SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Concanavalin A-like lectins/glucanases alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0052500 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2erfa1               n.............................................................................
ENSBTAP00000002600  tdfrrfqmipldpkgtsqndpnwvvrhqgkelvqtvncdpglavgydefnavdfsgtffinterdddyagfvfgyqss
ENSBTAP00000036460  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvdfegtfhvnt................
ENSBTAP00000006074  tdfrafqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvd.........................
ENSBTAP00000000063  tdfrayqtvvldpegdaqidpnwvvlnqgmeivqtmnsdpglavgytafngvd.........................
ENSBTAP00000042078  tdfrnfqmvhldpkgttqidpnwvirhqgkelvqtansdpgiavgfdefgsvdfsgtfyvntdrdddyagfvfgyqss
ENSBTAP00000054517  ykapvptgevyfadsfdrgtlsgwilsrakkddtddeiakydgkwevdemkesklpgdkglvlmsrakhhaistklnk
ENSBTAP00000046571  eylkrehslskpyqgvgtsssslwnlmgnamvmtqyirltpdmqskqgalwnrvpcflrdwelqvhfrihgqgkknlh
ENSBTAP00000002071  ktpqpvgevyftetfdsgrlagwvlskakkddidaeisiydgrweieelkenripgdrglvlksrakhhaisavlakp
ENSBTAP00000005195  eylkrehslskpyqgvgtsssslwnlmgnamvmtqyirltpdmqskqgalwnrvpcflrdwelqvhfrihgqgkknlh
ENSBTAP00000010569  hlkrehslikpyhgigssstllwdfqgstmltsqyvrltpderskegsiwnhlpcflkdwemhvhfkvhgagkknlhg
ENSBTAP00000001158  lreaqlysvdvtldpdtaypslilsdnlrqvrysylqqdlpdnperfnlfpcvlgspcfiagrhywevevgdkakwti
ENSBTAP00000008979  lhhpqikrqygyvpawmhtaeaipssdqiriapslksqrgsvwtktkaafenwelevtfrvtgrsrigadglavwyte
ENSBTAP00000018459  kmlrtcgvhitldpqtanpwlilsenrrqvrlantrqevpeneerfdsypmvlgaqrfdsgkvywevdvtgkeawdlg
ENSBTAP00000054004  kmlrtcgvhitldpqtanpwlilsenrrqvrlantrqevpeneerfdsypmvlgaqrfdsgkvywevdvtgkeawdlg
ENSBTAP00000011393  mremlrkfstditldpatanaylvlsedlksvkhggirqqlpdnperfdqsatvlgtqvftcgrhywevevgnktewe
ENSBTAP00000034027  ckptrldllldmppvsydvqllhswnnndrslnvfvkeddklifhrhpvaqstdairgkvgytrglhvwqitwamrqr
ENSBTAP00000015061  sadvrldpdtaysrlivsedrkcvrygdtkqklpdnperfyrynivlgsqcissgrhywevevgdrsewglgvckenv
ENSBTAP00000009824  mremlrkfqvdikldpatahpsllltadlrsvqdgelwrdvpnnperfdtwpcilglqnfssgrhywevmvgeraewg
ENSBTAP00000012013  parldqlldmpaaglavqlrhawnpedrslnvfvkdddrltfhrhpvaqstdgirgkvgharglhawqihwparqrgt
ENSBTAP00000009893  lspltldpktahpnlvlsknrtsvwhgdikqlmpddperfdssvavlgskgftsgkwywevevakktkwtvgvvresi
ENSBTAP00000013175  atvyfqeefldgerwrnrwvhstndsqfgh................................................
ENSBTAP00000042458  wrrnllhaadllrdphfthpslylyeenyplrfedrrqkspdklqryxswpcvmgreaftsgrhywevevgdrtdwai
ENSBTAP00000020111  rtvyfkeqfldgdgwterwieskhkpdfgkfvlssgkfygdqekdkglqtsqdarfyalsarfepfsnkgqtlvvqft
ENSBTAP00000024852  ealrrfrgdmtldpdtanpelvlsedrrsvrrgdlrqalpdsperfdpgpcvlgrepltsgrhywevevgeraswalg
ENSBTAP00000036910  lwvvpvnltldaatahpalflseegrrvtwqepcqdlpscperfvsrpcvlgqlhvssgryfwevevqnahswdlgvc
ENSBTAP00000028561  qrrfeyklsfkgprlalpgvgipfwshhgdaipgleevrlapsmrnrsgavwstnpvlfpaweveiqmrvtgpgrwga
ENSBTAP00000024658  kmlrrhqvsvtldpetahyelilsedrrqvirgcpqenldnssrrfsalpcilgyegftsgkhyfevdvgegtgwdlg
ENSBTAP00000055797  rkeefkavnmtldaatahpalllseegrqvswqercqeipssserfssipcvlgqlciisgryswdievgdacswdlg
ENSBTAP00000055913  wraaqrhavdvtldpgsahpslevsedgksvsslrtapgsenpqwlseqtcvlsrelfstgrhywevhvgrrsrwflg
ENSBTAP00000027907  kveltldpdtanprlilsldlksvrlgqqaqdlpshprrfdtntrvlascgfssgrhhwevevgskdgwafgvaresv
ENSBTAP00000033248  etaefnpidgwkkrwvvskhgsygkfqltggkfygdkekdkglqssedakf...........................
ENSBTAP00000045818  stpqalypdrsrpegleellsapppdlgaqrrhgwnpkdcsenievkegglcferrpvaqstdgargkrgysrglhaw
ENSBTAP00000047271  wrslcarslaeealrtdilcnlpsykakirafqhafstndcsrnvyikkngftlhrnpiaqstdgartkigfsegrha
ENSBTAP00000011391  skmlkvlqrpitldpktahpylvlsedlrsvrlrnvqrgvpghperfdfsatvlgaqsftsgrhywevdvgraaqwql
ENSBTAP00000027551  dihpvpaaltldpgtahqrlilsddctivaygnlhpqplqdspkrfdvevsvlgseafssgvhywevvvaektqwvig
ENSBTAP00000022024  dcrcgeedeyfdwvwddlnkssatllscdnrkvsfhmeyscgtaairgtkelgegqhfweikmtspvygtdmmvgigt
ENSBTAP00000007623  rkvlpapeslkldpatahpllelskgntvvqcgllaqrrasqperfdystcvltsrgfscgrhywevvvgsksdwrlg
ENSBTAP00000015712  tdvqsywvdvtlnphtanlnlvlsknrrqvrfvgaqlsgshleehygcgvlgsqhfssgkhywevdvakktdwilgvc
ENSBTAP00000009025  yinpvvpftgmiqgglqdghkitiigavlpsggnrfavnlqtgyndsdiafhfnprfeeggyvvcntkqrgswgteer
ENSBTAP00000009005  yinpvvpftgmiqgglqdghkitiigavlpsggnrfavnlqtgyndsdiafhfnprfeeggyvvcntkqrgswgteer
ENSBTAP00000012653  gvvtldpqtasrslvlsedrksvrytrqkqnlpdsplrfeglpvvlgspgfssgrhr.....................
ENSBTAP00000013346  hfnstynarikafnktgvsqysktlvlqtsevawfaf.........................................
ENSBTAP00000013398  klktnsqpfkldpksahrklkvshdnltverdessskkshtperftsqgsygvagnvfid..................
ENSBTAP00000013121  pelleyvvkvvldyntahskvalsenytvasvadaslnyrphpqrftycsqvlglhcykkgihywevelqknnfcgvg
ENSBTAP00000026179  aarvdltldpdtahpalmlspdrravrlaerrqevadhskrfsadccvlgaqgfrsgrhywevevggrrgwavgaare
ENSBTAP00000055851  wrkeefqewpvtldpgsahsdlvvshektsvtlkascvntadtcsvlgfegitsgrcyweveirdgdqsewalgvcge
ENSBTAP00000024853  evlksfqedvvpdpstaypylllyesrqrrylstpmdgtpcgkdrflaypcavgqeiyssgrhywevgmnltgdalwa
ENSBTAP00000021701  pafnppvpfngrlqgglivrrtiiikgyipptaksfvinfkvgssgdvalhinprmtegavvrnsfln..........
ENSBTAP00000044710  dntchfedekicgytqdltdnfdwtrqnaltqnpkrspntgpptdisgtpegyymfietsrprelgdrarlvsplyna
ENSBTAP00000041298  nvpyd.........................................................................
ENSBTAP00000001294  gyryilaepdphapdpekleldcwagkpipgdlyraclyervllalhdrapqlkisddrltvvgekgysmvrashgvr
ENSBTAP00000021701  ptynptlpyhnpipgglrvgmsvyiqgvasehmkrffvnfevgqgqgadvafhfnprfdgwdkvvl............
ENSBTAP00000007366  trvqchwvditlnpfnlnlnlvlsedqrqvlsvpiwpvkyynygilgcqyfssgkhyweidvseknawilgvycrirs
ENSBTAP00000009909  epahisldprtshpklllsedyqqarfsykwqkspdnpqrfdratcvlahggftggrhtwvvsvdlahggsctlgv..
ENSBTAP00000029287  rlktnsqpfkldpkmthkklkisndglqmekeesslkkshtperfsgtgcygaagnifidsgchywevvmgsstwyav
ENSBTAP00000009005  qlpfftsilgglypsksilvsgtilpsaqrfyinlrsgsdiafhlnprf.............................
ENSBTAP00000009025  qlpfftsilgglypsksilvsgtilpsaqrfyinlrsgsdiafhlnprf.............................
ENSBTAP00000054057  trvqchwvditlnpfnlnlnlvlsedqrqvlsvpiwpvkyynygilgcqyfssgkhyweidvseknawilgvycrirs
ENSBTAP00000006913  ryvqry........................................................................
ENSBTAP00000043820  hetplprswspkdkynyiglsqgnlrvhykghgknhkdaasvra..................................
ENSBTAP00000056333  pyinppvpftgmiegglq............................................................
ENSBTAP00000018469  tdlhkk........................................................................
ENSBTAP00000018010  iynpvipyvgtiseqlepgtlivlrghvpsdsd.............................................
ENSBTAP00000046313  qdwrkaelyadwrkeqfkaaaftldpktahpnlvlsenkqhislknnvsqngdasthedqavseaifsvlgdksftqg
ENSBTAP00000053488  vcqclpgfggpecekllsvnfvdrdtylqftdlqnwpran......................................
ENSBTAP00000017563  dftcscpagtggavcekalhpsvpa.....................................................
ENSBTAP00000020080  vasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcnskdagawgaeqresafpfq..
ENSBTAP00000052704  tdvqrywvqvtlnspkcanvvispdqtqvryassdqgynaylnynyetfgvlgspvitsgrhywevdvskksawilgv
ENSBTAP00000031529  elqcnfengicnweqdteddfdwtryqgptstlntgpmkdntlgtaqghylyiessepqvfqhraallspilna....
ENSBTAP00000023092  pgectfeqdeciftqerrnrsswqrrrgetptsytgpkgdhttgvgyymyieashlvygqkarllsrplrg.......
ENSBTAP00000029126  ggfrcqcpaggafegprcevaarsf.....................................................
ENSBTAP00000023900  idwlrqfqvyielhnervthhlpvfedlrcllagpdgpdvdytpprsiyflswgaesftsgqhywevdvagccnwaig
ENSBTAP00000034496  alrfdalwqvlsrdcfaagrhywevdvqeagvgwwvgaaygslrrhgasdaarlgcnrqswclkrydleywafhdcqr
ENSBTAP00000053345  fsggclfdepystcgysqavddefnweqvntltkptsdpwmpsgsfmlvntsgrpegqrahlllpqlkendthcidfh
ENSBTAP00000005971  tdvqrywvqvtlnspksenvvispdqrqvryassdqcynaywndnyedfgvlgspvitsgrhywevdvskksawilgv
ENSBTAP00000028802  mdmkmgsslkikgkitdgangfvinlgqgtdklnlhfnprfaestivcnsrdgnswgaeqrdnhmcfs..........
ENSBTAP00000011769  qltfplrtn.....................................................................
ENSBTAP00000054738  k.............................................................................
ENSBTAP00000004870  tdvqrywvqvtlnspkcanvvispdqtqvryassdqgynaylnynyetfgvlgspvitsgrhywevdvskksawilgv
ENSBTAP00000018010  lsktlpfvarlnssmgpgrtivikgevntnakgftvdllsgkskdialhlnprlnvkafvrnsflqea..........
ENSBTAP00000021676  mlerlnsfrvyitldgkirngcvpliealrrlqcgpvdrdvpwdaacpentptwgaqtftagkhywevdvgnsgdwvi
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000022890  farwaisptfdleslscnlkvsvdlrtvtvsdfpmlyawsperfassqalcsqalssgqhywevdtqrcshwavgva.
ENSBTAP00000053970  raaydpltldaasahpdliisqdlktvtlkpvpqrvcagdtdperfypfrcvlglpglcsgcqtweaelqgpegggcv
ENSBTAP00000035935  efhcgfedgniclftqddtdnfdwtkqstatrntkytpntgpnadrsgskegfymyietsrprlegekarllspvfsi
ENSBTAP00000056432  nvphktslpegirvgtvlrirglvpdkagrfyvnllcgeepgsdaalhfnprldestvvfntlergtwgaeergsgip
ENSBTAP00000053607  icqclpgyqgekceklvsvnfvnkesylqipsakvrpqtn......................................
ENSBTAP00000026956  pcknngmcrdgwnryvcdcsgtgylgrscereatvlsydgsmfmkiqlpvvmhteae.....................
ENSBTAP00000009351  pvipfvttifgglragkmvmlqgavplnahrfqvdfqcgcslhprpdiaihfnprfhttkphvicnslyrgrwqv...
ENSBTAP00000022744  tcrchlgrsgmrceegvtvttpsl......................................................
ENSBTAP00000053511  dvrmdertvspflqlsddrrtltfnakkskacadgperfdhwpnaladtsfqaglhawmvnvqnscaykvgvalgqlp
ENSBTAP00000042181  nvphktslpegirvgtvlrirglvpdkagrfymnllcgeepgsdaalhfnprldestvvfntlergtwgaeergsgip
ENSBTAP00000026111  twggsrchcnlgkggescsediviqypqffghsy............................................
ENSBTAP00000019994  fsldehtchprltvsedgltvvrserrgpakepvpsdaqftrtrcaavmgnlipvrgrhywevevdecldytvgvafe
ENSBTAP00000037239  rqeltfdpstahpslvlsnsgrcvecseqkappagedprqfdkavavvthqllsegehywevevgdkprwalgvigaq
ENSBTAP00000032103  keefqewpvtldpktsvtlktscvnaadkcsvlgfegitsgrcyweveirdgdqsewflgvcgegvnrkgwyvespgk
ENSBTAP00000010571  iggfhcvcppgaferpycevttrsfp....................................................
ENSBTAP00000014522  nym...........................................................................
ENSBTAP00000002600  s.............................................................................
ENSBTAP00000054736  tsplclsslawftfdpnsghrdiilsndnqtatcssyddrvvlgtaafskgahywelhvdrydnhpdpafgvarasvv
ENSBTAP00000054420  vggfkcncpsgdfekpfcqvttrsfpar..................................................
ENSBTAP00000053498  ggctfddgpgacdyhqdlyddfewvhvsaqephylppempqgsymivdssdhdpgekarlqlptmkendthcidfsyl
ENSBTAP00000027527  etytcvcpggk...................................................................
ENSBTAP00000026111  adsyiclcplgfrgrhcedaftltipqfkeslrsyaatpwpleprhylsf............................
ENSBTAP00000025424  aryirivplawnprgkiglrlglygcpyks................................................
ENSBTAP00000032310  ycdgkkgfklaqdqksceavpvclpldldknyellylaeqfvgvvlylkf............................
ENSBTAP00000042078  t.............................................................................
ENSBTAP00000056054  lpnpyqqsvslavgfmvkimgnlesscgknpelvvdfctgieedsdia..............................
ENSBTAP00000025033  vggfkcncpsgdfekpfcqvttrsfpar..................................................
ENSBTAP00000051925  ldtlnnfrvdnvltqttihhlslddasvmsgddpqgmsrqldggesfvawgaqaftsgrhyweldvthfsnwilgvsk
ENSBTAP00000017563  asyeclcpagfsglhcekgl..........................................................
ENSBTAP00000000307  ymdqckdgditycelnarfglraivad...................................................
ENSBTAP00000028276  d.............................................................................
ENSBTAP00000022744  hclcppgfsgprcqhssahglvesdwhlegsggndapgqyga....................................
ENSBTAP00000026133  tdlrgkvfvfpresstdhvtlitklekp..................................................
ENSBTAP00000042592  kllavawfafdpgsah..............................................................
ENSBTAP00000023889  ldmlnnfrvdnilsqt..............................................................
ENSBTAP00000053469  pcknngmcrdgwnryvcdcsgtgylgrscereatvlsydgsmfmkiqlpvvmhteae.....................
ENSBTAP00000033006  pcknngmcrdgwnryvcdcsgtgylgrscereatvlsydgsmfmkiqlpvvmhteae.....................
ENSBTAP00000053469  gvvafkcenvatldp...............................................................
ENSBTAP00000026956  gvvafkcenvatldp...............................................................
ENSBTAP00000033006  gvvafkcenvatldp...............................................................
ENSBTAP00000026471  tygfncefgwgshktfchwehdnhvqlkwsvltsktgpiqdhtagdg...............................
ENSBTAP00000042646  yngvniidlakrrkhqiytvgnvtfscsepqivpi...........................................
ENSBTAP00000013075  ipviqivyetlkdqqegkkgkatiktgasvlnkwqmnpydrgsafaigsdglccqsrevkewhgcratkgltkgkhyy
ENSBTAP00000000793  ..............................................................................
ENSBTAP00000036729  rflrfiplewnpkgrigmrievfgcayrsevvdldgksclly....................................
ENSBTAP00000001939  gfnldfevsgiy..................................................................
ENSBTAP00000029353  rrrlwqnyrnltfdpvsanrhlylsqqdqrvkhllkprgpdgpgsfelwqvqcaqsfq....................
ENSBTAP00000049986  lldnvlhqkmsf..................................................................
ENSBTAP00000028721  daasvrathpipaacgiyyfevkivskgrdgymgiglsaqgvnmnrlpgwdkhsygyhgddghsfcssgtgqpygptf
ENSBTAP00000035185  hcdgrgglklsqdmstcedilpcvpfnvaksvnslylgrmfsampvikllfkrl........................
ENSBTAP00000053469  yidlckngdidycelnarfgfrniia....................................................
ENSBTAP00000026956  yidlckngdidycelnarfgfrniia....................................................
ENSBTAP00000033006  yidlckngdidycelnarfgfrniia....................................................
ENSBTAP00000053469  iatfkgseyfcydlsqnp............................................................
ENSBTAP00000024169  gtffegsgyaa...................................................................
ENSBTAP00000013134  cvesvpfsldpntaagwlsvsddltsvtnhgyrvqvenperfssapcllgscilsqgshawevdlgalaswrvgvvrt
ENSBTAP00000036729  ydgvdiidlakrqdpqmivmgnvsfscsqpqsvpv...........................................
ENSBTAP00000037790  cnlnfdattaseelflfkethsvlnlgillepfaaggpfpgfkqwpqvlcsrglaegrhyweadvsnswvclgvtyrr
ENSBTAP00000053179  srnshiaiafddtkv...............................................................
ENSBTAP00000054149  kincnfedgfcfwiqdlnddnewertqgs.................................................
ENSBTAP00000000788  kincnfedgfcfwiqdlnddnewertqgs.................................................
ENSBTAP00000020299  lpnpyqqsvslavgfmvkitgnlesscglcgnnpevvvdfcmgieeg...............................
ENSBTAP00000013292  p.............................................................................
ENSBTAP00000000458  lhmlnnfrvdnvlslttivhhailddesalfeddhpiasrqpqgrscivswgawgftsgrhyweldvaqssswvlgvc
ENSBTAP00000012225  sfkleektahsslllfkgdtgvkygmvgleptklalnverfrewavvladtavtsgrhywevtvkrsqqfrigvadvd
ENSBTAP00000036729  cglegncvdsqyycncdadrnewtndtgflsykehlpvtrivitdtgrphseaayklgpllcrgdkl...........
ENSBTAP00000008454  evdiidlskkhkpqvlimgnvsfscshtqtvpmt............................................
