020473  ---.-..-.-----..--.----n......................................................
ENSSSCP00000008195  ---.-..-.-----..--.----khtlfsgqpgpswqpvsvnytsqgqiqftlvgvfgkipepavavdaisiapc...
ENSSSCP00000030974  ---.-..-.-----..--.----kmgkiqlyrgvgtpksiifeaergkgrtgeialdgvlllsgfc............
ENSSSCP00000019430  RSG.K..L.ADKKVidCL.YTC-.......................................................
ENSSSCP00000022637  ---.-..-.-----..--.----yptgnt.................................................
ENSSSCP00000014907  ---.-..-.-----..--.----icgdrrvvddwandgwg......................................
ENSSSCP00000017077  ---.-..-.-----..--.----pamnepfisccigsagqrt....................................
ENSSSCP00000010815  WSG.C..I.A----..--.----rtvsspnqhllrtddvisccldlsapsisfringqpvqgmfenfnidglffpvvs
ENSSSCP00000009337  ---.-..-.-----..--.----fgplkyyrlhalhpaq.......................................
ENSSSCP00000019007  ---.-..-.-----..--.----vrredgtlhffvngmtqgpaawnvppgvyavvdlygqaaqativ...........
ENSSSCP00000024991  ---.-..-.-----..--.----ekyffg.................................................
ENSSSCP00000009843  ---.-..-.-----..--.----vhstpggsgsanppvvstvyaymg...............................
ENSSSCP00000019007  ---.-..-.-----..--.----vgvertvagelrlwvngrdcgvaatglparvwavvdlygkctqitvlppepgf..
ENSSSCP00000023477  ---.-..-.-----..--.----pglgdflqlhivstrl.......................................
ENSSSCP00000009452  ---.-..-.-----..--.----pptpdngcwkiqvwa........................................
ENSSSCP00000003203  ---.-..-.-----..--.----sccldlsvpsisfringcpvqgvfeafnlnglffpvvsfsagvkvrfllggrhge
ENSSSCP00000003203  ---.-..-.-----..--.----dlvigclvdlatglmtftangkesntffqvepntklfpavfvlpt..........
ENSSSCP00000022093  DDQ.-..-.-----..--.----lvnlyevaqrrpgsfanvsidmcai..............................
ENSSSCP00000027047  ---.-..-.-----..--.----kvenalikpinprldgcirgwnl................................
ENSSSCP00000006952  ---.-..-.-----..--.----gdqh...................................................
ENSSSCP00000011072  ---.-..-.-----..--.----kmlyiqvlp..............................................
ENSSSCP00000023964  ---.-..-.-----..--.----kmlyiqvlp..............................................


                                                                                                    
                                                                                                    
d2erfa1               ..............................................................................
ENSSSCP00000029807  whdprhigwkdftayrwrlshrpktgfirvvmyegkkimadsgpiydktyaggrlglfvfsqemvffsdlkyecrd..
ENSSSCP00000005158  whdprhigwkdftayrwrlshrpktgfirvvmyegkkimadsgpiydktyaggrlglfvfsqemvffsdlkyecrd..
ENSSSCP00000015013  dsrnvgwkdkvsyrwflqhrpqvgyirvrfyegselvadsgvtidttmrggrlgvfcfsqeniiwsnlkyrcndt...
ENSSSCP00000015012  dsrnvgwkdkvsyrwflqhrpqvgyirvrfyegselvadsgvtidttmrggrlgvfcfsqeniiwsnlkyrcndt...
ENSSSCP00000014796  rnvgwkdktsyrwflqhrpqvgyirvrfyegpelvadsnvvldttmrggrlgvfcfsqeniiwanlryrcndt.....
ENSSSCP00000006952  dprnvgwrdktsyrwqllhrpqvgyirvklyegpqlvadsgaiidtsmrggrlgvfcfsqeniiwsnlqyrcndt...
ENSSSCP00000004335  gwkdytayrwhlthrpktgyirvlvhegkqvmadsgpiydqtyaggrlglfvfsqemvyfsdlkyecrd.........
ENSSSCP00000014907  llndmtppv.....................................................................
ENSSSCP00000005280  irakiiyyqktltvmihngftpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqlte.........
ENSSSCP00000024403  ..............................................................................
ENSSSCP00000001201  ..............................................................................
ENSSSCP00000029440  ..............................................................................
ENSSSCP00000001416  ..............................................................................
ENSSSCP00000029869  ..............................................................................
ENSSSCP00000030828  ..............................................................................
ENSSSCP00000026179  ..............................................................................
ENSSSCP00000014929  yfgasagtgdlsdnhdiismklfql.....................................................
ENSSSCP00000029385  m.............................................................................
ENSSSCP00000001288  m.............................................................................
ENSSSCP00000024192  islklfel......................................................................
ENSSSCP00000015699  ..............................................................................
ENSSSCP00000001200  mrdrshiytcprspfseplrpflrlgsddsplficp..........................................
ENSSSCP00000008754  fgtssitgdlsgt.................................................................
ENSSSCP00000015688  ..............................................................................
ENSSSCP00000029029  wpsdsaclticpv.................................................................
ENSSSCP00000014840  ..............................................................................
ENSSSCP00000021212  ..............................................................................
ENSSSCP00000014732  hsnkksirckvdgfthlytlilrpdltyevkidgqsiesgsieydwqltslkkmemasaeskdwdqatekpqdwekhf
ENSSSCP00000003582  ..............................................................................
ENSSSCP00000005042  ..............................................................................
ENSSSCP00000009237  ..............................................................................
ENSSSCP00000006271  ..............................................................................
ENSSSCP00000006272  ..............................................................................
ENSSSCP00000009236  ..............................................................................
ENSSSCP00000007533  ..............................................................................
ENSSSCP00000014615  ..............................................................................
ENSSSCP00000022095  ..............................................................................
ENSSSCP00000027530  ..............................................................................
ENSSSCP00000024940  ..............................................................................
ENSSSCP00000002077  sdpdelcvdvgplllapggffgvlaatstladdhdvlsfltfslse................................
ENSSSCP00000023787  sdpdelcvdvgplllapggffgvlaatstladdhdvlsfltfslse................................
ENSSSCP00000004776  scleplcpffslelpregekgaslkicp..................................................
ENSSSCP00000021310  scleplcpffslelpregekgaslkicp..................................................
ENSSSCP00000004184  vkidnqqvaagdleddwaflpprkikdpyaqkp.............................................
ENSSSCP00000003925  nvqplrin......................................................................
ENSSSCP00000027015  ..............................................................................
ENSSSCP00000008227  m.............................................................................
ENSSSCP00000005767  lwega.........................................................................
ENSSSCP00000024925  kvafaealypafwvfsagatlsics.....................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000014885  ..............................................................................
ENSSSCP00000028656  ..............................................................................
ENSSSCP00000030393  ldydngsvafydalnslhlytfdvtfsqpvcptftvwnkcltiitglpipd...........................
ENSSSCP00000030993  ldydngsvafydalnslhlytfdvtfsqpvcptftvwnkcltiitglpipd...........................
ENSSSCP00000012889  ldydngsvafydalnslhlytfdvtfsqpvcptftvwnkcltiitglpipd...........................
ENSSSCP00000029279  ldydngsvafydalnslhlytfdvtfsqpvcptftvwnkcltiitglpipd...........................
ENSSSCP00000030659  ldydngsvafydalnslhlytfdvtfsqpvcptftvwnkcltiitglpipd...........................
ENSSSCP00000005403  nvqvtlhtglpvpd................................................................
ENSSSCP00000001314  lplseiprrvgvaldyeagrvallnaetrapiftfaasfsgkvfpffavwkkgs........................
ENSSSCP00000009454  isfynlkdrshihsftdsfsgvlkpyfcvgcds.............................................
ENSSSCP00000001560  ..............................................................................
ENSSSCP00000001564  ..............................................................................
ENSSSCP00000023159  ..............................................................................
ENSSSCP00000028586  ..............................................................................
ENSSSCP00000021328  ggfsitsfkl....................................................................
ENSSSCP00000021030  ..............................................................................
ENSSSCP00000001553  ..............................................................................
ENSSSCP00000015601  ..............................................................................
ENSSSCP00000001716  ..............................................................................
ENSSSCP00000019609  svcstgtylr....................................................................
ENSSSCP00000022993  svcstgtylr....................................................................
ENSSSCP00000001312  lawgfvsalgsfptrlaleehprqvrvsidyevgwvtfvnavtqepiytftasftqkvfpffglwgrg..........
ENSSSCP00000029343  rg............................................................................
ENSSSCP00000015849  ..............................................................................
ENSSSCP00000005434  sgditltsas....................................................................
ENSSSCP00000030635  sgditltsas....................................................................
ENSSSCP00000019990  akslpdtykdkalikfksylyfeekdfvdkaekslkqtphseiifykngvnqgvaykdifegvyfpaislyksctvsi
ENSSSCP00000021698  sgtgqpygptfttgdvigccvnlingtcfytknghslgvaftdlpanlyptvglqtpgeivdanfgqqpflfdiedym
ENSSSCP00000025036  nvqvtlhtglpvpd................................................................
ENSSSCP00000018810  gdiqlthvq.....................................................................
ENSSSCP00000015851  ..............................................................................
ENSSSCP00000013361  ..............................................................................
ENSSSCP00000009456  ..............................................................................
ENSSSCP00000018791  tvlgsdrpgvvgiwldfekeklafysvadqekllyeypvsasfalypafwlygly.......................
ENSSSCP00000010821  imvlktifqvavngkhtllyshrispekintlgiygkviihslgf.................................
ENSSSCP00000000129  cvaf..........................................................................
ENSSSCP00000011201  ..............................................................................
ENSSSCP00000015852  rg............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000009455  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000006826  ..............................................................................
ENSSSCP00000029570  ..............................................................................
ENSSSCP00000018163  ..............................................................................
ENSSSCP00000005380  egirgpgiegdiaiddisiaegec......................................................
ENSSSCP00000000853  ..............................................................................
ENSSSCP00000009453  gvfldyelgevsfynlydrsnlytfsaiftgklmpyf.........................................
ENSSSCP00000008124  ..............................................................................
ENSSSCP00000025878  fldyelgevsfydlykrsplylysaiftgklmpyfsvgssst....................................
ENSSSCP00000026387  littdegfkvvvgdleyhhfrhrmpptrvravevggdlqlelvk..................................
ENSSSCP00000019654  ..............................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000015599  ..............................................................................
ENSSSCP00000024988  dyeaglvsfidvatsslicsflscsfssalkaflcsg.........................................
ENSSSCP00000024616  dyeaglvsfidvatsslicsflscsfssalkaflcsg.........................................
ENSSSCP00000021918  dyeaglvsfidvatsslicsflscsfssalkaflcsg.........................................
ENSSSCP00000009325  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000010821  idtleidgdihllevr..............................................................
ENSSSCP00000001973  cfslekpgclkihngismp...........................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000006160  ..............................................................................