ENSBTAP00000017076  agctfeetsdpavpceysqaqyddfqweqvrihpgtrapadlphgsylvvnasqh.......................
ENSBTAP00000000179  ivpfcghikggmrpgkkvlvmgivdlnpesfaisltcgdsedppadvaielkavftdrqllrnscisgergeeqsaip
ENSBTAP00000042771  vegrlgpstvvldhtggfeglllvdddllgvighsnfgtirsttcvykgkwiyevlissqglmqigwctincrf....
ENSBTAP00000046486  crcppfagprceklitvnfvgkdsyvelasakvrpqanis......................................
ENSBTAP00000031529  grcdfefdlcsweqeqdddfdwnlkasnvpatgtepaadhtlgnssghyifikslfpqqpmraarissp.........
ENSBTAP00000005332  cqcppgklge....................................................................
ENSBTAP00000008454  llcsgdns......................................................................
ENSBTAP00000053720  wna...........................................................................
ENSBTAP00000035185  mqcfsvtergsffpgsgfaffhldyartspaggtk...........................................
ENSBTAP00000017120  kdlrgk........................................................................
ENSBTAP00000053179  aqkgty........................................................................
ENSBTAP00000011612  svtpcfegpmetgtyfsteggyvvldesfni...............................................
ENSBTAP00000032513  revscnfergacgwhtgh............................................................
ENSBTAP00000017857  krtsvgsrppavrgsrdrftgesytvlgdtaiesgqhywevkaqkdcksysvgvayktlgkfdqlgktntswcihvnn
ENSBTAP00000008454  rflrflpltwnpkgrigmrie.........................................................
ENSBTAP00000027839  qfeafhagglap..................................................................
ENSBTAP00000053422  ..............................................................................
ENSBTAP00000000307  lsfrcedvaaldpv................................................................
ENSBTAP00000017783  g.............................................................................
ENSBTAP00000005537  pshggpalrpplpsq...............................................................
ENSBTAP00000017563  eakcecphgregslcqtvsepednqpfl..................................................
ENSBTAP00000031529  dicsfekgslckwyqpiseklikdsntfrwglgngtsihhgeenhrpsvdhttntadgwylyadssngnfgdia....
ENSBTAP00000000307  pcrnggacregwnrfvcdcvgtgflgrvcereatvlsydgsmymkimlpnamhteaedvs..................
ENSBTAP00000011863  cetailfpmrskkifasvhpvt........................................................
ENSBTAP00000053409  enlpiqevsfdpekaqccivengqilthgsggkgyglastgvtsgcyqwkfyivkenrgnegtcvgvsrwpvhdfnhr
ENSBTAP00000018697  ggcfllclsllllgcwaelgsglefpgaegqwtrfpkwnaccese.................................
ENSBTAP00000024169  caterapeyipnahqfglaegshlvlpfnqlav.............................................
ENSBTAP00000033006  iatfkgseyfcydlsqnp............................................................
ENSBTAP00000026956  iatfkgseyfcydlsqnp............................................................
ENSBTAP00000026725  p.............................................................................
ENSBTAP00000022744  vpyftqt.......................................................................
ENSBTAP00000011612  hcqlsnsprai...................................................................
ENSBTAP00000013316  gvesyychcpfgvfgkhcelnsygfeelsymefps...........................................
ENSBTAP00000025424  niadlavrrhsritfegkv...........................................................
ENSBTAP00000042646  rfirfvplewnpsgkigmrvevygcsyssslplfdma.........................................
ENSBTAP00000024169  fgspqdedasfhfagsgysvvektlratvtq...............................................
ENSBTAP00000000307  fvatfkgneffcydlshnpiqss.......................................................
ENSBTAP00000013440  d.............................................................................
ENSBTAP00000006786  vg............................................................................
ENSBTAP00000032513  lpascdfeaglcgwnhvprpglggyswdwssgaspsrypqppvdhtlgteaghfalfetsvlgpggraaglisqplpp
ENSBTAP00000025424  pcfhggrcverysyytcdcdltafdgpycnhdiggffepgtwmrynlqsalrsaarefshmlsrpvpgyepgyipgyd
ENSBTAP00000054985  p.............................................................................
ENSBTAP00000004114  tlvaidtyncdlhfkvardrssgypltiegfaylwsgarasygvrrgrvcfemkineeisvkhlpstepdphvvrigw
ENSBTAP00000045584  scdfelgnvcgmiqssadsadwqrlsevsegpesdhsnmgrcrgsgffmhfnsssvnegatailesrilypkrgfqcl
ENSBTAP00000053179  segtiqf.......................................................................
ENSBTAP00000053569  hagkllsvlkhmpqkygpdaff........................................................
ENSBTAP00000012117  mewlnhfrvnfslsnevssqhirlfddarrltyehdslhasldggtlkyfaswgdqsftsgkqywemlvdrswdwavg
ENSBTAP00000053727  kgiyfsqegg....................................................................
ENSBTAP00000008967  flllretahpalqissngtvisfaerrrlteipsvlgeelpacgqhywettvtdcpayrlgvcsssavqagalaqget
ENSBTAP00000005686  dhcdfekanicgmiqgtrddtdwvhennaqpgqadhtlagqctgagyfmylntsfgaaedaamles............
ENSBTAP00000031460  pvvq..........................................................................
ENSBTAP00000053495  mkgt..........................................................................
ENSBTAP00000007877  grdrftaesy....................................................................
ENSBTAP00000024169  gcilepvrsvsf..................................................................
ENSBTAP00000031529  gscsfettsgnwtttchltqdsqddldwaigsgiptealspdpdhtpgsgqhflfv......................
ENSBTAP00000036729  chhggmcmekpsgfscdctssayagpfcsdeisayfgsgssviynfqenysl..........................
ENSBTAP00000001200  e.............................................................................
ENSBTAP00000034542  pwqv..........................................................................
ENSBTAP00000000307  gglefgggpgqwaryarwagaassge....................................................
ENSBTAP00000053495  gcptslqegaq...................................................................
ENSBTAP00000024169  ayqpqisstnyn..................................................................
ENSBTAP00000023092  ciecdfeenhlcgfvnhwnpnvnwfvgggntrnsnsslpqdhtlkselghymyvdsiyvkhfqevaqlispmtta...
ENSBTAP00000024358  grlpvlyfsgrreplllrpev.........................................................
ENSBTAP00000000307  canqgvclqqwdgftcdctmtsyggpicndpgtt............................................
ENSBTAP00000006361  nsikamlnsndvseylkisphglearcdassfesvrctfcvdagvwyyevtvvtsgvmqigwatrdskflnhegygig
ENSBTAP00000032513  pftcdferdscgwrdistagyrwlrdragasperpglradhtlgtdlgwyvavgthrgretataalrspvlheaaptc
ENSBTAP00000053727  ralrfgdsptshllfmlpqellksrs....................................................
ENSBTAP00000054420  cecplgfggkscaqemanpqrflgssllawhglslpi.........................................
ENSBTAP00000032310  ekqnkhclvnvekgsyypgtgvaqfsinyknesnpeawqinvslnirpsagtgvmlalvsdntvpfalslvdsatek.
ENSBTAP00000023376  tplpalgaltacahvqwdatssdpaalfslavptlanalqlrafaep...............................
ENSBTAP00000042646  chnggkcvekhsgyfcdctsspyegpfckkevsavfeagtsvtymfqepypvtk........................
ENSBTAP00000016055  qkgftkgrhywevdiedtdewtlgiyeepteksellsdlqkmkfnvlekkgceyralicsrqgifhkeslpiekcplk
ENSBTAP00000003261  srsksppppeeevkdeeedhtlvnldtytsdlhfqvskdryggqplfsekfptlwsgarstygvtkgkvcfeakvtq.
ENSBTAP00000053720  ncenggkciekyhgyscdcsntaydgtfcnkadvgaffeegmwlrynfqapgigtrdsgsrsenspdpqng.......
ENSBTAP00000025033  cecplgfggkscaqemanpqrflgssllawhglslpi.........................................
ENSBTAP00000004156  ptasfygesyvglniievsse.........................................................
ENSBTAP00000025424  rcygdrnswntisfhtgaa...........................................................
ENSBTAP00000054276  avkkirnpkgpfilrlg.............................................................
ENSBTAP00000023092  leascnfeedlcnfyqdkegsgwtrvkvkpnlyragdhtsglgyflladtkftsqpgyigrlygpslpgnqqyc....
ENSBTAP00000037835  avkkirnpkgpfilrlg.............................................................
ENSBTAP00000032513  prrcsfedsacgfsvggrglwtrqanaswgphadhttetaqghymvvdmspqalprghaalltseeqrplvqptc...
ENSBTAP00000008454  chnggrcrekrrgitcdctvsaydgpfcendisayfgagssviynfqdhyndtfsknsss..................
ENSBTAP00000010571  cecplrfggknceqvmphpqrfsgesvvswsdldiiisvp......................................
ENSBTAP00000015885  sgfncnfdfpeepcgwmydhakwlrstwasssspddrtfpddrnflrlqsdgrregqyarlisppvhlprspvcmefq
ENSBTAP00000041534  qcdfedkdhpfcdwvqvlqdggrwtqgsantlihgtgpfgialsgeshfvylea........................
ENSBTAP00000023842  svdctfdhgvcdwkqdieddfdwnpvdqdnavgyymavsaltgqkkdigrlk..........................
ENSBTAP00000013316  dywswqqchcregltgkyceksitpdtalslegkgrldyhmsqnekreyllrqsirgamlepfgvn............
ENSBTAP00000053179  gcslenvytvsfpkpgfvelspvpidvgteinlsfstknesgiillgsggtpipprrkrrq.................
ENSBTAP00000033786  dgqhgfdclcppg.................................................................
ENSBTAP00000016206  dvavgf........................................................................
ENSBTAP00000003981  kgl...........................................................................
ENSBTAP00000053566  rlekncsckg....................................................................
ENSBTAP00000048368  ddtvvcldtyncdlhfkisrdrlsassltmesfaflwaggrasygvskgkvcfemkvtekipvrhlytkdidihevri
ENSBTAP00000025190  rdyflkfayivdldsdtadkflqlfgtkgvkrvlcpinypesptrfthceqvlgegaldrgtyyweveiiegwvsvgv
ENSBTAP00000004156  inffssrsyvtfpewkvqrd..........................................................
ENSBTAP00000010056  rkilkqliadvtldpetahpnlvlsedrksvkf.............................................
ENSBTAP00000001189  fdillglgikkkakkrvqllptkikg....................................................
ENSBTAP00000046960  clvgvardsvkrkgdlslrpedgvwalrlssagiwantspeaelfpalrprrvg........................
ENSBTAP00000055054  ..............................................................................
ENSBTAP00000006018  ..............................................................................
ENSBTAP00000055176  q.............................................................................
ENSBTAP00000003981  lppgslrtmrd...................................................................
ENSBTAP00000033786  nlwlghrcecyrpyrgr.............................................................
ENSBTAP00000042646  dnkeefsrpl....................................................................
ENSBTAP00000043064  ellpspgg......................................................................
ENSBTAP00000033786  nlcepnpchhggicyplwddfscscpvntagkacqelrwcelgpcppgaqclrlprgfecianavfngqsreiifrsn
ENSBTAP00000053179  gdcirtykpeikkgsynn............................................................
ENSBTAP00000011480  idllpspsaa....................................................................
ENSBTAP00000011612  s.............................................................................
ENSBTAP00000029126  erwggfscdcpvgfggkdcrltmahphhfrgngtlswdfgndvavsvp..............................
ENSBTAP00000029938  hscnfdhglcgwirekdsdvhwepvrdpaggqyltvsaakgplgraarlllplghllhag..................
ENSBTAP00000007926  vhlqp.........................................................................
ENSBTAP00000011612  ra............................................................................
ENSBTAP00000018394  hywplenvdgihelqettgdivegkvnkgiylkegkgvtfl.....................................
ENSBTAP00000003981  gramtfhghgflrlalpsdavpltgdvy..................................................
ENSBTAP00000016206  tasffgenhlevpvataltdidlqlefs..................................................
ENSBTAP00000010689  g.............................................................................
ENSBTAP00000018634  ppapvfsflfdekcgynnehlllnlkrdrvesragfnlllaaeriqvgyytsldyiigdvgitkgkhfwafrvepysy
ENSBTAP00000010687  g.............................................................................
ENSBTAP00000024762  k.............................................................................
ENSBTAP00000053727  epcrrrkeesdknyfegtgyarvptqpnapfp..............................................
ENSBTAP00000053802  sgiwprhavkllsvlnqmpq..........................................................
ENSBTAP00000039948  nniyknddfedhgvlgspvitsqkyhweadvsekpawvlgiyggkqneytmkflfenkryqpkysywirgfeydafde
ENSBTAP00000053727  edwklvrsasfsrggqlsftnl........................................................
ENSBTAP00000027783  ytndsaysnfsatvdivegkvnkgiylkegkgvtfl..........................................
ENSBTAP00000047997  rcdfedglcsmirdqslrlgwtkrngligqsppfydhngdmsahflslvsdldstssnissrvflptnnqhacqitfy
ENSBTAP00000009228  yvvqsgrwyfefeavttgemrvgwarpelrpdvelgaddlsyvfnghrgqrwhlgsepfgr.................
ENSBTAP00000048250  gpiyghtsv.....................................................................
ENSBTAP00000046960  rdleyktvsvtldpqsasgylqlsedwk..................................................
ENSBTAP00000044872  qgkigvkfnvgtddiaie............................................................
ENSBTAP00000031529  kksnsl........................................................................
ENSBTAP00000053650  yavkagrwyfefeavtagdmrvgwcrpgcqpdqelgsderafafdgfkaqrw..........................
ENSBTAP00000020240  yavkagrwyfefeavtagdmrvgwcrpgcqpdqelgsderafafdgfkaqrw..........................
ENSBTAP00000025061  mpavqldtqhmgtdvvivkngrricgtggclasaplhqnksyfefkiqstgiwgigvatqkvnlnqiplgrdvhslvm
ENSBTAP00000055305  syavrsgkwyfefevvtggdmrvgwarpgcrpdielgaddqafvfeg...............................
ENSBTAP00000036054  syavrsgkwyfefevvtggdmrvgwarpgcrpdielgaddqafvfeg...............................
ENSBTAP00000054766  gvhsytcrcppgthgpfc............................................................
ENSBTAP00000040914  gvhsytcrcppgthgpfc............................................................
ENSBTAP00000032513  atdfemglglwnhsegwtrnhsaggprypawprgdhtwnsaqgsflasvaepstpavlsspefqasaphncslvfyh.
ENSBTAP00000025458  ahsvnvileaetvhsnlifhqslgekkcdhlpaspgkfyrevkvgdkpgwvlgvcnagtsskenmtlspen.......
ENSBTAP00000023092  llghyiyvdtsfakqgekavllspdlqaeewsclrlvyqiatssgspsdpsrlnlymrfed.................
ENSBTAP00000054766  hctcpanftgptcaqqlwcpgqpclppatceevpdgfvcvaeatfregppaefsghnassgsalsgl...........
ENSBTAP00000009351  evpcfhalprglwpgqviivrglvlpepkdftlslrdeaahvpvtlrasfad..........................
ENSBTAP00000040914  hctcpanftgptcaqqlwcpgqpclppatceevpdgfvcvaeatfregppaefsghnassgsalsgl...........
ENSBTAP00000011612  qvsmmfdgqs....................................................................
ENSBTAP00000054766  hcdcprpyrgptcadevpaatfglggtlssa...............................................
ENSBTAP00000053495  hnhsasfifgnhqsc...............................................................
ENSBTAP00000040914  hcdcprpyrgptcadevpaatfglggtlssa...............................................
ENSBTAP00000003981  kpcarskstgdpwltdgsyldgsgfarismesqlsntkrfdqelrlvsysgiifflqhqdqflclavqegklvllydf
ENSBTAP00000053932  qgkigvkfnvgtddiaiee...........................................................
ENSBTAP00000053616  csyasrdrgwvvgihtvsdqgn........................................................
ENSBTAP00000048757  clvgvvresvvrrgflnftpegiwtpqlssagvsictspepfqi..................................
ENSBTAP00000044383  ilvdgdtlsyhgnsgevgcyvasrpltkdsnyfevsivdsgvrgtiavglvpqyysldhqpgwlpdsvayhaddgkly
ENSBTAP00000026111  pcahggscrprkegyecdcplgfeglhcqkaiteaieipqfigrsyltydnpdilkrvsgsrsn..............
ENSBTAP00000009703  agfycdfedgfcgwtqsspsphttqwqvrtlkdarfqdhqghalllsitdaptsenatvtsatfpapmknspcelrms
ENSBTAP00000022475  gatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflqlhirqgelavviafssvslqs
ENSBTAP00000003981  kvpmkfngssgvqlrtprdltnlasstalkfylqspeptagqvtg.................................
ENSBTAP00000048250  ynginitdlarrkklepsnvgnlsfs....................................................
ENSBTAP00000005537  qpgiffppgtgaefglqeiprph.......................................................
ENSBTAP00000014043  tsrerlaiskdqravrsvpglplllaaerlltgchlsvdvvlgdvavtqgrsywacavdpasylvkvgvglesklqes
ENSBTAP00000048757  rdleyktmriilnsqrangyls........................................................
ENSBTAP00000044383  dvglaqarrplstrshyfeveivdpgekcyialglarkdypknrhpgwsrg...........................
ENSBTAP00000037559  yqvsvaksvs....................................................................
ENSBTAP00000053727  vavpmrfngrsg..................................................................
ENSBTAP00000022474  gatyifgksgglilytwpandrpstrsdrlavgfsttvkdgilvridsapglgdflqlhirqgelavviafssvslqs
ENSBTAP00000036460  psvlqpi.......................................................................
ENSBTAP00000003367  rqqllqyacdivfd................................................................
ENSBTAP00000041534  pdgyymlldpknakasqksvllspliqssgclslsfhyllrgrs..................................
ENSBTAP00000055305  kwyfeliidqvdpfltaepthlrvgwasssgyapypgggegwggngvgddlysygfdglhlwsgripravasinqhll
ENSBTAP00000036054  kwyfeliidqvdpfltaepthlrvgwasssgyapypgggegwggngvgddlysygfdglhlwsgripravasinqhll
ENSBTAP00000054517  lepfkmtpfsaiglelwsmt..........................................................
ENSBTAP00000038137  yfnlshsmagisvpsiq.............................................................
ENSBTAP00000053650  kwyyelmvdhtepfvtaeath.........................................................
ENSBTAP00000020240  kwyyelmvdhtepfvtaeath.........................................................
ENSBTAP00000056645  yfnlshsmagisvpsiq.............................................................
ENSBTAP00000047997  cqacgfafdmcdwvseatagqtswmrtkareipvlenapqqhqssddegyclwig.......................
ENSBTAP00000053365  rffpppsglsysswfciehfssppsnhpvrlltvvrran.......................................
ENSBTAP00000017949  rffpppsglsysswfciehfssppsnhpvrlltvvrran.......................................
ENSBTAP00000042505  llfhpncgqkaaithegrtalrphatddfnhgvvlssralrdgevfqvridkmvdkwagsieigvtthnpaylqlpst
ENSBTAP00000009228  kwyfevmvdevvpfltaqathlrvgwaltegyspypgggegwggngvgddlysygfdglhlw................
ENSBTAP00000036054  qcyyairifagqdpscvwvgwvtpdyhlysekfdlnknctvtvtlgdergrvhesvkrsncy................
ENSBTAP00000032513  cgttdfeslsgggwedasvgrlqwvr....................................................
ENSBTAP00000055305  qcyyairifagqdpscvwvgwvtpdyhlysekfdlnknctvtvtlgdergrvhesvkrsncy................
ENSBTAP00000042505  rlvslsacgrtarrqqpgqefnhglvlsreplrdgrvftvridrkvnswsgsieigvtaldpnvldfpssatglkggs
ENSBTAP00000031529  cggsctfekgwcgw................................................................
ENSBTAP00000002970  ypv...........................................................................
ENSBTAP00000009228  yyysvrvfagqepscvwvgwvtpdyhqhdmnfdlskvravtvtmgdeqgnihsslkcsncymvwggdfvspgqqgris
ENSBTAP00000056398  sshsvl........................................................................
ENSBTAP00000031529  lilfpghflyleatpvglrgeeahlksglwqessas..........................................
ENSBTAP00000000063  ttg...........................................................................
ENSBTAP00000002071  hpflltsfralglelwsmtsdi........................................................


                                                                                                    
                                                                                                    
d2erfa1               ..............................................................................
ENSBTAP00000002600  srfyvvmwkq....................................................................
ENSBTAP00000036460  ..............................................................................
ENSBTAP00000006074  ..............................................................................
ENSBTAP00000000063  ..............................................................................
ENSBTAP00000042078  srfyvvmwkqvt..................................................................
ENSBTAP00000054517  pfifdtkplivqyevnfqngiecggayvkllsktpelnldqfh...................................
ENSBTAP00000046571  gdglaiwytkdrmqpgpvfgnmdkfvglgvfvdtypneekqqervfpyisamvnngslsydherdgrptelggctaiv
ENSBTAP00000002071  fifadkplvvqyevnfqdgidcggayiklladtdglnlenfydktsytimfgpdkcgedyklhfifrhkhpktgvfee
ENSBTAP00000005195  gdglaiwytkdrmqpgpvfgnmdkfvglgvfvdtypneekqqeaqkrryspgvqrvfpyisamvnngslsydherdgr
ENSBTAP00000010569  dgialwytrdrlvpgpvfgskdnfhglaifldtypndetterv...................................
ENSBTAP00000001158  gvcedsvcrkggvtsapqngfwavslwygkeywaltspmtalplrtplqr............................
ENSBTAP00000008979  nqglegpvfgsadmwngvgif.........................................................
ENSBTAP00000018459  vcrdnvrrkgqfllnsdtgfwiiwlwnkqkyeagtcpqtplhlqvpp...............................
ENSBTAP00000054004  vcrdnvrrkgqfllnsdtgfwiiwlwnkqkyeagtcpqtplhlqvpp...............................
ENSBTAP00000011393  vgickdsvsrkgnlpkppgdlfsliglkigddyslwvssplkgqhvrepvhk..........................
ENSBTAP00000034027  gthavvgvatadaplhsvgyttlignnheswgwdlgrnrlyhdgknqpsktypaflepdetfivpdsfl.........
ENSBTAP00000015061  drkevvflsphygfwvirlrkgneyragtdeypllslpvpprr...................................
ENSBTAP00000009824  lgvcqdtvsrkgeitpspengvwamwllkgseymvlaspsvpl...................................
ENSBTAP00000012013  havvgvataraplhsvgytalvgsdaeswgwdlgrsrlyhdgknrpgvaypaflgpeeafalpdsll...........
ENSBTAP00000009893  lrkgscpltpeqgfwllrlrnqtdlkaldfp...............................................
ENSBTAP00000013175  ..............................................................................
ENSBTAP00000042458  gvcrenvmkkgfdpmtpengfwavelygngywaltplrtplplagpprrv............................
ENSBTAP00000020111  vkheqnidcgggyvklfpagldqtdmhgdseynimfgpdicg....................................
ENSBTAP00000024852  vcrenanrkekgelfagngfwilvflgsyynsserafaplrdpprrvg..............................
ENSBTAP00000036910  rnnvarnemvtmspqngfwairlydgey..................................................
ENSBTAP00000028561  qgmavwytrgrgqvgpvlgepdlgdgig..................................................
ENSBTAP00000024658  vcmenvqrdtvmpqtpqsgfwairrckegyvaltspltsihltekp................................
ENSBTAP00000055797  vcrdnvtrkgrvtmspkngfwairfyegeywaltspetplilrekp................................
ENSBTAP00000055913  vclaavpragharmspatgywvmglwnsceyfvldqhrvpls....................................
ENSBTAP00000027907  rrkgltpftpeeg.................................................................
ENSBTAP00000033248  ..............................................................................
ENSBTAP00000045818  eiswpreqrgthavvgvataraplqadhyaallgsnseswgwdigrgklyhqskgpgapqyppgpqgeplevperll.
ENSBTAP00000047271  wevwwegplgtvavigiatkrapmqcq...................................................
ENSBTAP00000011391  gvyrsstvrns...................................................................
ENSBTAP00000027551  laheaasrkgsiqiqpsrgfycivmhdgnqysactepwtrl.....................................
ENSBTAP00000022024  sdvdldkyhhtfcsllgrdedswglsytgllhhkgd..........................................
ENSBTAP00000007623  vikgtasrkgklskspehgvwliglkegrvyeafgcprvplpva..................................
ENSBTAP00000015712  s.............................................................................
ENSBTAP00000009025  kmhmpfqrgcsfe.................................................................
ENSBTAP00000009005  kmhmpfqrgcsfe.................................................................
ENSBTAP00000012653  ..............................................................................
ENSBTAP00000013346  ..............................................................................
ENSBTAP00000013398  ..............................................................................
ENSBTAP00000013121  icygsmerqgpesrlgrnnaswcve.....................................................
ENSBTAP00000026179  sthhkek.......................................................................
ENSBTAP00000055851  gvnrkglyiesphkgfwtvgrfergycactvp..............................................
ENSBTAP00000024853  lgvcrdnvsrrnrvpkspengfwvvqlckgkr..............................................
ENSBTAP00000021701  ..............................................................................
ENSBTAP00000044710  sakfycvsffyhmyg...............................................................
ENSBTAP00000041298  ..............................................................................
ENSBTAP00000001294  kgawyfeitvdemppdtaarlgwsqpl...................................................
ENSBTAP00000021701  ..............................................................................
ENSBTAP00000007366  cnikfavqqstsyenaysiyrpqfgywviglkdkfryeafedsstthpdsrvltlsmtvp..................
ENSBTAP00000009909  ..............................................................................
ENSBTAP00000029287  gvayksapknewigknasswvfsrcnsnfvvrhnnkemlvdvppqlkr..............................
ENSBTAP00000009005  ..............................................................................
ENSBTAP00000009025  ..............................................................................
ENSBTAP00000054057  cnikfavqqstsyenaysiyrpqfgywviglkdkfryeafedsstthpdsrvltlsmtvp..................
ENSBTAP00000006913  ..............................................................................
ENSBTAP00000043820  ..............................................................................
ENSBTAP00000056333  ..............................................................................
ENSBTAP00000018469  ..............................................................................
ENSBTAP00000018010  ..............................................................................
ENSBTAP00000046313  dterqywevevntrteagsttrcalgicsetvkregwfvespdknfwvlvheegkvvfpnsqknspslrqq.......
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000020080  ..............................................................................
ENSBTAP00000052704  cgekcentiyqpkngywviglkhdsvynafessfsgp.........................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000029126  ..............................................................................
ENSBTAP00000023900  lcndswaresdma.................................................................
ENSBTAP00000034496  srlrp.........................................................................
ENSBTAP00000053345  yfvssksn......................................................................
ENSBTAP00000005971  cgekcedimklpsklgncgngncqnvysryqpkngywviglkhycvynafdassfsdpvilp................
ENSBTAP00000028802  ..............................................................................
ENSBTAP00000011769  ..............................................................................
ENSBTAP00000054738  ..............................................................................
ENSBTAP00000004870  cgekcentiyqpkngywviglkhdsvynafessfsgp.........................................
ENSBTAP00000018010  ..............................................................................
ENSBTAP00000021676  glckeswtsrndmllnsedi..........................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000022890  ..............................................................................
ENSBTAP00000053970  vgvaselvprkgmlqieplsgfwalriagsecqaltetgtredlsvcl..............................
ENSBTAP00000035935  apknpygptntaycfsff............................................................
ENSBTAP00000056432  fqrgqpfdvlliateegfkav.........................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000009351  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000053511  rkgsgsdsrlgcnafswvfsrygqd.....................................................
ENSBTAP00000042181  fqrgqpfdvlliateegfkav.........................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000019994  dvprqedlganrlswcmrhafas.......................................................
ENSBTAP00000037239  agrrgrlhavpsqglwllglrdgkileahveakepralrtperrp.................................
ENSBTAP00000032103  efwavgrfergycvctvpq...........................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000014522  ..............................................................................
ENSBTAP00000002600  ..............................................................................
ENSBTAP00000054736  kdmmlgkddkawamyvdnnrswfmhcnshtnrteggvckgat....................................
ENSBTAP00000054420  ..............................................................................
ENSBTAP00000053498  lysqkgl.......................................................................
ENSBTAP00000027527  ..............................................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000042078  ..............................................................................
ENSBTAP00000056054  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000051925  diltsdtiirinyeeafllfsekvndqyslftn.............................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000028276  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000026133  ..............................................................................
ENSBTAP00000042592  ..............................................................................
ENSBTAP00000023889  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000026471  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000013075  evschdqglcrvgwss..............................................................
ENSBTAP00000000793  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000029353  ..............................................................................
ENSBTAP00000049986  ..............................................................................
ENSBTAP00000028721  ttgdvigc......................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000013134  rqdagteghahscyhdtrsgf.........................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000037790  spplggrp......................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000054149  ..............................................................................
ENSBTAP00000000788  ..............................................................................
ENSBTAP00000020299  ..............................................................................
ENSBTAP00000013292  ..............................................................................
ENSBTAP00000000458  ksiftsdtsisigaeeayf...........................................................
ENSBTAP00000012225  msrdscigvddrswvf..............................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000000179  yfpfipdqpf....................................................................
ENSBTAP00000042771  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000005332  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000053720  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000017120  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000017857  wlqntfaakhn...................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000027839  ..............................................................................
ENSBTAP00000053422  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000017783  ..............................................................................
ENSBTAP00000005537  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000011863  ..............................................................................
ENSBTAP00000053409  ttsdmwlyraysgnl...............................................................
ENSBTAP00000018697  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000026725  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000013440  ..............................................................................
ENSBTAP00000006786  ..............................................................................
ENSBTAP00000032513  ttasclrfwyhmgfpeh.............................................................
ENSBTAP00000025424  tpgyvpgyhgp...................................................................
ENSBTAP00000054985  ..............................................................................
ENSBTAP00000004114  sldscstqlgeepfsygyggtgkkstnsrfen..............................................
ENSBTAP00000045584  qfflynsgseddqlniyireystahlsrtltlve............................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000053569  ..............................................................................
ENSBTAP00000012117  vckdswirkddgildt..............................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000008967  swymhcsepqrytffysgivsdvhvter..................................................
ENSBTAP00000005686  ..............................................................................
ENSBTAP00000031460  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000007877  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000001200  ..............................................................................
ENSBTAP00000034542  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000024358  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000006361  d.............................................................................
ENSBTAP00000032513  elrlwyhvasgdvaelrlelt.........................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000054420  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000023376  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000016055  ivifldyedsdisf................................................................
ENSBTAP00000003261  ..............................................................................
ENSBTAP00000053720  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000004156  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000054276  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000037835  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000015885  yqat..........................................................................
ENSBTAP00000041534  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000016206  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000053566  ..............................................................................
ENSBTAP00000048368  gwsl..........................................................................
ENSBTAP00000025190  maedfspqepydrgrlgrnayscc......................................................
ENSBTAP00000004156  ..............................................................................
ENSBTAP00000010056  ..............................................................................
ENSBTAP00000001189  ..............................................................................
ENSBTAP00000046960  ..............................................................................
ENSBTAP00000055054  ..............................................................................
ENSBTAP00000006018  ..............................................................................
ENSBTAP00000055176  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000043064  ..............................................................................
ENSBTAP00000033786  gni...........................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000011480  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000029126  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000007926  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000018394  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000016206  ..............................................................................
ENSBTAP00000010689  ..............................................................................
ENSBTAP00000018634  lvkagvassdklqewlrs............................................................
ENSBTAP00000010687  ..............................................................................
ENSBTAP00000024762  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000053802  ..............................................................................
ENSBTAP00000039948  ssssgplil.....................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000027783  ..............................................................................
ENSBTAP00000047997  cfssq.........................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000048250  ..............................................................................
ENSBTAP00000046960  ..............................................................................
ENSBTAP00000044872  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000025061  rndgalyhnne...................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000025458  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000009351  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000003981  gag...........................................................................
ENSBTAP00000053932  ..............................................................................
ENSBTAP00000053616  ..............................................................................
ENSBTAP00000048757  ..............................................................................
ENSBTAP00000044383  ngrakgrqfgskcnsgdrigcgiep.....................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000009703  wlirgvlqgnvslmlvenktgkeqsrmiwrvatleglslwqwtv..................................
ENSBTAP00000022475  qtqphpresgkkhtfqfssgsgdsrekv..................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000048250  ..............................................................................
ENSBTAP00000005537  ..............................................................................
ENSBTAP00000014043  fqgapdvisprydpdsghdsgaedatveasp...............................................
ENSBTAP00000048757  ..............................................................................
ENSBTAP00000044383  ..............................................................................
ENSBTAP00000037559  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000022474  qtqphpresgknqafqfssgsgdsrekvtswrtnrtnplgrql...................................
ENSBTAP00000036460  ..............................................................................
ENSBTAP00000003367  ..............................................................................
ENSBTAP00000041534  ..............................................................................
ENSBTAP00000055305  ksddvvsc......................................................................
ENSBTAP00000036054  ksddvvsc......................................................................
ENSBTAP00000054517  ..............................................................................
ENSBTAP00000038137  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000056645  ..............................................................................
ENSBTAP00000047997  ..............................................................................
ENSBTAP00000053365  ..............................................................................
ENSBTAP00000017949  ..............................................................................
ENSBTAP00000042505  mtnlrsgtwmmtgngvmhngttildeyghnldrlkagdtvg.....................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000042505  wvvsgcsvlrdgrsvleeygqdldqlgegdr...............................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000002970  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000056398  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000000063  ..............................................................................
ENSBTAP00000002071  ..............................................................................


                                          10               20         30                40        50
                                           |                |          |                 |         |
d2erfa1               ............-SVFDIFELTGAA.RK....GSG..RR.LVKGPDPSSP.......AFR.IEDANLIPPVPDDKFQD
ENSBTAP00000002600  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036460  ............-------------.--....---..--.----------.......---.---------QTDDDYAG
ENSBTAP00000006074  ............-------------.--....---..--.----------.......---.FEGTFHVNTATDDDYAG
ENSBTAP00000000063  ............-------------.--....---..--.----------.......---.FEGTFHVNTVTDDDYAG
ENSBTAP00000042078  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054517  ............-------------.--....---..--.----------.......---.--------DKTPYTIMF
ENSBTAP00000046571  ..........rn-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000002071  .khakppdvdlk-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000005195  ptelggctaivr-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000010569  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000001158  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000008979  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000018459  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054004  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000011393  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000034027  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000015061  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009824  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000012013  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009893  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000013175  ............-------------.--....---..--.----------.......-FR.LSSGNFYGHKEKDK---
ENSBTAP00000042458  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000020111  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000024852  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036910  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000028561  ............-------------.--....---..--.----------.......-I-.-----------------
ENSBTAP00000024658  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000055797  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000055913  ............-------------.--....---..V-.----------.......---.-----------------
ENSBTAP00000027907  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000033248  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000045818  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000047271  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000011391  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000027551  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000022024  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000007623  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000015712  ............-------------.--....---..--.-----DSMGP.......AFS.FNQFA-------NNRNV
ENSBTAP00000009025  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009005  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000012653  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000013346  ............-------------.--....---..--.----------.......---.------------DPGSA
ENSBTAP00000013398  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000013121  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000026179  ............---------V---.--....---..--.----------.......---.-----------------
ENSBTAP00000055851  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000024853  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000021701  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000044710  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000041298  ............-------------.--....---..--.----------.......---.---------------LP
ENSBTAP00000001294  ............-------------.--....---..--.----------.......---.--------------G--
ENSBTAP00000021701  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000007366  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009909  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000029287  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009005  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009025  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054057  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000006913  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000043820  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000056333  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000018469  ............-------------.--....---..--.----------.......AFV.FPKETENSYVSLKT---
ENSBTAP00000018010  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000046313  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053488  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000017563  ............-------------.--....---..--.----------.......---.FGGHS---FLAFPT---
ENSBTAP00000020080  ............-------------.--....---..--.---------Pgsvvev.CIS.FNQTDLTIKLPDGYEFK
ENSBTAP00000052704  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000031529  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000023092  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000029126  ............-------------.--....---..--.----------.......---.-----------PPSSFV
ENSBTAP00000023900  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000034496  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053345  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000005971  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000028802  ............-------------.--....---..--.---------Pgsevkl.IVT.FENNEFKVKLPDGHQLT
ENSBTAP00000011769  ............-------------.--....---..--.----------.......---.------------YMYAK
ENSBTAP00000054738  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000004870  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000018010  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000021676  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042993  ............---IDVLTELELG.ES....TTG..VR.QVPGLHNGTK.......AFL.FQDTPRSIKASTATAEQ
ENSBTAP00000022890  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053970  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000035935  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000056432  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053607  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000026956  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009351  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000022744  ............-------------.--....---..--.----------.......---.---------SGTDSYLA
ENSBTAP00000053511  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042181  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000026111  ............-------------.--....---..--.----------.......---.----------------V
ENSBTAP00000019994  ............-------------.--....---..--.----------.......---.----------S------
ENSBTAP00000037239  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000032103  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000010571  ............-------------.--....---..--.----------.......---.------------PQSFV
ENSBTAP00000014522  ............-------------.--....---..--.----------.......---.--------------YAR
ENSBTAP00000002600  ............--VFDIFELTGAA.RK....GSG..RR.LVKGPDPSSP.......AFR.IEDANLIPPVPDKKFQD
ENSBTAP00000054736  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054420  ............-------------.--....---..--.----------.......---.--------------SFI
ENSBTAP00000053498  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000027527  ............-------------.--....---..--.--SGQCPGSA.......SVT.FTGNS---FVKYR----
ENSBTAP00000026111  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025424  ............-------------.--....---..--.---------D.......VLY.FDGDD-------AISYR
ENSBTAP00000032310  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042078  ............--AFDLFSISNIN.RK....TIG..AK.QFRGPDPSVP.......AYR.FVRFDYIPPVSAEHLGR
ENSBTAP00000056054  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025033  ............-------------.--....---..--.----------.......---.--------------SFI