ENSSSCP00000023414  fidvatsslicsflscsfssslkaflcsg.................................................
ENSSSCP00000029303  gknaqplllv....................................................................
ENSSSCP00000008285  gknaqplllv....................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000029039  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000006832  ..............................................................................
ENSSSCP00000006161  ..............................................................................
ENSSSCP00000018218  mdldlasgclsfyslepktqllhtfhaiftrplypifwllegrtltlc..............................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000001598  ..............................................................................
ENSSSCP00000030976  ..............................................................................
ENSSSCP00000011839  geigkgslggiavddisisnh.........................................................
ENSSSCP00000030667  ..............................................................................
ENSSSCP00000001317  ..............................................................................
ENSSSCP00000003232  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000010319  chlytfharfgevrpyfyvggsrgdgppeplricpl..........................................
ENSSSCP00000022089  rvafydghsldllfafqgpgplgervfpllctrdpraplrivp...................................
ENSSSCP00000007459  ..............................................................................
ENSSSCP00000001326  ..............................................................................
ENSSSCP00000001327  grvafydghsldllfafqgpgplgervfpllctrdrraplrivp..................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000025497  ..............................................................................
ENSSSCP00000030716  geigkgslggiavddisisnh.........................................................
ENSSSCP00000029973  geigkgslggiavddisisnh.........................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000026569  ..............................................................................
ENSSSCP00000000431  falwdgellthsgle...............................................................
ENSSSCP00000020796  falwdgellthsgle...............................................................
ENSSSCP00000012801  ifqkegnygenwnygqvtlnetvefkvafnafknqflsdialddisltygic..........................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000020492  rrsliwryedgvftfpvkpftctg......................................................
ENSSSCP00000008085  rhrplaaitrvqvlsdhrlaqvelarr...................................................
ENSSSCP00000018239  ssgasvtl......................................................................
ENSSSCP00000021088  ssgasvtl......................................................................
ENSSSCP00000003894  ..............................................................................
ENSSSCP00000020352  ..............................................................................
ENSSSCP00000024007  ..............................................................................
ENSSSCP00000012140  gvslgtafenlsrglgmayfpaislsfkesvafnfgsrplryplagyrplqdpp........................
ENSSSCP00000015856  ..............................................................................
ENSSSCP00000000096  ..............................................................................
ENSSSCP00000022990  gmayfpaislsfkesvafnfgsrplryplagyrplqdpp.......................................
ENSSSCP00000009188  feipphmknqalfpacvlknaelkfnfgeeefkfp...........................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000012497  ..............................................................................
ENSSSCP00000031041  ..............................................................................
ENSSSCP00000004838  ..............................................................................
ENSSSCP00000025331  ..............................................................................
ENSSSCP00000006405  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000005821  glsln.........................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000008984  ..............................................................................
ENSSSCP00000004615  ..............................................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000004918  prdllpgdpicspv................................................................
ENSSSCP00000007532  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008985  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008158  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000026169  ..............................................................................
ENSSSCP00000023415  ..............................................................................
ENSSSCP00000027051  ..............................................................................
ENSSSCP00000026077  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000027650  ncavefnfgqraep................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000023361  ..............................................................................
ENSSSCP00000026213  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000008195  ewlntsvtipsghqqpmqlifeavrgtntafvvalgfvlinhgtc.................................
ENSSSCP00000006241  ggqpalgpialddveylag...........................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000016447  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000021829  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016390  ..............................................................................
ENSSSCP00000004039  lsiddinlsetqc.................................................................
ENSSSCP00000014354  vwcgsfhvttglqvp...............................................................
ENSSSCP00000020506  etpc..........................................................................
ENSSSCP00000001881  etpc..........................................................................
ENSSSCP00000013851  qvsglyyn......................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000005883  ..............................................................................
ENSSSCP00000004543  ..............................................................................
ENSSSCP00000003039  ekqvfsstvsgffaaasfmsyqqcefnfgakpfkyp..........................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000027862  cfanfeaeevelsfskngedlgvafriskesladrallphvlckncvvelnfgqkeepf...................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000018099  ..............................................................................
ENSSSCP00000012904  tgeialdgvlllsgfc..............................................................
ENSSSCP00000030031  tgeialdgvlllsgfc..............................................................
ENSSSCP00000004614  ..............................................................................
ENSSSCP00000027678  gpc...........................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000003680  ..............................................................................
ENSSSCP00000001127  ..............................................................................
ENSSSCP00000006241  verayialddlllqdgpc............................................................
ENSSSCP00000001629  ..............................................................................
ENSSSCP00000005988  ..............................................................................
ENSSSCP00000024916  ..............................................................................
ENSSSCP00000021132  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000005893  ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000011596  lsyakngqdlgiafkiskevlaerplfphvlchncavefnfgqkekpy..............................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000018222  ..............................................................................
ENSSSCP00000029355  ..............................................................................
ENSSSCP00000003233  ..............................................................................
ENSSSCP00000023342  ..............................................................................
ENSSSCP00000023857  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000023656  ..............................................................................
ENSSSCP00000001565  ..............................................................................
ENSSSCP00000003907  ..............................................................................
ENSSSCP00000012436  ..............................................................................
ENSSSCP00000001558  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000010407  ..............................................................................
ENSSSCP00000027979  gtvslngcp.....................................................................
ENSSSCP00000004016  gtvslngcp.....................................................................
ENSSSCP00000026273  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000015120  mptsigvfldydkgkvgfydmdhmkclyerqvdcshtmypafalmgsg..............................