ENSBTAP00000051925  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000017563  ............-------------.--....---..--.-IEKSAGDLD.......ALA.FDGRTYIEYLNAVT---
ENSBTAP00000000307  ............-------------.--....---..--.----------.......---.------PVTFKSRSSYL
ENSBTAP00000028276  ............--PVDVLKALDFH.NS....PEG..IS.KTMGFCTNRKnskgsdtAYR.VSKQA---QLSAPTKQL
ENSBTAP00000022744  ............-------------.--....---..--.----------.......--Y.FYDNG---FLALPGR-I
ENSBTAP00000026133  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042592  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000023889  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053469  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000033006  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053469  ............-------------.--....---..--.----------.......---.-------ITFETPESFI
ENSBTAP00000026956  ............-------------.--....---..--.----------.......---.-------ITFETPESFI
ENSBTAP00000033006  ............-------------.--....---..--.----------.......---.-------ITFETPESFI
ENSBTAP00000026471  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042646  ............-------------.--....---..--.----------.......---.-------TFVNSSSSYL
ENSBTAP00000013075  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000000793  ............--PVDVLRALRFP.AL....PDG..VR.RARGICPADV.......AYR.VSRPA---QLSAPTRQL
ENSBTAP00000036729  ............-------------.--....---..--.----------.......--R.FDQKS------------
ENSBTAP00000001939  ............-------------.--....---..--.----------.......---.--------------GYI
ENSBTAP00000029353  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000049986  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000028721  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000035185  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053469  ............-------------.--....---..--.----------.......---.-----DPVTFKTKSSYV
ENSBTAP00000026956  ............-------------.--....---..--.----------.......---.-----DPVTFKTKSSYV
ENSBTAP00000033006  ............-------------.--....---..--.----------.......---.-----DPVTFKTKSSYV
ENSBTAP00000053469  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000024169  ............-------------.--....---..--.----------.......---.----------------L
ENSBTAP00000013134  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036729  ............-------------.--....---..--.----------.......-T-.--------FLSPRSYLA
ENSBTAP00000037790  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053179  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054149  ............-------------.--....---..--.----------.......---.--------TFPPSTGPT
ENSBTAP00000000788  ............-------------.--....---..--.----------.......---.--------TFPPSTGPT
ENSBTAP00000020299  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000013292  ............---LDLTELVGV-.PL....PSS..VS.FVAG-YGGFP.......AYS.FGPGA---NVGRPARTL
ENSBTAP00000000458  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000012225  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036729  ............-------------.--....---..--.----------.......---.FWNSA---SFNTEASYL
ENSBTAP00000008454  ............-------------.--....---..--.----------.......---.--------FLSSRS-YL
ENSBTAP00000017076  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000000179  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042771  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000046486  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000031529  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000005332  ............-------------.--....---..--.-----CSGHT.......SLS.FAGNS---YIKYRL---
ENSBTAP00000008454  ............-------------.--....---..--.----------.......---.FWNSA---SFNTETSYL
ENSBTAP00000053720  ............-------------.--....---..--.----------.......---.-------ASFPNPSSYL
ENSBTAP00000035185  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000017120  ............-------------.--....---..--.----------.......VFI.FPEQSDTA-----YVTL
ENSBTAP00000053179  ............-------------.--....---..--.----------.......---.FDGTG---------FAK
ENSBTAP00000011612  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000032513  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000017857  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000008454  ............-------------.--....---..--.-VYGCAYRSE.......MVH.FDGKS-------SLLYT
ENSBTAP00000027839  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053422  ............-PGFDLISQFQID.KA....ASRraIQ.RVVGSTALQV.......AYK.LGNNV---DFRIPTRHL
ENSBTAP00000000307  ............-------------.--....---..--.----------.......---.--------TFESPEAFV
ENSBTAP00000017783  ............---FKMMEMFGLV.EKefssVEG..VS.MEPGTFNVYP.......CYQ.LHKDA---LVSQPTKYL
ENSBTAP00000005537  ............-------------.--....---..--.----TTEDSP.......ALH.LSSGPGQEPVTIMTFN-
ENSBTAP00000017563  ............-------------.--....---..--.----------.......-AD.FSSFS---YLELKGLHT
ENSBTAP00000031529  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000000307  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000011863  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053409  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000018697  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000024169  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000033006  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000026956  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000026725  ............--GFKMLEAYNLT.EKnfasVQG..VS.LESGSFPSYS.......SYR.LQKNA---FVNQPTVEL
ENSBTAP00000022744  ............-------------.--....---..--.----------.......---.--PYS---FLPLPTIKD
ENSBTAP00000011612  ............-------------.--....---..--.--------EH.......AYQ.YGGTA----NSRQEFEH
ENSBTAP00000013316  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025424  ............-------------.--....---..--.----------.......AFRcLDPVPHPINFGGPHNFV
ENSBTAP00000042646  ............-------------.--....---..--.----------.......---.----------TSLLYLK
ENSBTAP00000024169  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000000307  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000013440  ............--PVDVLKALGMR.GG....QAG..IP.EGPGLCPQRVpegdr..AFR.VGKTG---TLGVPTQEL
ENSBTAP00000006786  ............-------------.--....---..--.---------P.......ALI.FPNAS-----TMNVGFL
ENSBTAP00000032513  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025424  ............-------------.--....---..--.----------.......GYR.LPDYPRPGRPVPGYRGP
ENSBTAP00000054985  ............---ADLLKVLDFH.NL....PDG..IT.KTTGFCAARRsskgpdvAYR.VTKDA---QLSAPTKQL
ENSBTAP00000004114  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000045584  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053179  ............-------------.--....---..--.----------.......---.-DGEG-YALVSRPIR--
ENSBTAP00000053569  ............-------------.--....---..--.----------.......--N.FPGKSA-----AAIALP
ENSBTAP00000012117  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053727  ............-------------.--....---..--.----------.......---.------HIILANSV---
ENSBTAP00000008967  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000005686  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000031460  ............-------------.--....---..--.----------.......---.------------RTEDV
ENSBTAP00000053495  ............-------------.--....---..--.----------.......--R.FTGHG---YYKFPSST-
ENSBTAP00000007877  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000024169  ............-------------.--....---..--.----------.......---.---------LRGGYVEL
ENSBTAP00000031529  ............-------------.--....---..--.----------.......--N.SSGPKEGYTARITTSQY
ENSBTAP00000036729  ............-------------.--....---..--.----------.......---.-SKNS-----SSHAASF
ENSBTAP00000001200  ............--DVDVLQQLGLS.WTka..VGG..RSpPPPGVIPFQT.......GFI.FTQRA---RLQAPTAAV
ENSBTAP00000034542  ............-------------.--....---..-A.MVHDPD-VGS.......AYE.FGEDG--SGGGQAARRL
ENSBTAP00000000307  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053495  ............-------------.--....---..--.----------.......---.--------FLGTGFLEL
ENSBTAP00000024169  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000023092  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000024358  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000000307  ............-------------.--....---..--.----------.......-YI.FGKGGALITYTW-----
ENSBTAP00000006361  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000032513  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053727  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054420  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000032310  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000023376  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042646  ............-------------.--....---..--.----------.......---.--------NVSLSSSAI
ENSBTAP00000016055  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000003261  ............-------------.--....--N..--.----------.......---.-----------------
ENSBTAP00000053720  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025033  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000004156  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025424  ............-------------.--....---..--.----------.......---.---------------LR
ENSBTAP00000054276  ............-------------.--....---..--.----------.......---.------AVSVTQPTRRV
ENSBTAP00000023092  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000037835  ............-------------.--....---..--.----------.......---.------AVSVTQPTRRV
ENSBTAP00000032513  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000008454  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000010571  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000015885  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000041534  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000023842  ............-------------.--....---..--.----------.......---.----------------L
ENSBTAP00000013316  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053179  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000033786  ............-------------.--....---..--.YTGSRCGTVT.......TLS.FLGSGFLWVSSGSA---
ENSBTAP00000016206  ............-------------.--....---..--.----------.......---.----------SGPYSLA
ENSBTAP00000003981  ............-------------.--....---..--.----------.......--F.FTGSGGTVTLDT-----
ENSBTAP00000053566  ............-------------.--....---..--.---------T.......AVR.FSGQS-------FGRYR
ENSBTAP00000048368  ............-------------.--....---..--.----------.......---.----------------T
ENSBTAP00000025190  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000004156  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000010056  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000001189  ............-------------.--....---..--.----------.......-YE.ITSK---VDLSEFTSNV
ENSBTAP00000046960  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000055054  ............-PGFDLMAAFGLV.EKeyasIRG..VA.MEPSAFGPTR.......TFT.LFKDS---QLTRRASDI
ENSBTAP00000006018  ............-PGFDLMAAFGLV.EKeyasIRG..VA.MEPSAFGPTR.......TFT.LFKDS---QLTRRASDI
ENSBTAP00000055176  ............--GFDLMAAFGLV.EKeyasIRG..VA.MEPSAFGPTR.......TFT.LFKDS---QLTRRASDI
ENSBTAP00000003981  ............-------------.--....---..--.----------.......TYQ.FGGP----LTSYLEFAH
ENSBTAP00000033786  ............-------------.--....---..--.---SCHGEYV.......AGR.FGQDD----SPGYAVFH
ENSBTAP00000042646  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000043064  ............------------SwNW....TIG..LP.TDNGHDSDQ-.......VFE.FNGT-QAVRVPDGIVSV
ENSBTAP00000033786  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053179  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000011480  ............------------T.NW....TIG..LL.V----DSSEM.......IFK.FDGRQ-GAKIPDGV---
ENSBTAP00000011612  ............-------------.--....---..--.----------.......-YF.FDGSSYAIVRDITRRGK
ENSBTAP00000029126  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000029938  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000007926  ............-------------.--....---..--.HMRRHHSGTD.......ALY.FSGLEGAFGTVNPKYHP
ENSBTAP00000011612  ............-------------.--....---..--.----------.......--Y.FNGQS---YIASSQKIS
ENSBTAP00000018394  ............-------------.--....---..--.----------.......YYR.KNKTS---CISNPA---
ENSBTAP00000003981  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000016206  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000010689  ............--EVDLLPMPGPNaNW....TAG..LS.VHYSQDSSL-.......IYW.FNGT-QAVQVPLGGAAG
ENSBTAP00000018634  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000010687  ............--EVDLLPMPGPNaNW....TAG..LS.VHYSQDSSL-.......IYW.FNGT-QAVQVPLGGAAG
ENSBTAP00000024762  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053727  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053802  ............-------------.--....---..--.----RHGPDT.......FFN.FPGCS-----AAAIALP
ENSBTAP00000039948  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053727  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000027783  ............-------------.--....---..--.----------.......YYR.KNKTS---CISNPA---
ENSBTAP00000047997  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009228  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000048250  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000046960  ............-------------.--....---..--.----------.......---.---------------C-
ENSBTAP00000044872  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000031529  ............-------------.--....---..--.----------.......---.----------SQIARLQ
ENSBTAP00000053650  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000020240  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025061  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000055305  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036054  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054766  ............-------------.--....---..--.----------.......---.-GQNT---TFSMVAGNP
ENSBTAP00000040914  ............-------------.--....---..--.----------.......---.-GQNT---TFSMVAGNP
ENSBTAP00000032513  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000025458  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000023092  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054766  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009351  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000040914  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000011612  ............-------------.--....---..--.----------.......---.-------------AVEV
ENSBTAP00000054766  ............-------------.--....---..--.----------.......---.--------------SFL
ENSBTAP00000053495  ............-------------.--....---..--.----------.......---.--------FASPPAP--
ENSBTAP00000040914  ............-------------.--....---..--.----------.......---.--------------SFL
ENSBTAP00000003981  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053932  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053616  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000048757  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000044383  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000026111  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009703  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000022475  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000003981  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000048250  ............-------------.--....---..--.----------.......--C.VEPYTVPVFFNATSYLE
ENSBTAP00000005537  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000014043  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000048757  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000044383  ............-------------.--....---..--.--------SV.......AY-.-----------------
ENSBTAP00000037559  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053727  ............-------------.--....---..--.----------.......---.-------------VEVR
ENSBTAP00000022474  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036460  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000003367  ............-------------.--....---..--.----PDTAHR.......YLR.LQDDNRKVTNTAPWEHP
ENSBTAP00000041534  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000055305  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036054  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000054517  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000038137  ............-------------.--....---..--.----------.......---.----------------K
ENSBTAP00000053650  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000020240  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000056645  ............-------------.--....---..--.----------.......---.----------------K
ENSBTAP00000047997  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000053365  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000017949  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042505  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009228  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000036054  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000032513  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000055305  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000042505  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000031529  ............-------------.--....---..--.----------.......---.--QNSLAENFDWILGVG
ENSBTAP00000002970  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000009228  ............-------------.--....---..--.----------.......---.-------------H---
ENSBTAP00000056398  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000031529  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000000063  ............-------------.--....---..--.----------.......---.-----------------
ENSBTAP00000002071  ............-------------.--....---..--.----------.......---.-----------------


                                    60                        70                                80  
                                     |                         |                                 |  
d2erfa1               L....VDA.VRTEK.GF...L.LLASLR.Q...........MKK...TR.G.......T..LL...........ALE.
ENSBTAP00000002600  -....---.-----.--...-.------.V...........---...--.-.......-..--...........---.
ENSBTAP00000036460  F....IFG.YQDSS.SF...Y.VVMW--.-...........---...--.-.......-..--...........---.
ENSBTAP00000006074  F....IFG.YQDSS.SF...Y.VVMW--.-...........---...--.-.......-..--...........---.
ENSBTAP00000000063  F....LFS.YQDSG.RF...Y.VVMW--.-...........---...--.-.......-..--...........---.
ENSBTAP00000042078  -....---.-----.--...-.------.-...........-Q-...--.-.......-..--...........---.
ENSBTAP00000054517  G....PDK.CGED-.-Y...K.LHFIFR.H...........---...--.-.......-..--...........---.
ENSBTAP00000046571  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000002071  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000005195  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000010569  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000001158  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000008979  -....---.-----.--...-.------.-...........---...--.-.......-..-F...........---.
ENSBTAP00000018459  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000054004  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000011393  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000034027  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000015061  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009824  -....---.-----.--...-.------.-...........---...--.-.......-..--...........--L.
ENSBTAP00000012013  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009893  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000013175  G....LQT.TQNSR.FY...A.ISARFK.P...........FSN...KG.K.......T..LI...........IQY.
ENSBTAP00000042458  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000020111  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000024852  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036910  -....---.-----.--...-.---WVL.T...........TPE...TS.L.......T..L-...........---.
ENSBTAP00000028561  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000024658  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000055797  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000055913  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000027907  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000033248  -....---.-----.-Y...A.LSTRFK.P...........FSN...EN.E.......T..LV...........VQF.
ENSBTAP00000045818  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000047271  -....---.-----.--...-.------.-...........---...--.G.......-..--...........---.
ENSBTAP00000011391  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000027551  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000022024  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000007623  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000015712  Y....SRY.QPQSG.YW...V.IGLHHK.Heyray......EES...ST.S.......L..LL...........SMT.
ENSBTAP00000009025  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009005  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000012653  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000013346  H....SDI.IFSND.NL...T.VTC---.-...........SSY...DD.R.......V..VL...........GKT.
ENSBTAP00000013398  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000013121  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000026179  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000055851  -....---.-----.--...-.------.-...........---...--.Q.......T..LL...........SLM.
ENSBTAP00000024853  -....---.-----.--...-.------.-...........--Y...--.-.......-..--...........---.
ENSBTAP00000021701  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000044710  -....---.-----.--...-.------.-...........KHI...GS.L.......N..LL...........VRS.
ENSBTAP00000041298  F....PGG.IRPRM.LI...T.ILGTVK.P...........NAN...R-.-.......-..--...........---.
ENSBTAP00000001294  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000021701  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000007366  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009909  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000029287  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009005  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009025  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000054057  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000006913  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000043820  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000056333  -....---.--DGH.KI...T.VMGRVL.S...........TGE...SR.F.......S..VN...........FQM.
ENSBTAP00000018469  -....-QL.RTPLK.AF...T.VCLYFY.Tel.........ART...HS.Y.......S..IF...........SYA.
ENSBTAP00000018010  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000046313  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053488  -....---.-----.--...-.ITLQVS.-...........TAE...DN.G.......I..LL...........YNG.
ENSBTAP00000017563  -....---.LRAYH.TL...R.LALEFR.-...........ALE...PQ.G.......L..LL...........YNG.
ENSBTAP00000020080  F....PN-.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000052704  -....---.-----.--...-.------.-...........---...--.-.......V..IL...........SLS.
ENSBTAP00000031529  -....---.-----.--...-.------.-...........TDA...EG.C.......T..FR...........LYY.
ENSBTAP00000023092  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000029126  M....FRG.LRQR-.-F...H.LTLSLS.Fa..........TVQ...PS.G.......L..LF...........YNG.
ENSBTAP00000023900  -....---.-L---.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000034496  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053345  -....---.---SA.PG...S.LNVYVK.V...........NNG...PL.G.......Sp.IW...........NISg
ENSBTAP00000005971  -....---.-----.--...-.------.-...........---...--.-.......-..--...........--L.
ENSBTAP00000028802  F....PN-.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000011769  V....KKS.LPEMY.AF...T.VCMWLK.S...........SAA...PGvG.......T..PF...........SYA.
ENSBTAP00000054738  -....--T.LPELY.AF...T.ICLWLR.S...........SAS...PGiG.......T..PF...........SYA.
ENSBTAP00000004870  -....---.-----.--...-.------.-...........---...--.-.......V..IL...........SLS.
ENSBTAP00000018010  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000021676  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000042993  F....FQK.LRNKH.EF...T.ILVTLK.Q...........THL...NS.G.......V..IL...........SIH.
ENSBTAP00000022890  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053970  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000035935  -....-Y-.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000056432  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053607  -....---.-----.-I...T.L----Q.Ia..........TDE...DS.G.......I..LL...........YKG.
ENSBTAP00000026956  -....---.-----.--...D.VSLRFR.-...........SQR...AY.G.......I..LM...........ATT.
ENSBTAP00000009351  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000022744  L....PAL.TNTHH.EL...R.LDVEFK.P...........LAP...DG.V.......L..LF...........SGG.
ENSBTAP00000053511  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000042181  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000026111  T....FEP.LKNSYqAF...Q.ITLEFR.A...........EAE...DG.L.......L..LY...........CGE.
ENSBTAP00000019994  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000037239  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000032103  -....---.-----.--...-.------.-...........---...--.-.......I..LV...........SLM.
ENSBTAP00000010571  T....FRG.LRQRF.HF...T.VALAFA.-...........TQE...RN.A.......L..LL...........YNG.
ENSBTAP00000014522  V....RKA.LPELY.AF...T.VCMWLR.Srs.........GGT...GQ.G.......T..PF...........SYS.
ENSBTAP00000002600  L....VDA.VRAEK.GF...L.LLASLR.Q...........MKK...TR.G.......T..LL...........AVE.
ENSBTAP00000054736  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000054420  T....FRG.LRQRF.HF...T.LALSFA.-...........TKE...RD.G.......L..LL...........YNG.
ENSBTAP00000053498  -....---.--N--.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000027527  -....--L.MENEN.KL...E.MKLTMR.L...........RTY...SA.H.......A..VV...........MYA.
ENSBTAP00000026111  -....---.-----.-M...E.FEITFR.P...........DSE...DG.-.......V..LL...........YSY.
ENSBTAP00000025424  F....PRG.VSRSL.WD...V.FAFSFK.-...........TEE...KD.G.......L..LL...........HAE.
ENSBTAP00000032310  -....--R.LPETT.RF...S.AEFDFR.-...........TYD...SE.G.......V..IL...........YAE.
ENSBTAP00000042078  I....TEA.MRRKE.GF...F.LTASMK.Q...........DRR...SR.G.......T..LL...........ALE.
ENSBTAP00000056054  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000025033  T....FRG.LRQRF.HF...T.LALSFA.-...........TKE...RD.G.......L..LL...........YNG.
ENSBTAP00000051925  -....---.-----.--...-.------.-...........---...-S.-.......-..--...........---.
ENSBTAP00000017563  E....SEK.ALQS-.-N...H.FELSLR.T...........EAT...QG.L.......V..LW...........SGK.
ENSBTAP00000000307  A....LAT.LQAYA.SM...H.LFFQFK.-...........TTA...PD.G.......L..LL...........FNS.
ENSBTAP00000028276  F....SGGtFPED-.-F...S.ILFTIK.P...........QKG...IQ.S.......F..LL...........SIY.
ENSBTAP00000022744  F....SRS.LP-EV.PE...T.IELEVR.T...........STA...SG.L.......L..VW...........QGE.
ENSBTAP00000026133  -....---.---LK.NL...T.LCLRAY.S...........DLS...RG.Y.......S..LF...........SYN.
ENSBTAP00000042592  -....SDI.IFSND.NL...T.VTC---.-...........SSY...DD.R.......V..VL...........GKT.
ENSBTAP00000023889  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053469  -....---.-----.--...D.VSLRFR.-...........SQR...AY.G.......I..LM...........ATT.
ENSBTAP00000033006  -....---.-----.--...D.VSLRFR.-...........SQR...AY.G.......I..LM...........ATT.
ENSBTAP00000053469  S....LPK.WNAKK.TG...S.ISFDFR.T...........TEP...NG.L.......I..LF...........SHG.
ENSBTAP00000026956  S....LPK.WNAKK.TG...S.ISFDFR.T...........TEP...NG.L.......I..LF...........SHG.
ENSBTAP00000033006  S....LPK.WNAKK.TG...S.ISFDFR.T...........TEP...NG.L.......I..LF...........SHG.
ENSBTAP00000026471  -....---.-----.--...-.------.-...........---...--.N.......F..IY...........SQA.
ENSBTAP00000042646  L....LPG.TPQID.GL...S.VSFQFR.-...........TWN...KD.G.......L..LL...........STR.
ENSBTAP00000013075  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000000793  F....PGG.FPKD-.-F...S.LLTAVR.A...........RPG...LQ.A.......P..LL...........TLY.
ENSBTAP00000036729  -....---.-LSPI.KD...V.ISLKFK.-...........TMQ...SD.G.......I..LL...........HRE.
ENSBTAP00000001939  M....LDGvLPTLH.AV...T.CTFWMK.Ss..........DDI...NY.G.......T..PI...........SYA.
ENSBTAP00000029353  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000049986  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000028721  -....---.-----.--...-.---C--.-...........---...--.-.......-..--...........---.
ENSBTAP00000035185  -....---.QPTR-.-L...V.AEFDFR.T...........FDP...EG.I.......L..FF...........AGG.
ENSBTAP00000053469  A....LAT.LQAYT.SM...H.LFFQFK.T...........TSL...D-.G.......L..IL...........YNS.
ENSBTAP00000026956  A....LAT.LQAYT.SM...H.LFFQFK.T...........TSL...D-.G.......L..IL...........YNS.
ENSBTAP00000033006  A....LAT.LQAYT.SM...H.LFFQFK.T...........TSL...D-.G.......L..IL...........YNS.
ENSBTAP00000053469  -....IQS.SS---.-D...E.ITLSFK.T...........LQR...NG.L.......M..LH...........TGK.
ENSBTAP00000024169  V....REG.YRVRS.DV...N.ITLEFR.-...........TSS...EN.G.......V..LL...........GIS.
ENSBTAP00000013134  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036729  L....PGS.-FGED.EI...S.ATFQFR.T...........WNK...AG.L.......L..LF...........TEL.
ENSBTAP00000037790  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053179  -....---.-KNR-.-L...T.IEFEVR.-...........TEA...ES.G.......L..LF...........YMA.
ENSBTAP00000054149  F....DHT.FGNES.GF...Y.IST---.-...........---...--.-.......-..--...........---.
ENSBTAP00000000788  F....DHT.FGNES.GF...Y.IST---.-...........---...--.-.......-..--...........---.
ENSBTAP00000020299  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000013292  I....PST.FFRD-.-F...A.ISVRVK.P...........SSP...QG.G.......V..LF...........AIT.
ENSBTAP00000000458  -....---.-----.--...-.----LC.S...........TKV...NS.Q.......Y..IL...........STT.
ENSBTAP00000012225  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036729  H....FPT.FHGEL.SA...D.VSFFFK.-...........TTA...SS.G.......V..FL...........ENL.
ENSBTAP00000008454  V....LPG.ISRED.KV...S.VIFQFR.T...........WNR...AG.L.......L..LT...........SQF.
ENSBTAP00000017076  -....---.-----.--...-.------.A...........PGQ...RA.H.......V..IF...........QSL.
ENSBTAP00000000179  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000042771  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000046486  -....---.-----.--...-.--LQVA.-...........TDK...DN.G.......I..LL...........YKG.
ENSBTAP00000031529  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000005332  -....S-E.NSKEE.DF...K.LALRLR.T...........LQS...NG.I.......I..MY...........TRA.
ENSBTAP00000008454  H....FPT.FRGEL.SA...D.VSFFFK.-...........TTA...SS.G.......V..FL...........ENL.
ENSBTAP00000053720  H....FST.FQGET.SA...D.ISFYFK.-...........TLI...PR.G.......V..FL...........ENL.
ENSBTAP00000035185  -....---.--TTW.AV...E.AVARVR.P...........AAD...T-.G.......V..LL...........ALV.
ENSBTAP00000017120  I....PRV.RKPLR.SF...T.LCLKAF.T...........DLT...RP.Y.......S..LF...........SYS.
ENSBTAP00000053179  A....VDG.FKVGL.DL...L.VEFEFR.-...........TTR...TT.G.......V..LL...........GIS.
ENSBTAP00000011612  -....---.---GL.KF...E.IAFEVR.-...........PRS...SS.G.......T..LV...........HGH.
ENSBTAP00000032513  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000017857  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000008454  F....NHK.SMNPI.KE...V.ISLKFK.-...........TRE...NN.G.......I..LL...........HRE.
ENSBTAP00000027839  -....---.-----.--...-.------.-...........---...-G.W.......N..LL...........VQG.
ENSBTAP00000053422  Y....PNG.LPEE-.-Y...S.FLTTFR.M...........TGStleKH.W.......S..IW...........QIQ.
ENSBTAP00000000307  A....LPR.WSAKR.TG...S.ISLDFR.T...........TEP...SG.L.......L..LF...........SQG.
ENSBTAP00000017783  H....PEG.LPSDY.TI...S.ILFRIL.Pd..........TPE...EP.F.......A..LW...........EIL.
ENSBTAP00000005537  -....---.LTKIT.KI...S.SSFEFR.-...........TWD...PE.G.......V..IFy..........GDT.
ENSBTAP00000017563  F....ERD.LGEK-.-M...A.LEVVFL.A...........RSP...SG.L.......L..LY...........NGQ.
ENSBTAP00000031529  -....---.-----.--...D.ILTPVI.S...........HTG...PK.C.......T..LV...........FWT.
ENSBTAP00000000307  -....---.-----.--...-.----LR.F...........MSQ...RA.Y.......G..LM...........MAT.
ENSBTAP00000011863  -....---.PMKLE.TF...S.ACIWVK.A...........TEVl..NK.T.......V..LF...........SYG.
ENSBTAP00000053409  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000018697  -....---.-----.--...-.MSFQLK.-...........TRS...AR.G.......L..VL...........YFD.
ENSBTAP00000024169  -....---.---RK.RL...S.VQLRIR.-...........TFA...SS.G.......L..VF...........YMA.
ENSBTAP00000033006  -....IQS.SS---.-D...E.ITLSFK.T...........LQR...NG.L.......M..LH...........TGK.
ENSBTAP00000026956  -....IQS.SS---.-D...E.ITLSFK.T...........LQR...NG.L.......M..LH...........TGK.
ENSBTAP00000026725  H....PNG.LPPSY.TI...I.LLFRLL.Pe..........TPS...DP.F.......A..IW...........QIT.
ENSBTAP00000022744  A....---.-YRK-.-F...E.IKITFR.P...........DSA...DG.M.......L..LYngqkqipgspaNLA.
ENSBTAP00000011612  L....KRD.FGEK-.-S...Q.FSIRLK.-...........TRS...SH.G.......M..IF...........YVS.
ENSBTAP00000013316  -....--L.DPNN-.-N...Y.I--YVK.Fa..........TIK...SH.A.......L..LL...........YNY.
ENSBTAP00000025424  Q....VPG.FPRRG.RL...A.VSFRFR.T...........WDL...TG.L.......L..LF...........SSL.
ENSBTAP00000042646  F....SKF.LMKQL.DQ...V.ISLKFK.-...........SMQ...GD.G.......V..LF...........HGE.
ENSBTAP00000024169  -....---.-----.--...-.-IIMLF.S...........TYS...PN.G.......L..LL...........YLA.
ENSBTAP00000000307  -....---.-----.TD...E.ITLAFR.T...........LQR...NG.L.......M..LH...........TGK.
ENSBTAP00000013440  F....QDGhFPEN-.-F...S.ILITLR.G...........QPA...NR.S.......V..LL...........SIY.
ENSBTAP00000006786  R....PGF.LTGLR.AL...S.ICSWVR.T...........AAD...HL.G.......T..LL...........SYA.
ENSBTAP00000032513  -....---.-----.--...-.------.-...........--F...--.-.......-..--...........---.
ENSBTAP00000025424  V....YNV.TGEEV.SF...S.FS----.-...........TQS...AP.A.......V..LL...........YVS.
ENSBTAP00000054985  Y....PASaFPED-.-F...S.ILTTVK.A...........KKG...SQ.A.......F..LV...........SIY.
ENSBTAP00000004114  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000045584  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053179  -....--W.YPNI-.-S...T.VMFKFR.-...........TFS...SS.A.......L..LM...........YLA.
ENSBTAP00000053569  P....VAK.WPYQN.GF...T.FHTWLR.M...........DPV...NN.InvdkdkpY..LY...........CFR.
ENSBTAP00000012117  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053727  -....--S.LGPE-.-F...K.LVFSIR.P...........RSL...T-.G.......I..LI...........HIG.
ENSBTAP00000008967  -....---.-----.--...-.------.-...........-P-...--.-.......-..--...........---.
ENSBTAP00000005686  -....---.-----.--...-.---RIL.Y...........PKR...KQ.Q.......C..LQ...........FFY.
ENSBTAP00000031460  F....PQG.LPDEY.AF...V.TTFRLRkP...........SRR...ED.W.......Y..IW...........QVI.
ENSBTAP00000053495  -....---.HPVNT.DF...TgIKASFR.-...........TRV...PE.G.......L..IV...........FAA.
ENSBTAP00000007877  -....---.-----.--...-.------.-...........---...--.-.......T..VL...........GDT.
ENSBTAP00000024169  P....PKS.LSPD-.-T...E.LLATFA.T...........RSS...SG.I.......V..LA...........ALS.
ENSBTAP00000031529  F....PAS.LGM--.-C...A.VRFWFY.Mv..........DPG...ST.G.......VlkVY...........TVD.
ENSBTAP00000036729  H....GDT.RLSR-.-E...T.IKFSFR.T...........TRT...PS.-.......L..LL...........YLS.
ENSBTAP00000001200  L....PAS.LGTE-.-L...A.LVLSLC.S...........HRV...NH.A.......F..LF...........AVR.
ENSBTAP00000034542  L....PGT.FFQD-.-F...S.LLVRVR.P...........ASA...RA.G.......V..LF...........AVT.
ENSBTAP00000000307  -....---.-----.--...-.LSFSLR.-...........TNA...TR.A.......L..LL...........YLD.
ENSBTAP00000053495  Y....PYL.FHGGM.DF...E.ISFKFR.T...........DQL...N-.G.......L..LL...........FIY.
ENSBTAP00000024169  -....---.-----.--...S.LTLNVK.-...........TSE...PD.N.......L..LF...........YLG.
ENSBTAP00000023092  -....---.---P-.-M...S.GCLSFY.Yq..........LQQ...RN.D.......N..IF...........SVY.
ENSBTAP00000024358  -....LAD.IPRE-.AF...T.VEAWVR.Peg.........GQN...SP.A.......I..IA...........GVF.
ENSBTAP00000000307  -....---.PPNDR.PS...T.RMDRLA.Vgfs........THQ...RS.A.......V..LV...........RVD.
ENSBTAP00000006361  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000032513  -....---.-----.--...-.------.-...........HGV...ET.L.......T..LW...........QSA.
ENSBTAP00000053727  -....---.-----.QF...A.VDV---.L...........TTA...SR.G.......L..VF...........YTG.
ENSBTAP00000054420  -....---.---SQ.PW...H.LSLMFR.-...........TRQ...AD.G.......V..LL...........QAV.
ENSBTAP00000032310  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000023376  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000042646  Y....ADA.ALSKE.NI...A.LSFV--.-...........TAQ...AP.S.......L..LL...........YIN.
ENSBTAP00000016055  -....---.-----.--...-.------.-...........---...--.-.......-..--...........--Y.
ENSBTAP00000003261  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053720  A....PDL.AGEEI.RF...S.FS----.-...........TTK...AP.C.......I..LL...........YVS.
ENSBTAP00000025033  -....---.---SQ.PW...H.LSLMFR.-...........TRQ...AD.G.......V..LL...........QAV.
ENSBTAP00000004156  -....---.-----.--...-.LSLQLK.Fq..........TSK...PQ.G.......L..LF...........LAA.
ENSBTAP00000025424  F....P-P.IRANH.SL...D.VSFYFR.T...........SAP...SG.V.......F..LE...........NMG.
ENSBTAP00000054276  F....PRG.LPSEF.AL...V.LTLLMK.Kh..........THR...NT.W.......Y..LF...........QVT.
ENSBTAP00000023092  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000037835  F....PRG.LPSEF.AL...V.LTLLMK.Kh..........THR...NT.W.......Y..LF...........QVT.
ENSBTAP00000032513  -....---.-----.--...-.LTFWYH.L...........SLR...NP.G.......T..LR...........VHV.
ENSBTAP00000008454  F....AAL.FHEDL.TLtgeM.ATLSFR.-...........TTG...TP.S.......L..LL...........YVS.
ENSBTAP00000010571  -....---.-----.-W...Y.LGLMFR.-...........TRK...ED.G.......V..LM...........EAT.
ENSBTAP00000015885  -....---.-----.--...-.------.-...........-G-...--.-.......-..--...........---.
ENSBTAP00000041534  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000023842  L....LPN.LQPHS.NF...C.LLFNYR.L...........AGN...KV.G.......K..LR...........VFV.
ENSBTAP00000013316  -....---.-----.--...S.LEVKFR.-...........TRS...EN.G.......I..LI...........HIQ.
ENSBTAP00000053179  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000033786  -....---.LAQDS.GC...T.VALRFQ.T...........VQP...A-.A.......L..LL...........FRG.
ENSBTAP00000016206  A....FPA.WGTRH.EG...T.LEFTLT.T...........RSQ...KA.P.......L..AF...........QAG.
ENSBTAP00000003981  L....GAT.LPD--.-V...A.LELEVR.P...........QTA...T-.G.......L..VF...........HLG.
ENSBTAP00000053566  -....---.LPEFQ.NG...H.IHFRLK.T...........LQS...QA.I.......L..LF...........SNK.
ENSBTAP00000048368  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000025190  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000004156  -....---.-----.-G...L.LEFALQ.-...........TGT...QQ.A.......L..LL...........FQS.
ENSBTAP00000010056  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000001189  F....PEG.LPPSY.VF...V.STQRFK.V...........KKM...--.W.......D..LW...........RIL.
ENSBTAP00000046960  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000055054  H....LAT.LPPEH.TV...V.FLLRLL.Pe..........TPR...EA.F.......A..LW...........QVA.
ENSBTAP00000006018  H....LAT.LPPEH.TV...V.FLLRLL.Pe..........TPR...EA.F.......A..LW...........QVA.
ENSBTAP00000055176  H....LAT.LPPEH.TV...V.FLLRLL.Pe..........TPR...EA.F.......A..LW...........QVA.
ENSBTAP00000003981  V....PAS.PSDW-.-S...Q.LSMLVR.P...........HAP...RG.L.......L..LL...........AVP.
ENSBTAP00000033786  L....NKD.YEED-.-L...T.LSMFVR.-...........TRR...PT.G.......L..LL...........ALG.
ENSBTAP00000042646  -....---.-----.--...-.-AFFFK.Y...........TAV...SG.T.......V..LE...........NNL.
ENSBTAP00000043064  N....PK-.----E.PF...T.ISVWMR.Hgpf........GKK...KE.T.......I..LC...........SSD.
ENSBTAP00000033786  -....---.TREL-.-T...N.VTFGFR.-...........TRD...AH.A.......I..IL...........HAE.
ENSBTAP00000053179  -....---.-----.--...-.IIVNVK.-...........TAV...AD.N.......L..LF...........YLG.
ENSBTAP00000011480  V....PKN.LTDQ-.-F...T.ITMWMK.Hgpspg......VRA...EK.E.......T..IL...........CNS.
ENSBTAP00000011612  F....GQV.TR---.--...-.FDIEVR.T...........PAD...NG.L.......V..LL...........M-V.
ENSBTAP00000029126  -....---.-----.-W...Y.LGLAFR.-...........TRV...KQ.G.......V..LM...........QVQ.
ENSBTAP00000029938  -....---.-----.DL...C.LSFRHK.V...........TGL...HS.G.......T..LQ...........VLV.
ENSBTAP00000007926  S....RNN.SIAN-.-F...T.FSAWVM.P...........NPN...TN.G.......F..VI...........AKD.
ENSBTAP00000011612  F....FDG.FEGG-.--...-.--FNFR.-...........TLQ...PN.G.......L..LF...........YYA.
ENSBTAP00000018394  -....-QC.GPE--.GV...S.FSFFWK.T...........QGE...QS.T.......S..IP...........SAY.
ENSBTAP00000003981  -....---.-----.--...-.SGFGFR.-...........SSQ...DS.A.......L..LF...........QRE.
ENSBTAP00000016206  -....---.-----.--...-.------.-...........TAQ...PE.A.......L..LL...........LAA.
ENSBTAP00000010689  LgsgpPDS.LSDH-.-F...T.LSFWMK.Hgvtpnk.....GKK...EE.E.......T..IV...........CNTv
ENSBTAP00000018634  -....---.---P-.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000010687  LgsgpPDS.LSDH-.-F...T.LSFWMK.Hgvtpnk.....GKK...EE.E.......T..IV...........CNTv
ENSBTAP00000024762  -....---.-----.--...-.------.-...........---...-N.E.......Y..LL...........AVV.
ENSBTAP00000053727  -....---.-----.--...T.FGQTIQ.-...........TTV...DR.G.......L..LF...........FAE.
ENSBTAP00000053802  P....IAK.WPYQN.GF...T.LNTWFR.M...........DPL...NN.I.......-..--...........---.
ENSBTAP00000039948  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053727  -....--D.FPSSS.HF...Q.ASFGFQ.T...........FQP...SG.-.......I..LL...........S--.
ENSBTAP00000027783  -....-QC.GPE--.GV...S.FSFFWK.T...........QGE...QS.T.......S..IP...........SAY.
ENSBTAP00000047997  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009228  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000048250  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000046960  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000044872  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000031529  S....PTF.SQTGP.GC...T.LSFWFY.N...........YGL...SV.G.......-..--...........---.
ENSBTAP00000053650  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000020240  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000025061  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000055305  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036054  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000054766  L....RAS.VPAGS.SL...G.LALRFR.-...........TTI...RV.G.......A..LA...........TCS.
ENSBTAP00000040914  L....RAS.VPAGS.SL...G.LALRFR.-...........TTI...RV.G.......A..LA...........TCS.
ENSBTAP00000032513  -....---.-----.--...-.-----Y.-...........---...--.-.......-..--...........---.
ENSBTAP00000025458  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000023092  -....---.----E.SF...D.RL----.-...........---...--.-.......-..FW...........SAK.
ENSBTAP00000054766  -....---.-----.--...-.-SLVFR.T...........RDP...EA.G.......L..L-...........RAE.
ENSBTAP00000009351  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000040914  -....---.-----.--...-.-SLVFR.T...........RDP...EA.G.......L..L-...........RAE.
ENSBTAP00000011612  H....PRA.SMDDLkTFt..S.LSLYMK.Pppvkqsel...AVT...AD.Q.......F..IL...........YLG.
ENSBTAP00000054766  L....DQP.PGPN-.-L...T.VSFLLR.-...........TRE...PA.G.......L..LL...........QLT.
ENSBTAP00000053495  -....--R.LAAS-.-F...T.LAVWLK.L...........EQG...G-.-.......V..MC...........VIE.
ENSBTAP00000040914  L....DQP.PGPN-.-L...T.VSFLLR.-...........TRE...PA.G.......L..LL...........QLT.
ENSBTAP00000003981  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053932  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053616  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000048757  -....---.-----.--...-.------.-...........---...--.-.......-..--...........--L.
ENSBTAP00000044383  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000026111  -....---.-----.--...-.AFMRFK.T...........TAK...DG.L.......L..LW...........RGD.
ENSBTAP00000009703  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000022475  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000003981  -....---.-----.--...-.------.-...........---...-D.Q.......F..VL...........YMG.
ENSBTAP00000048250  V....PGR.LHQDL.-F...S.VSFQFR.T...........WNP...NG.L.......L..LF...........SHF.
ENSBTAP00000005537  -....---.-AEPW.AF...S.LDLALQ.L...........AA-...GS.G.......R..LL...........ALG.
ENSBTAP00000014043  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000048757  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000044383  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000037559  -....---.IPELR.AF...T.LCFEAT.Kig.........KED...SE.W.......T..AF...........SYS.
ENSBTAP00000053727  L....PND.LEDLK.GY...T.SLSLFL.Qrpeatet....GGT...EN.M.......F..VM...........YLG.
ENSBTAP00000022474  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036460  L....TDP.TLNE-.-L...Y.VISTFK.L...........QSK...SS.A.......T..IF...........GLY.
ENSBTAP00000003367  Y....PD-.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000041534  -....---.--PGA.GF...T.AYASVL.-...........GSI...RK.H.......T..IF...........S--.
ENSBTAP00000055305  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036054  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000054517  -....SDI.FFDN-.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000038137  W....PG-.----S.AF...S.FNAWFC.LdqdqltlgnanKGG...KR.K.......Q..LY...........SFF.
ENSBTAP00000053650  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000020240  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000056645  W....PG-.----S.AF...S.FNAWFC.LdqdqltlgnanKGG...KR.K.......Q..LY...........SFF.
ENSBTAP00000047997  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000053365  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000017949  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000042505  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000009228  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000036054  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000032513  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000055305  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000042505  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000031529  S....PQ-.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000002970  -....---.-----.-F...T.VSLWLY.Llhy........CKA...NL.C.......G..IL...........YFV.
ENSBTAP00000009228  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000056398  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000031529  -....---.-----.-C...-.------.-...........---...--.-.......-..--...........---.
ENSBTAP00000000063  -....---.-----.DI...Y.LLSTFR.L...........PPK...QG.G.......V..LF...........GLY.
ENSBTAP00000002071  -....---.-----.--...-.------.-...........---...--.-.......-..--...........---.