ENSSSCP00000029926  mptsigvfldydkgkvgfydmdhmkclyerqvdcshtmypafalmgsg..............................
ENSSSCP00000019261  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000019207  rdllpgdpicspva................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000000712  ..............................................................................
ENSSSCP00000022455  ip............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000008559  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000010021  ildcqfsefyhtpppgfe............................................................
ENSSSCP00000010815  fipvcsl.......................................................................
ENSSSCP00000020574  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000022958  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000021247  khgriilpsydmey................................................................
ENSSSCP00000012777  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000028807  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000004775  dldpedtvfyvggvpsnfklpaslnlpgfvgclelatlnndvislynfkhiynmdps.....................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000000277  eeeddgeeieqehegkkvvvfftrngkiivkkdavvpsggffptigmlscgekvkv......................
ENSSSCP00000027978  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000014530  ..............................................................................
ENSSSCP00000023947  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000026588  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000004471  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000006241  paklefvglvdldgpgqqgagvdhvtlkdc................................................
ENSSSCP00000026906  ..............................................................................
ENSSSCP00000016389  ..............................................................................
ENSSSCP00000006954  llecpldcsgpvcpafcfigggavq.....................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000027979  dvdskssntllnldpenvvfyvggypsdfrlpsrlrfppykgcielddlnenvlslynfkkt................
ENSSSCP00000004016  dvdskssntllnldpenvvfyvggypsdfrlpsrlrfppykgcielddlnenvlslynfkkt................
ENSSSCP00000020473  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000030974  ..............................................................................
ENSSSCP00000019430  ..............................................................................
ENSSSCP00000022637  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000017077  ..............................................................................
ENSSSCP00000010815  fsagikvrfllggrhgefkflpppgya...................................................
ENSSSCP00000009337  ..............................................................................
ENSSSCP00000019007  ..............................................................................
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  ..............................................................................
ENSSSCP00000019007  ..............................................................................
ENSSSCP00000023477  ..............................................................................
ENSSSCP00000009452  ..............................................................................
ENSSSCP00000003203  fkflpppgyap...................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000022093  ..............................................................................
ENSSSCP00000027047  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000011072  ..............................................................................
ENSSSCP00000023964  ..............................................................................


                                                                                                    
                                                                                                    
d2erfa1               ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000015013  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000014796  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000005280  ..............................................................................
ENSSSCP00000024403  ..............................................................................
ENSSSCP00000001201  ..............................................................................
ENSSSCP00000029440  ..............................................................................
ENSSSCP00000001416  ..............................................................................
ENSSSCP00000029869  ..............................................................................
ENSSSCP00000030828  ..............................................................................
ENSSSCP00000026179  ..............................................................................
ENSSSCP00000014929  ..............................................................................
ENSSSCP00000029385  ..............................................................................
ENSSSCP00000001288  ..............................................................................
ENSSSCP00000024192  ..............................................................................
ENSSSCP00000015699  ..............................................................................
ENSSSCP00000001200  ..............................................................................
ENSSSCP00000008754  ..............................................................................
ENSSSCP00000015688  ..............................................................................
ENSSSCP00000029029  ..............................................................................
ENSSSCP00000014840  ..............................................................................
ENSSSCP00000021212  ..............................................................................
ENSSSCP00000014732  ldagaskpsdwnseldgdwqapmlqkppyqdglkpegidkdiwlhqkmkhtnylteydlsefenigaiglelwqvrsg
ENSSSCP00000003582  ..............................................................................
ENSSSCP00000005042  ..............................................................................
ENSSSCP00000009237  ..............................................................................
ENSSSCP00000006271  ..............................................................................
ENSSSCP00000006272  ..............................................................................
ENSSSCP00000009236  ..............................................................................
ENSSSCP00000007533  ..............................................................................
ENSSSCP00000014615  ..............................................................................
ENSSSCP00000022095  ..............................................................................
ENSSSCP00000027530  ..............................................................................
ENSSSCP00000024940  ..............................................................................
ENSSSCP00000002077  ..............................................................................
ENSSSCP00000023787  ..............................................................................
ENSSSCP00000004776  ..............................................................................
ENSSSCP00000021310  ..............................................................................
ENSSSCP00000004184  ..............................................................................
ENSSSCP00000003925  ..............................................................................
ENSSSCP00000027015  ..............................................................................
ENSSSCP00000008227  ..............................................................................
ENSSSCP00000005767  ..............................................................................
ENSSSCP00000024925  ..............................................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000014885  ..............................................................................
ENSSSCP00000028656  ..............................................................................
ENSSSCP00000030393  ..............................................................................
ENSSSCP00000030993  ..............................................................................
ENSSSCP00000012889  ..............................................................................
ENSSSCP00000029279  ..............................................................................
ENSSSCP00000030659  ..............................................................................
ENSSSCP00000005403  ..............................................................................
ENSSSCP00000001314  ..............................................................................
ENSSSCP00000009454  ..............................................................................
ENSSSCP00000001560  ..............................................................................
ENSSSCP00000001564  ..............................................................................
ENSSSCP00000023159  ..............................................................................
ENSSSCP00000028586  ..............................................................................
ENSSSCP00000021328  ..............................................................................
ENSSSCP00000021030  ..............................................................................
ENSSSCP00000001553  ..............................................................................
ENSSSCP00000015601  ..............................................................................
ENSSSCP00000001716  ..............................................................................
ENSSSCP00000019609  ..............................................................................
ENSSSCP00000022993  ..............................................................................
ENSSSCP00000001312  ..............................................................................
ENSSSCP00000029343  ..............................................................................
ENSSSCP00000015849  ..............................................................................
ENSSSCP00000005434  ..............................................................................
ENSSSCP00000030635  ..............................................................................
ENSSSCP00000019990  nfgp..........................................................................
ENSSSCP00000021698  rewra.........................................................................
ENSSSCP00000025036  ..............................................................................
ENSSSCP00000018810  ..............................................................................
ENSSSCP00000015851  ..............................................................................
ENSSSCP00000013361  ..............................................................................
ENSSSCP00000009456  ..............................................................................
ENSSSCP00000018791  ..............................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000000129  ..............................................................................
ENSSSCP00000011201  ..............................................................................
ENSSSCP00000015852  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000009455  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000006826  ..............................................................................
ENSSSCP00000029570  ..............................................................................
ENSSSCP00000018163  ..............................................................................
ENSSSCP00000005380  ..............................................................................
ENSSSCP00000000853  ..............................................................................
ENSSSCP00000009453  ..............................................................................
ENSSSCP00000008124  ..............................................................................
ENSSSCP00000025878  ..............................................................................
ENSSSCP00000026387  ..............................................................................
ENSSSCP00000019654  ..............................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000015599  ..............................................................................
ENSSSCP00000024988  ..............................................................................
ENSSSCP00000024616  ..............................................................................
ENSSSCP00000021918  ..............................................................................
ENSSSCP00000009325  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000010821  ..............................................................................
ENSSSCP00000001973  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000006160  ..............................................................................
ENSSSCP00000023414  ..............................................................................
ENSSSCP00000029303  ..............................................................................
ENSSSCP00000008285  ..............................................................................
ENSSSCP00000024906  ..............................................................................
ENSSSCP00000005158  ..............................................................................
ENSSSCP00000029039  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000006832  ..............................................................................
ENSSSCP00000006161  ..............................................................................
ENSSSCP00000018218  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000001598  ..............................................................................
ENSSSCP00000030976  ..............................................................................
ENSSSCP00000011839  ..............................................................................
ENSSSCP00000030667  ..............................................................................
ENSSSCP00000001317  ..............................................................................
ENSSSCP00000003232  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000004335  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000010319  ..............................................................................
ENSSSCP00000022089  ..............................................................................
ENSSSCP00000007459  ..............................................................................
ENSSSCP00000001326  ..............................................................................
ENSSSCP00000001327  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000025497  ..............................................................................
ENSSSCP00000030716  ..............................................................................
ENSSSCP00000029973  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000026569  ..............................................................................
ENSSSCP00000000431  ..............................................................................
ENSSSCP00000020796  ..............................................................................
ENSSSCP00000012801  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000020492  ..............................................................................
ENSSSCP00000008085  ..............................................................................
ENSSSCP00000018239  ..............................................................................
ENSSSCP00000021088  ..............................................................................
ENSSSCP00000003894  ..............................................................................
ENSSSCP00000020352  ..............................................................................
ENSSSCP00000024007  ..............................................................................
ENSSSCP00000012140  ..............................................................................
ENSSSCP00000015856  ..............................................................................
ENSSSCP00000000096  ..............................................................................
ENSSSCP00000022990  ..............................................................................
ENSSSCP00000009188  ..............................................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000012497  ..............................................................................
ENSSSCP00000031041  ..............................................................................
ENSSSCP00000004838  ..............................................................................
ENSSSCP00000025331  ..............................................................................
ENSSSCP00000006405  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000005821  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000010214  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000008984  ..............................................................................
ENSSSCP00000004615  ..............................................................................
ENSSSCP00000030087  ..............................................................................
ENSSSCP00000004918  ..............................................................................
ENSSSCP00000007532  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008985  ..............................................................................
ENSSSCP00000018428  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000008158  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000026169  ..............................................................................
ENSSSCP00000023415  ..............................................................................
ENSSSCP00000027051  ..............................................................................
ENSSSCP00000026077  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000027650  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000023361  ..............................................................................
ENSSSCP00000026213  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000016447  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000019848  ..............................................................................
ENSSSCP00000021829  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016390  ..............................................................................
ENSSSCP00000004039  ..............................................................................
ENSSSCP00000014354  ..............................................................................
ENSSSCP00000020506  ..............................................................................
ENSSSCP00000001881  ..............................................................................
ENSSSCP00000013851  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000005883  ..............................................................................
ENSSSCP00000004543  ..............................................................................
ENSSSCP00000003039  ..............................................................................
ENSSSCP00000018415  ..............................................................................
ENSSSCP00000027862  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000018099  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000004614  ..............................................................................
ENSSSCP00000027678  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000003680  ..............................................................................
ENSSSCP00000001127  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000001629  ..............................................................................
ENSSSCP00000005988  ..............................................................................
ENSSSCP00000024916  ..............................................................................
ENSSSCP00000021132  ..............................................................................
ENSSSCP00000017907  ..............................................................................
ENSSSCP00000005893  ..............................................................................
ENSSSCP00000029807  ..............................................................................
ENSSSCP00000011596  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000012112  ..............................................................................
ENSSSCP00000018222  ..............................................................................
ENSSSCP00000029355  ..............................................................................
ENSSSCP00000003233  ..............................................................................
ENSSSCP00000023342  ..............................................................................
ENSSSCP00000023857  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000023656  ..............................................................................
ENSSSCP00000001565  ..............................................................................
ENSSSCP00000003907  ..............................................................................
ENSSSCP00000012436  ..............................................................................
ENSSSCP00000001558  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000010407  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000026273  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000015120  ..............................................................................
ENSSSCP00000029926  ..............................................................................