                                                          90                100                 110 
                                                           |                  |                   | 
d2erfa1               RK......D..........HS..........G...QVFSVVS.....NG....KAGTL..DLSLT......VQ..GKQ
ENSBTAP00000002600  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036460  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000006074  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000000063  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000042078  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000054517  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000046571  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000002071  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000005195  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000010569  --......-..........--..........F...PYISVMV.....NN....GS--L..S----......--..---
ENSBTAP00000001158  --......-..........--..........-...--V----.....--....-----..-----......--..---
ENSBTAP00000008979  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000018459  --......-..........--..........-...NRIGIFL.....DY....EASTV..SFYNI......TD..HAS
ENSBTAP00000054004  --......-..........--..........-...NRIGIFL.....DY....EASTV..SFYNI......TD..HAS
ENSBTAP00000011393  --......-..........--..........-...--V----.....--....-----..-----......--..---
ENSBTAP00000034027  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000015061  --......-..........--..........-...--VGVFL.....DY....EAHDI..SFYNV......TD..NGS
ENSBTAP00000009824  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000012013  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000009893  --......-..........--..........-...-S-----.....--....-----..-----......--..---
ENSBTAP00000013175  TV......K..........HE..........-...-------.....--....-----..-----......--..---
ENSBTAP00000042458  --......-..........--..........-...---GVFL.....DY....ESGDI..FFYNM......TD..G--
ENSBTAP00000020111  --......-..........--..........-...-------.....-P....GTKKV..HVIFN......YK..GKN
ENSBTAP00000024852  --......-..........--..........-...----IFL.....DY....EAGHL..SFYS-......--..---
ENSBTAP00000036910  --......K..........EK..........P...LRVGVFL.....DY....EARDV..SFYNM......TD..GS-
ENSBTAP00000028561  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000024658  --......-..........--..........-...LVVGIFL.....DF....EAGVV..SFYNMt.....TG..SH-
ENSBTAP00000055797  --......-..........--..........-...V------.....--....-----..-----......--..---
ENSBTAP00000055913  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000027907  --......-..........--..........-...-V-----.....--....-----..-----......--..---
ENSBTAP00000033248  SV......K..........HK..........-...-------.....--....-----..-----......--..---
ENSBTAP00000045818  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000047271  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000011391  --......-..........--..........-...-------.....-S....GNKVL..LTGSL......MG..TDH
ENSBTAP00000027551  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000022024  --......-..........--..........-...-------.....--....-----..-----......--..K--
ENSBTAP00000007623  --......-..........G-..........-...-------.....--....-----..-----......--..---
ENSBTAP00000015712  VP......P..........R-..........-...-RVGVFL.....DY....DAGTV..SFYNV......TN..HGF
ENSBTAP00000009025  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000009005  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000012653  --......-..........--..........-...W------.....--....-----..-----......--..---
ENSBTAP00000013346  GF......S..........KG..........V...HYWELTV.....DR....YDN--..-----......HP..DPA
ENSBTAP00000013398  --......-..........SG..........R...HYWEVVI.....SG....STW--..-----......--..---
ENSBTAP00000013121  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000026179  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000055851  QA......P..........HP..........R...LRVGVFL.....DH....QEGDI..SFYNM......TD..GS-
ENSBTAP00000024853  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000021701  --......-..........--..........-...-------.....--....-----..----Gs.....WG..SEE
ENSBTAP00000044710  RS......K..........GA..........L...DTHAWSL.....SG....NKGNV..W----......--..---
ENSBTAP00000041298  --......-..........--..........-...LALDFK-.....RG....NDVAF..HFNPR......FN..EDN
ENSBTAP00000001294  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000021701  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000007366  --......-..........--..........P...RHVGVFL.....DY....EAGTV..SFFNV......TN..HGS
ENSBTAP00000009909  --......-..........--..........-...-----V-.....--....-----..-----......--..---
ENSBTAP00000029287  --......-..........--..........-...--L----.....--....-----..-----......--..---
ENSBTAP00000009005  --......-..........--..........-...-------.....--....NENAV..VRNTQ......IN..GSW
ENSBTAP00000009025  --......-..........--..........-...-------.....--....NENAV..VRNTQ......IN..GSW
ENSBTAP00000054057  --......-..........--..........P...RHVGVFL.....DY....EAGTV..SFFNV......TN..HGS
ENSBTAP00000006913  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000043820  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000056333  DH......T..........DH..........-...-EIAF--.....--....-----..-----......--..---
ENSBTAP00000018469  TK......Q..........QP..........-...NEILIFW.....SK....GKGYI..FGV--......HG..KQV
ENSBTAP00000018010  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000046313  --......-..........--..........P...RRIGVFL.....DW....EVGNL..SFYNM......AD..G-S
ENSBTAP00000053488  DN......D..........H-..........-...--IAVEL.....YQ....GH--V..RVSYD......PG..SYP
ENSBTAP00000017563  NA......R..........GK..........-...DFLGLVL.....LG....GR--V..QFRFD......TG..SGP
ENSBTAP00000020080  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000052704  L-......S..........VS..........P...HRVGVFL.....DY....EAHTV..LFLNV......TN..HGF
ENSBTAP00000031529  HM......F..........GK..........-...HIYRLAVyqrvwNN....TRGQL..LWHIF......--..---
ENSBTAP00000023092  --......-..........--..........-...----V--.....--....-----..-----......--..---
ENSBTAP00000029126  RL......N..........EK..........H...DFLALEL.....VA....GQ--V..RLTYS......TG..ESN
ENSBTAP00000023900  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000034496  --......R..........HD..........P...DRLGVFL.....DY....EAGVL..AFYDV......TG..GMS
ENSBTAP00000053345  DP......N..........RT..........W...NRAELAI.....STfwp.NFYQV..IFEVI......TS..GHQ
ENSBTAP00000005971  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000028802  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000011769  VP......G..........QA..........-...NEL-VLI.....EW....GNNPM..EIL--......IN..DKV
ENSBTAP00000054738  VP......G..........QA..........-...NEI-VLI.....EW....GNNPI..ELL--......IN..DKV
ENSBTAP00000004870  L-......S..........VS..........P...HRVGVFL.....DY....EAHTV..LFLNV......TN..HGF
ENSBTAP00000018010  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000021676  --......-..........--..........-...-------.....--....---F-..-----......--..---
ENSBTAP00000042993  HL......D..........H-..........-...RYLELES.....SG....HRNEV..RLHYR......SG..SHH
ENSBTAP00000022890  --......-..........--..........-...------S.....--....-----..-----......--..---
ENSBTAP00000053970  --......-..........--..........-...R------.....--....-----..-----......--..---
ENSBTAP00000035935  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000056432  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000053607  DK......D..........H-..........-...IAVELY-.....-R....GR--V..RASYD......TG..SHP
ENSBTAP00000026956  SR......D..........S-..........A...DTLRLEL.....DA....GR--V..KLTVN......LG..KGP
ENSBTAP00000009351  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000022744  KS......G..........PV..........E...DFVSLAM.....VG....GH--L..EFRYE......LG..SGL
ENSBTAP00000053511  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000042181  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000026111  NE......H..........GR..........G...DFMSLAV.....IR....RSLQF..RFNCG......TG..---
ENSBTAP00000019994  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000037239  --......-..........--..........-...TRIGIYL.....SF....GDGVL..SFYDA......SD..P--
ENSBTAP00000032103  QA......P..........HP..........R...LRVGVFL.....DH....QEGDI..SFYNM......TD..GS-
ENSBTAP00000010571  RF......N..........EK..........H...DFIALEI.....VD....EQVQL..TF---......SA..GET
ENSBTAP00000014522  VP......G..........QA..........-...NEI-VLL.....EA....GHDPM..ELL--......IN..DKV
ENSBTAP00000002600  RK......D..........HS..........G...QVFSVIS.....NG....KAGTL..DLSLT......VQ..GKQ
ENSBTAP00000054736  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000054420  RF......N..........EK..........H...DFVALEV.....IQ....EQVQL..TFS--......AG..EST
ENSBTAP00000053498  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000027527  RG......T..........D-..........-...-YSILEI.....HN....GR--L..QYKFD......CG..SGP
ENSBTAP00000026111  DT......G..........SK..........-...DFLSINM.....AG....GH--V..EFRFD......CG..SGT
ENSBTAP00000025424  GA......Q..........GD..........-...-YVTLEL.....QG....AH--L..LLHMS......LG..SSP
ENSBTAP00000032310  SS......D..........HS..........-...AWFLIAL.....RE....GKIEI..QFK--......-N..EKT
ENSBTAP00000042078  GP......G..........AT..........H...RQFEIVS.....NG....PADTL..DLTYW......VD..GTQ
ENSBTAP00000056054  --......-..........--..........-...--FHFRV.....YT....NSMVV..MNSFQ......KG..GWQ
ENSBTAP00000025033  RF......N..........EK..........H...DFVALEV.....IQ....EQVQL..TFS--......AG..EST
ENSBTAP00000051925  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000017563  AT......E..........R-..........A...DYIALAI.....VD....GR--L..QLAYD......LG..SQP
ENSBTAP00000000307  GN......G..........ND..........F...IVIELV-.....--....-KGYI..HYVFDl.....GN..GPS
ENSBTAP00000028276  NE......H..........G-..........I...QQIGVEV.....-G....RSPVF..LYEDH......TG..KPA
ENSBTAP00000022744  ET......G..........QS..........GrgkDFISLGL.....QD....GH--L..VFSYQ......LG..SGE
ENSBTAP00000026133  IH......S..........KD..........-...NELLVFK.....NGi...GEYSL..YI---......GK..TKV
ENSBTAP00000042592  GF......S..........KG..........V...HYWELTV.....DR....-----..-----......--..---
ENSBTAP00000023889  --......-..........TT..........I...HHMSLSE.....DS....NDASV..MFRDEh.....HG..TSR
ENSBTAP00000053469  SR......D..........S-..........A...DTLRLEL.....DA....GRVKL..TVNLDcirincNS..SKG
ENSBTAP00000033006  SR......D..........S-..........A...DTLRLEL.....DA....GRVKL..TVNLDcirincNS..SKG
ENSBTAP00000053469  KP......R..........HQkdakhpqmikV...DFFAIEM.....LD....GH--L..YLLLD......MG..SGT
ENSBTAP00000026956  KP......R..........HQkdakhpqmikV...DFFAIEM.....LD....GH--L..YLLLD......MG..SGT
ENSBTAP00000033006  KP......R..........HQkdakhpqmikV...DFFAIEM.....LD....GH--L..YLLLD......MG..SGT
ENSBTAP00000026471  DE......N..........QK..........G...KVARLV-.....--....-----..-----......--..---
ENSBTAP00000042646  LS......E..........GS..........G...T-LLLSL.....ED....GTLRL..VIQKM......TE..RAA
ENSBTAP00000013075  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000000793  SA......Q..........G-..........V...RQLGLEL.....-G....RPVRF..LYEDQ......TGrpQPP
ENSBTAP00000036729  GQ......N..........GD..........-...-HITLEL.....RR....GKLFL..LIN--......SG..DAK
ENSBTAP00000001939  LE......N..........GS..........D...NTFLLT-.....DY....NGWVL..YV---......NG..KEK
ENSBTAP00000029353  --......-..........AG..........Q...HYWEVRA.....SS....HSVTL..GVAY-......--..---
ENSBTAP00000049986  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000028721  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000035185  HR......D..........ST..........W...IVLG--L.....RA....GRLEL..QLRYQ......--..-GV
ENSBTAP00000053469  GD......G..........ND..........F...IVVELV-.....--....-KGYL..HYVFD......LG..NGA
ENSBTAP00000026956  GD......G..........ND..........F...IVVELV-.....--....-KGYL..HYVFD......LG..NGA
ENSBTAP00000033006  GD......G..........ND..........F...IVVELV-.....--....-KGYL..HYVFD......LG..NGA
ENSBTAP00000053469  S-......-..........--..........A...DYVNLAL.....KN....GA--V..SLVIN......LG..SGA
ENSBTAP00000024169  SA......K..........VD..........A...IGLEIV-.....-D....GK--L..LFHVN......NG..AGR
ENSBTAP00000013134  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036729  QL......V..........SG..........-...-GLLLFL.....ND....GKLKL..HLY--......HP..GKL
ENSBTAP00000037790  --......-..........--..........-...-------.....--....RRNIV..YL---......LG..RNP
ENSBTAP00000053179  RI......N..........HA..........-...DFATVQL.....KN....GLP--..YFSYD......LG..SGD
ENSBTAP00000054149  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000000788  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000020299  --......-..........-S..........N...IAFHFRV.....YT....NSMVV..MNSFQ......EG..GWQ
ENSBTAP00000013292  DA......F..........QK..........V...IYLGLRL.....SGved.GRQRV..ILYYT......EP..SSQ
ENSBTAP00000000458  SPplvqfvK..........RP..........L...GKIGVFL.....DY....DNGTV..SFYDV......FR..SSL
ENSBTAP00000012225  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036729  GI......T..........D-..........F...IRIELRS.....--....-PAVV..TFSFD......VG..NGP
ENSBTAP00000008454  HH......R..........SG..........-...-ALILVL.....SD....GKLKL..SLS--......QP..GHP
ENSBTAP00000017076  SE......N..........DT..........HcvqFSYFLYS.....RDgh..SPGTL..GIYVR......VN..GGP
ENSBTAP00000000179  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000042771  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000046486  DN......D..........P-..........-...--LALEL.....YQ....GH--V..RLVYDs.....LS..SPP
ENSBTAP00000031529  --......-..........--..........-...-VISWRS.....KN....CK--I..IFHYHm.....YG..HG-
ENSBTAP00000005332  N-......-..........--..........-...PCIILKI.....VD....GR--L..WFQLD......CG..SGP
ENSBTAP00000008454  GI......T..........D-..........F...IRLELRA.....PT....E---V..TFSFD......VG..NGP
ENSBTAP00000053720  GN......T..........D-..........F...IKLEL--.....-K....SATEV..SFSFDv.....GN..GPV
ENSBTAP00000035185  GD......H..........Q-..........A...VALSVAL.....--....----V..DYHSTkk....LK..KQL
ENSBTAP00000017120  TK......S..........KD..........-...NELLLFV.....NKv...GEYEL..HIGNTk.....VT..F--
ENSBTAP00000053179  SQ......K..........MD..........G...--MGIEM.....ID....EK--L..MFHVD......NG..AGR
ENSBTAP00000011612  SV......N..........G-..........-...EYLNVHM.....KN....GQVIV..KVNNG......IR..DFS
ENSBTAP00000032513  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000017857  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000008454  GP......N..........DK..........-...-HITLEL.....VK....GKLIL..FLNSGh.....AD..LPS
ENSBTAP00000027839  HS......D..........SG..........E...DQFEINF.....LS....ETGDI..VFHIKp.....R-..---
ENSBTAP00000053422  DS......S..........GK..........-...EQVGVKI.....NG....QTKSV..SFSYKg.....LD..GSL
ENSBTAP00000000307  GR......AgvgpgspstaQR..........A...DYFAMEL.....LD....GY--L..YLLLD......MG..SGG
ENSBTAP00000017783  NK......N..........SD..........-...PLVGVIL.....DN....GGKTLt.YFNYD......YS..GDF
ENSBTAP00000005537  NP......K..........ND..........-...-WFMLGL.....RD....GRPEI..QLHNH......WA..--Q
ENSBTAP00000017563  KT......D..........GK..........G...DFVSLAL.....HN....GL--L..EFRYD......LG..KGA
ENSBTAP00000031529  HM......N..........GA..........-...TVGSLQV.....LS....KKDNV..TSKLW......AQ..SGQ
ENSBTAP00000000307  TS......R..........ES..........A...DTLRLEL.....DG....GQMKL..TVNLDclrvgcAP..SKG
ENSBTAP00000011863  TK......R..........NP..........-...YEIQLYL.....SY....RSIML..V----......VG..GEE
ENSBTAP00000053409  --......-..........--..........-...------Y.....HN....GEQTL..TLSSF......TQ..GDF
ENSBTAP00000018697  DE......G..........F-..........C...DFLELILt....RG....GRLQL..SFSIF......CA..EPA
ENSBTAP00000024169  HQ......N..........Q-..........V...DHAALQL.....HA....GR--L..HFTFD......LG..KGR
ENSBTAP00000033006  S-......-..........--..........A...DYVNLAL.....KN....GA--V..SLVIN......LG..SGA
ENSBTAP00000026956  S-......-..........--..........A...DYVNLAL.....KN....GA--V..SLVIN......LG..SGA
ENSBTAP00000026725  DR......D..........YK..........-...PQVGVIA.....DP....SSKTL..SFFNKd.....TR..GEV
ENSBTAP00000022744  NR......Q..........P-..........-...DFISFGL.....VG....GRPEF..RF--D......AG..SGM
ENSBTAP00000011612  DQ......E..........EN..........-...NFMTLFL.....AH....GRLVF..MFN--......VG..HKK
ENSBTAP00000013316  DN......Q..........TG..........D...RAEFLAL.....EI....AEERL..RFSYN......LG..SGT
ENSBTAP00000025424  GD......G..........L-..........-...GHVELML.....SE....GQVNV..SVVQT......GR..KKL
ENSBTAP00000042646  GQ......R..........GD..........-...-HITLEL.....QR....GRLAL..HLNLD......DS..KPR
ENSBTAP00000024169  SN......G..........TK..........-...DFLSIDL.....VD....GR--V..RVTVD......LG..SGP
ENSBTAP00000000307  SA......-..........--..........-...DYVNLSL.....KS....GA--V..WLVIN......LG..SGA
ENSBTAP00000013440  DE......G..........G-..........V...RQLGLAL.....GP....A---L..DLL--......--..GDS
ENSBTAP00000006786  TE......E..........ND..........-...--NKLVL.....HG....RDSLApgSVHF-......VI..GDP
ENSBTAP00000032513  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000025424  SF......V..........RD..........-...-YMAVLI.....-K....EDGTL..QLRYQ......LG..TSP
ENSBTAP00000054985  NE......-..........QG..........I...QQIGLEM.....-G....RSPVF..LYEDH......TGkpGPE
ENSBTAP00000004114  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000045584  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000053179  TR......D..........LK..........-...DFMSVEL.....TD....GH--I..KVSYD......LG..SGM
ENSBTAP00000053569  TS......K..........G-..........-...LGYSAHF.....VG....GCLII..TSIKS......KG..KGF
ENSBTAP00000012117  --......-..........--..........-...-------.....SN....NDNFL..LVCVK......QD..DHY
ENSBTAP00000053727  SQ......P..........G-..........-...QHLCVYM.....EG....GKVTA..SVGS-......EA..GEV
ENSBTAP00000008967  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000005686  KM......S..........GSpsd.......R...LVVWIRR.....DD....STGNV..R----......--..---
ENSBTAP00000031460  DQ......Y..........G-..........I...PQVSIRL.....DG....ENKAV..EYSAVga....MK..DAV
ENSBTAP00000053495  SP......G..........NQ..........E...EYFAIQL.....KN....GRPYF..LFD--......PQ..GSA
ENSBTAP00000007877  LI......D..........GG..........E...HYWEVRY.....EP....DSKAF..GVGVAyrsl..GR..FEQ
ENSBTAP00000024169  QS......Sekpgdrq...AH..........G...PFWSIML.....IE....GHVEV..HVNPG......DG..TSL
ENSBTAP00000031529  ES......G..........LN..........I...LMWSVIG.....NK....RTGWM..YGHVPl.....SS..NSP
ENSBTAP00000036729  SF......Y..........K-..........-...EYLSVILa....KN....GSLQI..RYKLN......RY..QEP
ENSBTAP00000001200  SR......K..........RK..........-...LQLGLQF.....LP....GKTVV..HL---......--..GPR
ENSBTAP00000034542  DP......A..........QA..........V...VSVGVKLtaa..RG....GRQHM..QLLYT......EP..GAT
ENSBTAP00000000307  D-......G..........GD..........C...DFLELLL.....VD....GRLRL..RFTLS......CA..EPA
ENSBTAP00000053495  NK......D..........GP..........-...DFLAMEL.....K-....-SGIL..SFRLN......TS..LTF
ENSBTAP00000024169  SS......-..........TS..........A...DFLAVEM.....RR....GK--V..AFLWD......LG..SGS
ENSBTAP00000023092  TR......D..........A-..........-...-------.....--....-----..-----......--..---
ENSBTAP00000024358  DNcshai.S..........DK..........G...WALGIRS.....GKdvgrRDARF..FFSLR......TDrvKKA
ENSBTAP00000000307  SA......S..........GL..........G...DYLQLHI.....DQ....GTVGV..IFNVG......TD..D-I
ENSBTAP00000006361  --......-..........--..........-...D------.....--....-----..-----......--..---
ENSBTAP00000032513  GP......W..........DP..........-...DWQELAV.....PT....GRIR-..-----......--..---
ENSBTAP00000053727  TR......S..........S-..........-...-FMALYL.....SK....GRLVF..AL--G......AE..GKK
ENSBTAP00000054420  TR......G..........RS..........-...-TITLQL.....RE....GRVVL..SV--Eg.....TG..LQA
ENSBTAP00000032310  --......-..........--..........-...-------.....--....---L-..-----......--..---
ENSBTAP00000023376  --......-..........--..........-...-------.....-G....GAVHA..ALVVR......GH..HAP
ENSBTAP00000042646  SS......S..........QD..........F...LAVLLC-.....KN....GS--L..QVRSQl.....NK..EET
ENSBTAP00000016055  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000003261  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000053720  SF......T..........TD..........-...FLAALVK.....PT....GSLQV..R--YN......LG..GTR
ENSBTAP00000025033  TR......G..........RS..........-...-TITLQL.....RE....GRVVL..SV--Eg.....TG..LQA
ENSBTAP00000004156  GE......N..........D-..........Y...CIVEILS.....GN....LQVRV..NL---......GT..GEL
ENSBTAP00000025424  GPyc....Q..........WR..........R...PYVRVEL.....NT....SRDVV..FAFDVg.....NG..DEN
ENSBTAP00000054276  DG......D..........G-..........Y...PQISLEV.....NS....QEQSL..ELRTRg.....QD..GDF
ENSBTAP00000023092  --......-..........--..........-...-------.....--....----L..-----......--..---
ENSBTAP00000037835  DG......D..........G-..........Y...PQISLEV.....NS....QEQSL..ELRTRg.....QD..GDF