ENSSSCP00000019261  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000019207  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000002048  ..............................................................................
ENSSSCP00000000712  ..............................................................................
ENSSSCP00000022455  ..............................................................................
ENSSSCP00000001310  ..............................................................................
ENSSSCP00000028578  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000008559  ..............................................................................
ENSSSCP00000021819  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000010021  ..............................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000020574  ..............................................................................
ENSSSCP00000016666  ..............................................................................
ENSSSCP00000022958  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000017851  ..............................................................................
ENSSSCP00000021247  ..............................................................................
ENSSSCP00000012777  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000028807  ..............................................................................
ENSSSCP00000013885  ..............................................................................
ENSSSCP00000025417  ..............................................................................
ENSSSCP00000004775  ..............................................................................
ENSSSCP00000024968  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000027978  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000014530  ..............................................................................
ENSSSCP00000023947  ..............................................................................
ENSSSCP00000025895  ..............................................................................
ENSSSCP00000022922  ..............................................................................
ENSSSCP00000005978  ..............................................................................
ENSSSCP00000026588  ..............................................................................
ENSSSCP00000001308  ..............................................................................
ENSSSCP00000000277  ..............................................................................
ENSSSCP00000004471  ..............................................................................
ENSSSCP00000004541  ..............................................................................
ENSSSCP00000020853  ..............................................................................
ENSSSCP00000006241  ..............................................................................
ENSSSCP00000026906  ..............................................................................
ENSSSCP00000016389  ..............................................................................
ENSSSCP00000006954  ..............................................................................
ENSSSCP00000015012  ..............................................................................
ENSSSCP00000016392  ..............................................................................
ENSSSCP00000027979  ..............................................................................
ENSSSCP00000004016  ..............................................................................
ENSSSCP00000020473  ..............................................................................
ENSSSCP00000008195  ..............................................................................
ENSSSCP00000030974  ..............................................................................
ENSSSCP00000019430  ..............................................................................
ENSSSCP00000022637  ..............................................................................
ENSSSCP00000014907  ..............................................................................
ENSSSCP00000017077  ..............................................................................
ENSSSCP00000010815  ..............................................................................
ENSSSCP00000009337  ..............................................................................
ENSSSCP00000019007  ..............................................................................
ENSSSCP00000024991  ..............................................................................
ENSSSCP00000009843  ..............................................................................
ENSSSCP00000019007  ..............................................................................
ENSSSCP00000023477  ..............................................................................
ENSSSCP00000009452  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000003203  ..............................................................................
ENSSSCP00000022093  ..............................................................................
ENSSSCP00000027047  ..............................................................................
ENSSSCP00000006952  ..............................................................................
ENSSSCP00000011072  ..............................................................................
ENSSSCP00000023964  ..............................................................................


                                              
                                              
d2erfa1               ........................
ENSSSCP00000029807  ........................
ENSSSCP00000005158  ........................
ENSSSCP00000015013  ........................
ENSSSCP00000015012  ........................
ENSSSCP00000014796  ........................
ENSSSCP00000006952  ........................
ENSSSCP00000004335  ........................
ENSSSCP00000014907  ........................
ENSSSCP00000005280  ........................
ENSSSCP00000024403  ........................
ENSSSCP00000001201  ........................
ENSSSCP00000029440  ........................
ENSSSCP00000001416  ........................
ENSSSCP00000029869  ........................
ENSSSCP00000030828  ........................
ENSSSCP00000026179  ........................
ENSSSCP00000014929  ........................
ENSSSCP00000029385  ........................
ENSSSCP00000001288  ........................
ENSSSCP00000024192  ........................
ENSSSCP00000015699  ........................
ENSSSCP00000001200  ........................
ENSSSCP00000008754  ........................
ENSSSCP00000015688  ........................
ENSSSCP00000029029  ........................
ENSSSCP00000014840  ........................
ENSSSCP00000021212  ........................
ENSSSCP00000014732  tifdnflitddeeyaenfgkatwg
ENSSSCP00000003582  ........................
ENSSSCP00000005042  ........................
ENSSSCP00000009237  ........................
ENSSSCP00000006271  ........................
ENSSSCP00000006272  ........................
ENSSSCP00000009236  ........................
ENSSSCP00000007533  ........................
ENSSSCP00000014615  ........................
ENSSSCP00000022095  ........................
ENSSSCP00000027530  ........................
ENSSSCP00000024940  ........................
ENSSSCP00000002077  ........................
ENSSSCP00000023787  ........................
ENSSSCP00000004776  ........................
ENSSSCP00000021310  ........................
ENSSSCP00000004184  ........................
ENSSSCP00000003925  ........................
ENSSSCP00000027015  ........................
ENSSSCP00000008227  ........................
ENSSSCP00000005767  ........................
ENSSSCP00000024925  ........................
ENSSSCP00000018810  ........................
ENSSSCP00000014885  ........................
ENSSSCP00000028656  ........................
ENSSSCP00000030393  ........................
ENSSSCP00000030993  ........................
ENSSSCP00000012889  ........................
ENSSSCP00000029279  ........................
ENSSSCP00000030659  ........................
ENSSSCP00000005403  ........................
ENSSSCP00000001314  ........................
ENSSSCP00000009454  ........................
ENSSSCP00000001560  ........................
ENSSSCP00000001564  ........................
ENSSSCP00000023159  ........................
ENSSSCP00000028586  ........................
ENSSSCP00000021328  ........................
ENSSSCP00000021030  ........................
ENSSSCP00000001553  ........................
ENSSSCP00000015601  ........................
ENSSSCP00000001716  ........................
ENSSSCP00000019609  ........................
ENSSSCP00000022993  ........................
ENSSSCP00000001312  ........................
ENSSSCP00000029343  ........................
ENSSSCP00000015849  ........................
ENSSSCP00000005434  ........................
ENSSSCP00000030635  ........................
ENSSSCP00000019990  ........................
ENSSSCP00000021698  ........................
ENSSSCP00000025036  ........................
ENSSSCP00000018810  ........................
ENSSSCP00000015851  ........................
ENSSSCP00000013361  ........................
ENSSSCP00000009456  ........................
ENSSSCP00000018791  ........................
ENSSSCP00000010821  ........................
ENSSSCP00000000129  ........................
ENSSSCP00000011201  ........................
ENSSSCP00000015852  ........................
ENSSSCP00000017851  ........................
ENSSSCP00000009455  ........................
ENSSSCP00000012112  ........................
ENSSSCP00000006826  ........................
ENSSSCP00000029570  ........................
ENSSSCP00000018163  ........................
ENSSSCP00000005380  ........................
ENSSSCP00000000853  ........................
ENSSSCP00000009453  ........................
ENSSSCP00000008124  ........................
ENSSSCP00000025878  ........................
ENSSSCP00000026387  ........................
ENSSSCP00000019654  ........................
ENSSSCP00000024906  ........................
ENSSSCP00000015599  ........................
ENSSSCP00000024988  ........................
ENSSSCP00000024616  ........................
ENSSSCP00000021918  ........................
ENSSSCP00000009325  ........................
ENSSSCP00000022455  ........................
ENSSSCP00000010821  ........................
ENSSSCP00000001973  ........................
ENSSSCP00000017851  ........................
ENSSSCP00000022455  ........................
ENSSSCP00000013885  ........................
ENSSSCP00000006160  ........................
ENSSSCP00000023414  ........................
ENSSSCP00000029303  ........................
ENSSSCP00000008285  ........................
ENSSSCP00000024906  ........................
ENSSSCP00000005158  ........................
ENSSSCP00000029039  ........................
ENSSSCP00000018428  ........................
ENSSSCP00000006832  ........................
ENSSSCP00000006161  ........................
ENSSSCP00000018218  ........................
ENSSSCP00000018024  ........................
ENSSSCP00000001598  ........................
ENSSSCP00000030976  ........................
ENSSSCP00000011839  ........................
ENSSSCP00000030667  ........................
ENSSSCP00000001317  ........................
ENSSSCP00000003232  ........................
ENSSSCP00000013851  ........................
ENSSSCP00000023132  ........................
ENSSSCP00000016666  ........................
ENSSSCP00000004335  ........................
ENSSSCP00000019848  ........................
ENSSSCP00000010319  ........................
ENSSSCP00000022089  ........................
ENSSSCP00000007459  ........................
ENSSSCP00000001326  ........................
ENSSSCP00000001327  ........................
ENSSSCP00000005851  ........................
ENSSSCP00000010214  ........................
ENSSSCP00000025497  ........................
ENSSSCP00000030716  ........................
ENSSSCP00000029973  ........................
ENSSSCP00000004541  ........................
ENSSSCP00000026569  ........................
ENSSSCP00000000431  ........................
ENSSSCP00000020796  ........................
ENSSSCP00000012801  ........................
ENSSSCP00000016666  ........................
ENSSSCP00000023132  ........................
ENSSSCP00000019848  ........................
ENSSSCP00000006241  ........................
ENSSSCP00000020492  ........................
ENSSSCP00000008085  ........................
ENSSSCP00000018239  ........................
ENSSSCP00000021088  ........................
ENSSSCP00000003894  ........................
ENSSSCP00000020352  ........................
ENSSSCP00000024007  ........................
ENSSSCP00000012140  ........................
ENSSSCP00000015856  ........................
ENSSSCP00000000096  ........................
ENSSSCP00000022990  ........................
ENSSSCP00000009188  ........................
ENSSSCP00000030087  ........................
ENSSSCP00000012497  ........................
ENSSSCP00000031041  ........................
ENSSSCP00000004838  ........................
ENSSSCP00000025331  ........................
ENSSSCP00000006405  ........................
ENSSSCP00000013851  ........................
ENSSSCP00000005821  ........................
ENSSSCP00000004541  ........................
ENSSSCP00000021819  ........................
ENSSSCP00000018415  ........................
ENSSSCP00000013851  ........................
ENSSSCP00000010214  ........................
ENSSSCP00000011618  ........................
ENSSSCP00000008984  ........................
ENSSSCP00000004615  ........................
ENSSSCP00000030087  ........................
ENSSSCP00000004918  ........................
ENSSSCP00000007532  ........................
ENSSSCP00000004775  ........................
ENSSSCP00000008985  ........................
ENSSSCP00000018428  ........................
ENSSSCP00000004775  ........................
ENSSSCP00000008158  ........................
ENSSSCP00000013851  ........................
ENSSSCP00000026169  ........................
ENSSSCP00000023415  ........................
ENSSSCP00000027051  ........................
ENSSSCP00000026077  ........................
ENSSSCP00000004541  ........................
ENSSSCP00000027650  ........................
ENSSSCP00000019848  ........................
ENSSSCP00000023361  ........................
ENSSSCP00000026213  ........................
ENSSSCP00000023132  ........................
ENSSSCP00000008195  ........................
ENSSSCP00000006241  ........................
ENSSSCP00000025417  ........................
ENSSSCP00000016447  ........................
ENSSSCP00000021819  ........................
ENSSSCP00000006241  ........................