ENSBTAP00000032513  EE......A..........GR..........Q...QVLSVSS.....RG....G----..-----......--..---
ENSBTAP00000008454  SF......Y..........EE..........-...-YLSVIL.....-A....PNGSL..QIRYK......LD..RHR
ENSBTAP00000010571  AG......V..........SS..........R...LHLQIL-.....-N....NH--V..QFEVSh.....GA..SDV
ENSBTAP00000015885  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000041534  --......-..........--..........-...-------.....--....-----..----N......--..---
ENSBTAP00000023842  KN......R..........NN..........A...-------.....--....-----..-----......--..---
ENSBTAP00000013316  ES......S..........N-..........-...-YTTVKI.....KN....GK--V..HFTSDag....IA..GKV
ENSBTAP00000053179  --......-..........TG..........Q...VYYAIFL.....NK....GRLEV..HLSTG......AR..TMR
ENSBTAP00000033786  DR......D..........V-..........F...VMLEVL-.....--....-AGFV..HLTVQ......VS..DRP
ENSBTAP00000016206  GR......Q..........GD..........F...IYVDIFE.....GH....LRAV-..-----......VE..KGQ
ENSBTAP00000003981  RG......-..........QT..........P...PYLELQV.....LG....-KQVL..LWAND......GA..GEF
ENSBTAP00000053566  T-......-..........--..........-...VRLSLKL.....V-....-NGVL..QLEYH......CP..GGF
ENSBTAP00000048368  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000025190  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000004156  GR......E..........GD..........F...VALEIV-.....-E....GF--L..KAH--......VG..RDR
ENSBTAP00000010056  --......-..........--..........-...-------.....--....-----..--V--......--..---
ENSBTAP00000001189  TI......D..........GR..........-...PQIAVTL.....NG....VDKTL..LFTTTs.....II..NGS
ENSBTAP00000046960  --......-..........--..........-...--IALDY.....E-....-----..-----......--..---
ENSBTAP00000055054  SE......D..........FQ..........-...PILGVLL.....DA....GRKSL..TYFNRd.....PR..ATL
ENSBTAP00000006018  SE......D..........FQ..........-...PILGVLL.....DA....GRKSL..TYFNRd.....PR..ATL
ENSBTAP00000055176  SE......D..........FQ..........-...PILGVLL.....DA....GRKSL..TYFNRd.....PR..ATL
ENSBTAP00000003981  QT......A..........SS..........-...PSLVLFL.....NH....RR--F..VAQTE......GP..GPQ
ENSBTAP00000033786  NG......T..........Y-..........-...QYLRVWL.....EH....GRLAM..L----......TP..GSP
ENSBTAP00000042646  EV......K..........--..........-...LLASLEV.....SA....PS-EI..TFAIDv.....GN..GPI
ENSBTAP00000043064  KT......E..........MN..........R...HHYSLYV.....HG....CRLVF..LLRQDps....EE..KKY
ENSBTAP00000033786  KE......-..........--..........-...PEF-LRI.....HI....QDSRL..LFQLR......SG..NSF
ENSBTAP00000053179  SA......K..........F-..........V...DFLAIEM.....RK....GK--V..SFLWD......VG..SGV
ENSBTAP00000011480  DKt.....E..........MN..........R...HHYALYV.....HN....CRLVF..LLRKDfd....QA..DTF
ENSBTAP00000011612  NG......S..........--..........-...MFFSLEM.....RS....GYLHV..FYDFG......FS..NGP
ENSBTAP00000029126  AG......P..........HS..........T...LLCQL--.....--....DRGLL..SVTVTr.....AS..GRA
ENSBTAP00000029938  RK......H..........GA..........-...HGAALWG.....RN....G----..-----......--..---
ENSBTAP00000007926  DG......N..........GG..........-...IYYGVKI.....HTne..SHVTL..SLHYKt.....LG..SNA
ENSBTAP00000011612  SG......S..........D-..........-...-MFSISL.....NN....GTVIM..DV---......--..KGI
ENSBTAP00000018394  GG......Q..........VI..........S...NGFKVCS.....RG....GKGSV..ELYTH......NK..SVT
ENSBTAP00000003981  SP......G..........GP..........-...--CEVTL.....QQ....GHVTL..RLART......--..---
ENSBTAP00000016206  GP......A..........D-..........Y...LLLQLYS.....GR....LQVRL..LL---......GQ..EEV
ENSBTAP00000010689  QN......E..........DG..........F...SHYSLTV.....HG....CRIAF..LYWPL......LE..SAR
ENSBTAP00000018634  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000010687  QN......E..........DG..........F...SHYSLTV.....HG....CRIAF..LYWPL......LE..SAR
ENSBTAP00000024762  AE......E..........RD..........S...LLLGLRY.....SP....TQLHF..LFLSEdg....AG..AWQ
ENSBTAP00000053727  NQ......D..........H-..........-...-FISLNV.....ED....GR--L..MVRYK......LN..SEP
ENSBTAP00000053802  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000039948  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000053727  -H......Q..........MG..........A...SSLQVTL.....ED....GHIEL..S----......TR..DSS
ENSBTAP00000027783  GG......Q..........VI..........S...NGFKVCS.....RG....GKGSV..ELYTH......NK..SVT
ENSBTAP00000047997  --......-..........--..........-...-------.....MN....GKLMV..GFQTT......CG..GPI
ENSBTAP00000009228  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000048250  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000046960  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000044872  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000031529  --......-..........--..........A...AELQLHV.....GNs...SESTV..LWRVLy.....NQ..GDQ
ENSBTAP00000053650  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000020240  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000025061  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000055305  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036054  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000054766  DT......Q..........GS..........-...VELALVE.....AR....----L..QATLWs.....HG..KNV
ENSBTAP00000040914  DT......Q..........GS..........-...VELALVE.....AR....----L..QATLWs.....HG..KNV
ENSBTAP00000032513  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000025458  --......-..........--..........-...-------.....--....--G--..-----......--..---
ENSBTAP00000023092  EP......S..........DS..........W...LIASLDL.....QN....SSQKF..-----......--..---
ENSBTAP00000054766  DG......-..........--..........P...AAVWLAV.....RN....GSLAA..GVRSG......AG..LPR
ENSBTAP00000009351  --......-..........--..........-...RTLAWVS.....RW....GRKKL..IL---......--..---
ENSBTAP00000040914  DG......-..........--..........P...AAVWLAV.....RN....GSLAA..GVRSG......AG..LPR
ENSBTAP00000011612  SK......N..........AK..........K...EYMGLAI.....KN....DN--L..VYVYN......LG..TKD
ENSBTAP00000054766  NG......S..........A-..........-...AGLTVFL.....SE....GQIWA..EA---......L-..GSP
ENSBTAP00000053495  KT......A..........DG..........Q...IVFKLTI.....SE....KETMF..YYRTV......NG..LQP
ENSBTAP00000040914  NG......S..........A-..........-...AGLTVFL.....SE....GQIWA..EA---......L-..GSP
ENSBTAP00000003981  --......-..........--..........-...-------.....--....-----..-----......--..--L
ENSBTAP00000053932  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000053616  --......-..........--..........-...-------.....--....RDPRY..FFSLK......TD..RAR
ENSBTAP00000048757  SY......C..........PG..........-...-QIGVAL.....DH....DGGKV..TFTNA......RT..Q--
ENSBTAP00000044383  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000026111  SPmrp...N..........S-..........-...DFISLGL.....RD....-----..-----......--..---
ENSBTAP00000009703  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000022475  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000003981  GR......Q..........AT..........G...DYMGVAL.....RG....QR--V..HWVYRl.....GG..AGP
ENSBTAP00000048250  AD......N..........LG..........N...VEIDLT-.....--....-----..-----......--..---
ENSBTAP00000005537  TP......E..........NP..........-...SWLSIHL.....QD....QKVVL..S----......SG..---
ENSBTAP00000014043  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000048757  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000044383  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000037559  DA......S..........FP..........-...QLLSFGK.....TK....SGYFL..SF---......FG..SKC
ENSBTAP00000053727  NK......D..........AS..........R...DYIGMAV.....VD....GQLTC..VYN--......--..---
ENSBTAP00000022474  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036460  SS......A..........DH..........S...KYFEFTV.....MG....RLNKA..ILRYLk.....ND..GRI
ENSBTAP00000003367  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000041534  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000055305  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036054  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000054517  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000038137  TG......S..........G-..........-...MGFEAFI.....-T....HSGML..VVAVC......TK..REY
ENSBTAP00000053650  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000020240  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000056645  TG......S..........G-..........-...MGFEAFI.....-T....HSGML..VVAVC......TK..REY
ENSBTAP00000047997  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000053365  SS......E..........HH..........Y...VCLAIVL.....SA....KDRSL..IVSTK......--..EEL
ENSBTAP00000017949  SS......E..........HH..........Y...VCLAIVL.....SA....KDRSL..IVSTK......--..EEL
ENSBTAP00000042505  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000009228  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000036054  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000032513  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000055305  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000042505  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000031529  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000002970  DS......N..........EM..........Y...GTPSIFL.....-T....EEGYL..HIQMHl.....VK..GED
ENSBTAP00000009228  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000056398  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000031529  --......-..........--..........-...-------.....--....-----..-----......--..---
ENSBTAP00000000063  SR......H..........DN..........T...RWLEASV.....VG....KINKV..LVRYQr.....ED..GKV
ENSBTAP00000002071  --......-..........--..........-...-------.....--....-----..-----......--..---


                                                     120           130                              
                                                       |             |                              
d2erfa1               ..HVVSVE...EA....................L....LATGQWKSITL.F.....V...Q.....E...........
ENSBTAP00000002600  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036460  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000006074  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000000063  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000042078  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000054517  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000046571  ..------...--....................-....L----------.-.....-...-.....-...........
ENSBTAP00000002071  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000005195  ..------...--....................N....-----------.-.....-...-.....-...........
ENSBTAP00000010569  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000001158  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000008979  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000018459  ..LIYTF-...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000054004  ..LIYTF-...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000011393  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000034027  ..------...--....................-....--------VAL.D.....M...D.....D...........
ENSBTAP00000015061  ..HIFTFP...HY....................P....-----------.-.....-...-.....-...........
ENSBTAP00000009824  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000012013  ..------...--....................-....--------VVL.D.....M...D.....E...........
ENSBTAP00000009893  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000013175  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000042458  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000020111  ..-VLINK...DI....................R....CKDDEFTHLYTlI.....V...Rp....N...........
ENSBTAP00000024852  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036910  ..HIYTFS...N-....................-....-----------.-.....-...-.....-...........
ENSBTAP00000028561  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000024658  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055797  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055913  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000027907  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000033248  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000045818  ..------...--....................-....--------V--.-.....-...-.....-...........
ENSBTAP00000047271  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000011391  ..TFWTFP...P-....................-....-----------.-.....-...-.....-...........
ENSBTAP00000027551  ..------...--....................-....---------N-.-.....-...-.....-...........
ENSBTAP00000022024  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000007623  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000015712  ..PIYTFS...KY....................-....-----------.-.....-...-.....-...........
ENSBTAP00000009025  ..------...--....................-....--------LCF.Q.....V...Q.....S...........
ENSBTAP00000009005  ..------...--....................-....--------LCF.Q.....V...Q.....S...........
ENSBTAP00000012653  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000013346  ..FGVARI...DV....................-....-M----KDVML.G.....K...D.....D...........
ENSBTAP00000013398  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000013121  ..------...W-....................-....-----------.-.....-...-.....-...........
ENSBTAP00000026179  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055851  ..HIFSF-...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000024853  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000021701  ..RKVSYN...P-....................-....FGPGQFFDLSV.R.....C...G.....A...........
ENSBTAP00000044710  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000041298  ..RRVIVC...NS....................K....L----------.-.....-...-.....-...........
ENSBTAP00000001294  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000021701  ..------...--....................-....-----------.N.....-...-.....-...........
ENSBTAP00000007366  ..LIYKFS...K-....................-....-----------.-.....-...-.....-...........
ENSBTAP00000009909  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000029287  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000009005  ..GSEERSlprGM....................P....FFRGQSFSVWI.M.....C...E.....G...........
ENSBTAP00000009025  ..GSEERSlprGM....................P....FFRGQSFSVWI.M.....C...E.....G...........
ENSBTAP00000054057  ..LIYKFS...K-....................-....-----------.-.....-...-.....-...........
ENSBTAP00000006913  ..------...--....................-....-----WVHVTL.S.....H...Ttg...N...........
ENSBTAP00000043820  ..----T-...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000056333  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000018469  ..LFQSPE...NT....................Q....AP----THICA.S.....W...Est...S...........
ENSBTAP00000018010  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000046313  ..HIYSFT...GV....................T....FC---------.-.....-...-.....-...........
ENSBTAP00000053488  ..SSAIYS...TE....................T....INDGQFHTVEL.V.....T...F.....D...........
ENSBTAP00000017563  ..AVLTS-...SV....................P....VQPGRWHHLEL.S.....R...H.....W...........
ENSBTAP00000020080  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000052704  ..PIYTFS...SC....................-....-----------.-.....-...-.....-...........
ENSBTAP00000031529  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000023092  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000029126  ..TVVSPTv..PG....................G....LSDGQWHTVHL.R.....Y...Y.....Nkprtdalggaq
ENSBTAP00000023900  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000034496  ..HLHTF-...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053345  ..GY----...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000005971  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000028802  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000011769  ..AKL---...PF....................V....INDGKWHHICI.T.....W...Ttr...D...........
ENSBTAP00000054738  ..AQL---...PL....................F....VSDGKWHHICV.T.....W...Ttr...D...........
ENSBTAP00000004870  ..PIYTFS...SC....................-....-----------.-.....-...-.....-...........
ENSBTAP00000018010  ..------...--....................-....-----W-----.-.....-...-.....-...........
ENSBTAP00000021676  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000042993  ..PHTEVF...PY....................I....LADDKWHKLSL.A.....I...S.....A...........
ENSBTAP00000022890  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053970  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000035935  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000056432  ..------...--....................-....IADSEYHHFRY.R.....I...P.....-...........
ENSBTAP00000053607  ..ASAIYS...VE....................T....INDGNFHIVEL.L.....A...L.....D...........
ENSBTAP00000026956  ..ETLFA-...GY....................N....LNDNEWHTVRV.V.....R...R.....G...........
ENSBTAP00000009351  ..------...--....................-....--EARWPHVAL.Q.....R...G.....A...........
ENSBTAP00000022744  ..AVLRS-...AE....................P....LALGRWHHVSA.E.....R...L.....N...........
ENSBTAP00000053511  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000042181  ..------...--....................-....IADSEYHHFRY.R.....I...P.....P...........
ENSBTAP00000026111  ..VAIIVS...ET....................K....IKLGGWHTVTL.Y.....R...D.....G...........
ENSBTAP00000019994  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000037239  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000032103  ..HIFSF-...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000010571  ..TTTVAP...QV....................Pgg..VSDGRWHAVQL.Q.....Y...Y.....Nkpnigrlglph
ENSBTAP00000014522  ..AQL---...PL....................S....LKDNGWHHICI.A.....W...Ttr...D...........
ENSBTAP00000002600  ..HVVSVE...EA....................L....LATGQWKSITL.F.....V...Q.....E...........
ENSBTAP00000054736  ..------...--....................-....------VGVLL.D.....L...N.....K...........
ENSBTAP00000054420  ..TTVSPFv..PG....................G....VSDGQWHTVQL.K.....Y...Y.....Nkpllgqtglpq
ENSBTAP00000053498  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000027527  ..GIVSVQ...SI....................Q....VNDGLWHAVSL.E.....V...N.....G...........
ENSBTAP00000026111  ..GVL-RS...EE....................P....LTLGHWHELRV.S.....R...T.....A...........
ENSBTAP00000025424  .iQPRPGH...TTvsa.................Ggv..LNDQHWHYVRV.D.....R...F.....G...........
ENSBTAP00000032310  ..TKMTTG...GK....................V....INDGLWHMVSV.E.....E...L.....E...........
ENSBTAP00000042078  ..HVISLE...DV....................G....LADSQWKNVTV.Q.....V...T.....G...........
ENSBTAP00000056054  ..EEKRMF...SD....................P....FMPGQPFELRF.L.....V...L.....E...........
ENSBTAP00000025033  ..TTVSPFv..PG....................G....VSDGQWHTVQL.K.....Y...Y.....Nkpllgqtglpq
ENSBTAP00000051925  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000017563  ..VVLR-S...TV....................P....VNTNRWLRVRA.H.....R...K.....Q...........
ENSBTAP00000000307  ..LMKGNS...DK....................P....VNDNQWHNVVV.S.....R...Dp....G...........
ENSBTAP00000028276  peDYPLFR...TV....................N....IADGKWHRVAI.S.....V...E.....K...........
ENSBTAP00000022744  ..ARLVS-...ED....................P....INDGEWHRVTA.L.....R...E.....G...........
ENSBTAP00000026133  ..TVRATE...KFps..................P....------VHICT.S.....W...E.....Sst.........
ENSBTAP00000042592  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000023889  ..QPQIVE...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053469  ..PETLFA...GY....................N....LNDNEWHTVRV.V.....R...R.....G...........
ENSBTAP00000033006  ..PETLFA...GY....................N....LNDNEWHTVRV.V.....R...R.....G...........
ENSBTAP00000053469  ..IKIKAL...QK....................K....VNDGEWYHVDF.Q.....R...D.....G...........
ENSBTAP00000026956  ..IKIKAL...QK....................K....VNDGEWYHVDF.Q.....R...D.....G...........
ENSBTAP00000033006  ..IKIKAL...QK....................K....VNDGEWYHVDF.Q.....R...D.....G...........
ENSBTAP00000026471  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000042646  ..EILT--...GR....................D....LNDGLWHSVSI.N.....A...R.....R...........
ENSBTAP00000013075  ..------...--....................-....--------M--.-.....-...-.....-...........
ENSBTAP00000000793  ..AQPVFR...GL....................S....LADGKWHRVAV.A.....V...K.....G...........
ENSBTAP00000036729  ..PPSARA...PVrltlg...............Sl...LDDQHWHSVLI.Q.....R...L.....G...........
ENSBTAP00000001939  ..ITD---...CP....................S....VNDGNWHHIAI.T.....W...Tst...G...........
ENSBTAP00000029353  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000049986  ..------...--....................-....------HNVSL.S.....E...D.....N...........
ENSBTAP00000028721  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000035185  ..GRVTSS...GP....................V....INHGSWQTISV.E.....E...L.....E...........