ENSSSCP00000019848  ........................
ENSSSCP00000021829  ........................
ENSSSCP00000020853  ........................
ENSSSCP00000013851  ........................
ENSSSCP00000016390  ........................
ENSSSCP00000004039  ........................
ENSSSCP00000014354  ........................
ENSSSCP00000020506  ........................
ENSSSCP00000001881  ........................
ENSSSCP00000013851  ........................
ENSSSCP00000016666  ........................
ENSSSCP00000005883  ........................
ENSSSCP00000004543  ........................
ENSSSCP00000003039  ........................
ENSSSCP00000018415  ........................
ENSSSCP00000027862  ........................
ENSSSCP00000004541  ........................
ENSSSCP00000018099  ........................
ENSSSCP00000012904  ........................
ENSSSCP00000030031  ........................
ENSSSCP00000004614  ........................
ENSSSCP00000027678  ........................
ENSSSCP00000017907  ........................
ENSSSCP00000027979  ........................
ENSSSCP00000004016  ........................
ENSSSCP00000003680  ........................
ENSSSCP00000001127  ........................
ENSSSCP00000006241  ........................
ENSSSCP00000001629  ........................
ENSSSCP00000005988  ........................
ENSSSCP00000024916  ........................
ENSSSCP00000021132  ........................
ENSSSCP00000017907  ........................
ENSSSCP00000005893  ........................
ENSSSCP00000029807  ........................
ENSSSCP00000011596  ........................
ENSSSCP00000002048  ........................
ENSSSCP00000001310  ........................
ENSSSCP00000028578  ........................
ENSSSCP00000012112  ........................
ENSSSCP00000018222  ........................
ENSSSCP00000029355  ........................
ENSSSCP00000003233  ........................
ENSSSCP00000023342  ........................
ENSSSCP00000023857  ........................
ENSSSCP00000026405  ........................
ENSSSCP00000023656  ........................
ENSSSCP00000001565  ........................
ENSSSCP00000003907  ........................
ENSSSCP00000012436  ........................
ENSSSCP00000001558  ........................
ENSSSCP00000004775  ........................
ENSSSCP00000010407  ........................
ENSSSCP00000027979  ........................
ENSSSCP00000004016  ........................
ENSSSCP00000026273  ........................
ENSSSCP00000027979  ........................
ENSSSCP00000004016  ........................
ENSSSCP00000015120  ........................
ENSSSCP00000029926  ........................
ENSSSCP00000019261  ........................
ENSSSCP00000027979  ........................
ENSSSCP00000004016  ........................
ENSSSCP00000019207  ........................
ENSSSCP00000025417  ........................
ENSSSCP00000024968  ........................
ENSSSCP00000001308  ........................
ENSSSCP00000004775  ........................
ENSSSCP00000025895  ........................
ENSSSCP00000022922  ........................
ENSSSCP00000002048  ........................
ENSSSCP00000000712  ........................
ENSSSCP00000022455  ........................
ENSSSCP00000001310  ........................
ENSSSCP00000028578  ........................
ENSSSCP00000016392  ........................
ENSSSCP00000008559  ........................
ENSSSCP00000021819  ........................
ENSSSCP00000003203  ........................
ENSSSCP00000010021  ........................
ENSSSCP00000010815  ........................
ENSSSCP00000020574  ........................
ENSSSCP00000016666  ........................
ENSSSCP00000022958  ........................
ENSSSCP00000005978  ........................
ENSSSCP00000017851  ........................
ENSSSCP00000021247  ........................
ENSSSCP00000012777  ........................
ENSSSCP00000006241  ........................
ENSSSCP00000028807  ........................
ENSSSCP00000013885  ........................
ENSSSCP00000025417  ........................
ENSSSCP00000004775  ........................
ENSSSCP00000024968  ........................
ENSSSCP00000000277  ........................
ENSSSCP00000027978  ........................
ENSSSCP00000005978  ........................
ENSSSCP00000014530  ........................
ENSSSCP00000023947  ........................
ENSSSCP00000025895  ........................
ENSSSCP00000022922  ........................
ENSSSCP00000005978  ........................
ENSSSCP00000026588  ........................
ENSSSCP00000001308  ........................
ENSSSCP00000000277  ........................
ENSSSCP00000004471  ........................
ENSSSCP00000004541  ........................
ENSSSCP00000020853  ........................
ENSSSCP00000006241  ........................
ENSSSCP00000026906  ........................
ENSSSCP00000016389  ........................
ENSSSCP00000006954  ........................
ENSSSCP00000015012  ........................
ENSSSCP00000016392  ........................
ENSSSCP00000027979  ........................
ENSSSCP00000004016  ........................
ENSSSCP00000020473  ........................
ENSSSCP00000008195  ........................
ENSSSCP00000030974  ........................
ENSSSCP00000019430  ........................
ENSSSCP00000022637  ........................
ENSSSCP00000014907  ........................
ENSSSCP00000017077  ........................
ENSSSCP00000010815  ........................
ENSSSCP00000009337  ........................
ENSSSCP00000019007  ........................
ENSSSCP00000024991  ........................
ENSSSCP00000009843  ........................
ENSSSCP00000019007  ........................
ENSSSCP00000023477  ........................
ENSSSCP00000009452  ........................
ENSSSCP00000003203  ........................
ENSSSCP00000003203  ........................
ENSSSCP00000022093  ........................
ENSSSCP00000027047  ........................
ENSSSCP00000006952  ........................
ENSSSCP00000011072  ........................
ENSSSCP00000023964  ........................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0052500 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 6312
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma mobile 163K
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
No