ENSBTAP00000053469  .nLIKGSS...NK....................P....LNDNQWHNVMI.S.....R...Dt....S...........
ENSBTAP00000026956  .nLIKGSS...NK....................P....LNDNQWHNVMI.S.....R...Dt....S...........
ENSBTAP00000033006  .nLIKGSS...NK....................P....LNDNQWHNVMI.S.....R...Dt....S...........
ENSBTAP00000053469  ..FEALVE...PV....................Ngk..FNDNAWHDVKV.T.....R...N.....L...........
ENSBTAP00000024169  ..ITATYE...PKtps.................R....LCDGRWHTLQA.N.....K...S.....K...........
ENSBTAP00000013134  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036729  ..PSDITA...GV....................G....LNDGQWHSVSL.S.....A...K.....R...........
ENSBTAP00000037790  ..YSWCLE...WD....................S....LKFSVWHNNTQ.-.....-...-.....-...........
ENSBTAP00000053179  ..TSTMI-...PT....................K....INDGQWHKIKI.L.....R...V.....K...........
ENSBTAP00000054149  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000000788  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000020299  ..EEKRMF...SD....................P....FMPGQPFELRF.L.....V...L.....E...........
ENSBTAP00000013292  ..VSREAA...AFlv..................P....VMTHKWNYFAV.V.....V...Q.....G...........
ENSBTAP00000000458  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000012225  ..------...--....................T....YAQRKWH----.-.....-...-.....-...........
ENSBTAP00000036729  ..FEISVQs..PT....................H....FSDNQWHHVRV.E.....R...N.....M...........
ENSBTAP00000008454  ..ARDITA...GA....................G....LNDGQWHSVSL.S.....A...R.....G...........
ENSBTAP00000017076  ..LGSAVW...NM....................Tg...SHGRQWHQAEL.A.....V...S.....-...........
ENSBTAP00000000179  ..------...--....................-....-------RVEI.L.....C...E.....H...........
ENSBTAP00000042771  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000046486  ..TTVY--...SVe...................T....VNDGQFHSVEL.V.....M...L.....N...........
ENSBTAP00000031529  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000005332  ..GILGIS...GR....................A....VNDGSWHSVFL.E.....L...N.....R...........
ENSBTAP00000008454  ..CEVTVQ...SP....................Ta...FNDNRWHHVKA.D.....R...N.....I...........
ENSBTAP00000053720  ..EMVVRS...PT....................P....LNDDQWHRVTA.E.....R...N.....V...........
ENSBTAP00000035185  ..VVLAVE...GVtlvlmei.............K....VCDGQEHVVTI.S.....V...N.....K...........
ENSBTAP00000017120  ..------...KV....................P....RPPYGPVHLCV.S.....W...Esv...S...........
ENSBTAP00000053179  ..FTAIYDa..GV....................Pgh..LCDGQWHKVTA.N.....K...I.....K...........
ENSBTAP00000011612  ..TSVTP-...KQ....................S....LCDGRWHRITV.I.....R...D.....S...........
ENSBTAP00000032513  ..------...--....................-....LTDAHWHRV--.-.....-...-.....-...........
ENSBTAP00000017857  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000008454  ..PDALML...GS....................L....LDDEHWHSVLI.E.....L...L.....S...........
ENSBTAP00000027839  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053422  ..QTAAFS...NL....................Ps...LFDSQWHKIMI.G.....V...E.....R...........
ENSBTAP00000000307  ..IKLRAS...SR....................K....VNDGEWCHVDF.Q.....R...D.....G...........
ENSBTAP00000017783  ..QTVTFE...GPeir.................K....IFYGSFHKLHI.V.....V...S.....K...........
ENSBTAP00000005537  ..LTVSA-...GP....................R....LDDGKWHQMEV.K.....I...H.....G...........
ENSBTAP00000017563  ..AVIRS-...KE....................P....VALGAWTRVSL.E.....R...N.....G...........
ENSBTAP00000031529  ..QGAQWK...KV....................E....LFLGVHSHIQI.V.....F...R.....A...........
ENSBTAP00000000307  ..PETLFA...GH....................K....LNDNEWHTVRV.V.....R...R.....G...........
ENSBTAP00000011863  ..NRLVA-...DA....................V....ISLGTWTHLCS.T.....W...Dsk...K...........
ENSBTAP00000053409  ..ITC---...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000018697  ..TLLT--...DT....................P....VNDGAWHNVRI.R.....R...Q.....F...........
ENSBTAP00000024169  ..TKVSH-...PA....................L....LSDGQWHTVKT.E.....Y...F.....K...........
ENSBTAP00000033006  ..FEALVE...PV....................Ngk..FNDNAWHDVKV.T.....R...Nlrqh.S...........
ENSBTAP00000026956  ..FEALVE...PV....................Ngk..FNDNAWHDVKV.T.....R...Nlrqh.S...........
ENSBTAP00000026725  ..QTVTFD...TD....................Evka.LFYGSFHKVHI.V.....V...T.....S...........
ENSBTAP00000022744  ..ATIR-H...PT....................P....LALGQFHTVTL.L.....R...S.....L...........
ENSBTAP00000011612  ..LK-IRS...QE....................K....YNDGLWHDVIF.I.....R...E.....K...........
ENSBTAP00000013316  ..YKLTT-...MK....................K....VSDGHFHTVIA.R.....R...A.....G...........
ENSBTAP00000025424  ..QFAA--...GF....................R....LNDGFWHEVNF.V.....A...Q.....E...........
ENSBTAP00000042646  ..LSSSPP...SA....................TlgslLDDQHWHSVLL.E.....R...V.....G...........
ENSBTAP00000024169  ..LALIT-...DR....................R....YNNGTWYKIAF.Q.....R...N.....K...........
ENSBTAP00000000307  ..FEALVE...PV....................Ngk..FNDNAWHDVRV.T.....R...Nl....R...........
ENSBTAP00000013440  ..FSPLPQ...QV....................N....LTDGRWHRVAV.S.....V...D.....G...........
ENSBTAP00000006786  ..AFRELP...LQ....................P....LLDGQWHHVCV.I.....W...T.....Sil.........
ENSBTAP00000032513  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000025424  ..YVYQLT...TR....................P....VTDGQPHSVNI.T.....R...V.....Y...........
ENSBTAP00000054985  ..DYPLFR...GI....................N....LSDGKWHRIAL.S.....V...H.....K...........
ENSBTAP00000004114  ..------...-Y....................-....-----------.-.....-...-.....-...........
ENSBTAP00000045584  ..------...QIk...................D....IPSGSWQLYHV.T.....L...N.....-...........
ENSBTAP00000053179  ..ASVVS-...NQ....................N....HNDGKWKSFTL.S.....RiqkQ.....A...........
ENSBTAP00000053569  ..QHCV--...KF....................D....FKPQKWYMVTV.VhiynrW...K.....N...........
ENSBTAP00000012117  ..QLWTTA...PT....................T....-------PLYI.E.....R...P.....L...........
ENSBTAP00000053727  ..LTSVTP...KQ....................A....LCDGQWHSVAV.T.....I...K.....Q...........
ENSBTAP00000008967  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000005686  ..KLVKLK...TF....................Qg...DFDHNWK----.-.....-...-.....-...........
ENSBTAP00000031460  ..RVVFRG...PRvh..................D....LFDRDWHKVAL.S.....V...Q.....A...........
ENSBTAP00000053495  ..VEVTTTnddGK....................Q....YSDGKWHEIIA.I.....R...H.....Q...........
ENSBTAP00000007877  ..LGKTAA...SW....................C....LHVNNWLQVSF.T.....A...-.....-...........
ENSBTAP00000024169  ..RRALLH...APtg..................T....YGDGQEHSISM.I.....R...S.....G...........
ENSBTAP00000031529  ..FKVA--...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036729  ..DVVNFD...FK....................N....MADGQLHHVKI.N.....R...E.....E...........
ENSBTAP00000001200  ..RSVAF-...DL....................D....VHDGRWHHLAL.E.....L...R.....G...........
ENSBTAP00000034542  ..HTRTAA...SFel..................P....ALDGRWTRLAL.S.....V...D.....G...........
ENSBTAP00000000307  ..TLQL--...DT....................P....VADDRWHMVLL.T.....R...D.....A...........
ENSBTAP00000053495  .tQVDLWP...GL....................S....YCDGKWNKVII.K.....K...N.....D...........
ENSBTAP00000024169  ..TRLEFP...DF....................P....IDDNKWHGIYV.T.....R...F.....G...........
ENSBTAP00000023092  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000024358  ..TTVMG-...HS....................R....YQPGKWTHVAA.T.....Y...D.....G...........
ENSBTAP00000000307  ..TIDEP-...NA....................I....VSDGKYHVVRF.T.....R...S.....G...........
ENSBTAP00000006361  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000032513  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053727  ..LKL-KS...KE....................K....CNDGKWHTVTF.G.....Q...D.....G...........
ENSBTAP00000054420  ..SSLQLE...PG....................R....ANDGDWHHAQL.A.....L...Gasgg.P...........
ENSBTAP00000032310  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000023376  ..FR----...AA....................F....RADGRWHHVCV.T.....W...Eql...G...........
ENSBTAP00000042646  ..HVFTIN...TE....................N....FANRRLHHLKI.N.....R...E.....G...........
ENSBTAP00000016055  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000003261  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053720  ..EPYNIDvd.HR....................S....MANGQPHSVNI.T.....R...R.....E...........
ENSBTAP00000025033  ..SSLQLE...PG....................R....ANDGDWHHAQL.A.....L...Gasgg.P...........
ENSBTAP00000004156  ..VRLSEQ...RL....................R....VDDLAWHLVEL.Y.....Y...V.....K...........
ENSBTAP00000025424  ..LTVHSD...DF....................E....FNDDEWHLVRA.E.....I...N.....V...........
ENSBTAP00000054276  ..VSCIFS...VP....................Q....LFDLRWHKLVL.S.....V...A.....E...........
ENSBTAP00000023092  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000037835  ..VSCIFS...VP....................Q....LFDLRWHKLVL.S.....V...A.....E...........
ENSBTAP00000032513  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000008454  ..EPDVFNf..GFk...................N....LADGQLHHVRI.N.....R...E.....A...........
ENSBTAP00000010571  ..VSMQLS...RS....................R....VTDGEWHHLLI.E.....L...K.....S...........
ENSBTAP00000015885  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000041534  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000023842  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000013316  ..ERNIP-...EV....................Y....VADGHWHTFLI.G.....K...N.....G...........
ENSBTAP00000053179  ..KIVVKP...EP....................Sl...FHDGREHSVHV.E.....R...T.....R...........
ENSBTAP00000033786  ..KVVLLI...PH....................D....TSDGGWHAVEA.T.....F...A.....E...........
ENSBTAP00000016206  ..GTVLLHn..SM....................P....VADGQPHEVSV.H.....V...D.....V...........
ENSBTAP00000003981  ..STLVTH...PA....................A....LCDGRWHRLAV.T.....K...G.....G...........
ENSBTAP00000053566  ..YGNLSS...RL....................H....VNDHEWHSVLV.E.....E...M.....D...........
ENSBTAP00000048368  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000025190  ..------...--....................-....----------L.Q.....W...N.....G...........
ENSBTAP00000004156  ..SDTQLS...SF....................Sl...VSDNQWHDIQL.R.....F...T.....E...........
ENSBTAP00000010056  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000001189  ..QVVTFA...DP....................Rvki.LFDEGWHQIRL.L.....V...T.....E...........
ENSBTAP00000046960  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055054  ..QEVTFDlp.EVr...................R....IFFGSFHKVHV.A.....V...G.....R...........
ENSBTAP00000006018  ..QEVTFDlp.EVr...................R....IFFGSFHKVHV.A.....V...G.....R...........
ENSBTAP00000055176  ..QEVTFDlp.EVr...................R....IFFGSFHKVHV.A.....V...G.....R...........
ENSBTAP00000003981  ..LQVQ-S...RQ....................R....SRTGQWHTVSV.R.....W...E.....K...........
ENSBTAP00000033786  ..KLLV--...TF....................V....LSDGNVRLVSL.K.....I...K.....P...........
ENSBTAP00000042646  ..ELIVQS...PS....................S....LNDNQWHYVRA.E.....R...N.....L...........
ENSBTAP00000043064  ..KPAEFH...WKls..................Q....VCDEEWHHYVL.N.....V...E.....I...........
ENSBTAP00000033786  ..YTLSLT...SL....................Qp...VSDGVWYQVTI.S.....M...T.....Dpgaqa......
ENSBTAP00000053179  ..GRVEYP...DL....................T....IDDSYWYRIEA.S.....R...T.....G...........
ENSBTAP00000011480  ..RPAEFH...WKld..................Q....ICDKEWHYYVI.N.....V...E.....F...........
ENSBTAP00000011612  vhLEDTLK...KA....................Q....INDAKYHEISI.I.....Y...Hn....D...........
ENSBTAP00000029126  ..AHLLLD...QM....................I....VSDGRWHDLRL.E.....L...Q.....Eepggrr.....
ENSBTAP00000029938  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000007926  ..TYVAKT...TVmk..................Y....LEENVWLHLLI.V.....L...D.....D...........
ENSBTAP00000011612  ..KVQS-A...DK....................Q....YNDGLSHFIIT.S.....V...S.....P...........
ENSBTAP00000018394  ..WEASFS...PP....................-....--GHYWTHVLF.T.....W...Ks....E...........
ENSBTAP00000003981  ..--ELKT...QE....................R....FDDGAPHYVTF.Y.....S...N.....S...........
ENSBTAP00000016206  ..RVQTPA...EM....................L....LSDSVPHIVEL.T.....V...S.....D...........
ENSBTAP00000010689  ..PVKFLW...KL....................Eq...VCDDEWHHYAL.N.....L...E.....F...........
ENSBTAP00000018634  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000010687  ..PVKFLW...KL....................Eq...VCDDEWHHYAL.N.....L...E.....F...........
ENSBTAP00000024762  ..TRVSFR...SP....................A....LVDGQWHVLVL.A.....V...S.....E...........
ENSBTAP00000053727  ..PKEK--...GI....................Rdi..INDGKDHLVQI.K.....I...Gkv...Q...........
ENSBTAP00000053802  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000039948  ..------...--....................-....-------TLSL.S.....I...P.....P...........
ENSBTAP00000053727  ..SPIFTS...PQ....................T....YMDGLLHYVSV.I.....S...D.....N...........
ENSBTAP00000027783  ..WEASFS...PP....................-....--GHYWTHVLF.T.....W...Ks....E...........
ENSBTAP00000047997  ..QHLWQ-...NT....................P....GLQNRWERNVI.K.....I...Q.....-...........
ENSBTAP00000009228  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000048250  ..----MT...GS....................L....LDDHHWHSVVI.E.....R...Q.....G...........
ENSBTAP00000046960  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000044872  ..----ES...NA....................I....INDGKYHVVRF.T.....R...S.....G...........
ENSBTAP00000031529  ..WSR---...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053650  ..------...--....................-....------H----.-.....-...-.....-...........
ENSBTAP00000020240  ..------...--....................-....------H----.-.....-...-.....-...........
ENSBTAP00000025061  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055305  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036054  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000054766  ..LVLRLL...EP....................P....LNDGHWHRVEV.T.....L...R.....L...........
ENSBTAP00000040914  ..LVLRLL...EP....................P....LNDGHWHRVEV.T.....L...R.....L...........
ENSBTAP00000032513  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000025458  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000023092  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000054766  ..AVLPAP...GP....................R....VADGAWHRVRL.A.....M...E.....Qpaava......
ENSBTAP00000009351  ..-----A...PF....................L....FYPQRFFEVLL.L.....C...Q.....E...........
ENSBTAP00000040914  ..AVLPAP...GP....................R....VADGAWHRVRL.A.....M...E.....Qpaava......
ENSBTAP00000011612  ..VEIPLD...S-....................-....-----------.-.....-...-.....-...........
ENSBTAP00000054766  ..ALVL--...PG....................R....WDDGLRHLVTL.S.....F...G.....P...........
ENSBTAP00000053495  ..PIKVMT...LG....................R....ILVKKWIHLSV.Q.....V...H.....Q...........
ENSBTAP00000040914  ..ALVL--...PG....................R....WDDGLRHLVTL.S.....F...G.....P...........
ENSBTAP00000003981  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053932  ..-----S...NA....................I....INDGKYHVVRF.T.....R...S.....G...........
ENSBTAP00000053616  ..QVTTINa..HR....................S....YLPGQWVYLAA.T.....Y...D.....G...........
ENSBTAP00000048757  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000044383  ..------...--....................-....--------V--.-.....-...-.....-...........
ENSBTAP00000026111  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000009703  ..----LP...LL....................E....VADRFWLQIVA.W.....W...Gq....G...........
ENSBTAP00000022475  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000003981  ..ATLSID...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000048250  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000005537  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000014043  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000048757  ..--VSPN...GK....................Sm...MF---------.-.....-...-.....-...........
ENSBTAP00000044383  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000037559  ..LLNSAL...PVkdke................D....IFTESFEQLCI.A.....W...S.....S...........
ENSBTAP00000053727  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000022474  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036460  ..HLVVFN...NL....................Q....LADGRRHRLLL.R.....L...T.....Nlhrga......
ENSBTAP00000003367  ..------...-L....................P....SRFSH------.-.....-...-.....-...........
ENSBTAP00000041534  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055305  ..------...--....................-....---------C-.-.....-...-.....-...........
ENSBTAP00000036054  ..------...--....................-....---------C-.-.....-...-.....-...........
ENSBTAP00000054517  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000038137  ..ATVMLP...DH....................S....FCDSLWHNITI.V.....H...M.....Pgkrpfgq....
ENSBTAP00000053650  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000020240  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000056645  ..ATVMLP...DH....................S....FCDSLWHNITI.V.....H...M.....Pgkrpfgq....
ENSBTAP00000047997  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000053365  ..LQNYVD...DFseessfyeilpccarfrcgeL....IVEGQWHHLVL.V.....M...SkgmlkN...........
ENSBTAP00000017949  ..LQNYVD...DFseessfyeilpccarfrcgeL....IVEGQWHHLVL.V.....M...SkgmlkN...........
ENSBTAP00000042505  ..------...--....................-....---------V-.-.....-...-.....-...........
ENSBTAP00000009228  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000036054  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000032513  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000055305  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000042505  ..------...--....................-....--------V--.-.....-...-.....-...........
ENSBTAP00000031529  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000002970  ..LAVKT-...KF....................T....IPLKEWFRLDI.S.....F...N.....G...........
ENSBTAP00000009228  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000056398  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000031529  ..------...--....................-....-----------.-.....-...-.....-...........
ENSBTAP00000000063  ..HAVNLQ...QA....................G....LADGRTHTALL.R.....L...R.....G...........
ENSBTAP00000002071  ..------...--....................-....-----------.-.....-...-.....-...........


                                            140                      150                            
                                              |                        |                            
d2erfa1               .....DR...............AQLYI...D.C...E..K.M..E...NA.E..........LDV..........PIQ
ENSBTAP00000002600  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036460  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000006074  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000000063  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042078  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000054517  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000046571  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000002071  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000005195  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000010569  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000001158  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000008979  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000018459  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000054004  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000011393  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000034027  .....GT...............LSFIV...D.G...Q..Y.M..G...VA.F..........RGL..........K--
ENSBTAP00000015061  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009824  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000012013  .....GT...............LSFVV...D.G...Q..Y.L..G...VA.F..........RGL..........K--
ENSBTAP00000009893  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000013175  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042458  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000020111  .....NT...............YEVKI...D.N...S..Q.V..E...SG.S..........---..........---
ENSBTAP00000024852  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036910  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000028561  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000024658  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000055797  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000055913  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000027907  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000033248  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000045818  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000047271  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000011391  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000027551  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000022024  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000007623  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000015712  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009025  .....SE...............FRVMV...N.G...N..L.F..T...QY.A..........HRV..........PFH
ENSBTAP00000009005  .....SE...............FRVMV...N.G...N..L.F..T...QY.A..........HRV..........PFH
ENSBTAP00000012653  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000013346  .....KA...............WAMYV...D.N...N..R.S..W...FM.H..........NNS..........---
ENSBTAP00000013398  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000013121  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000026179  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000055851  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000024853  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000021701  .....DR...............FKVYA...N.G...K..H.L..F...DF.S..........HRL..........---
ENSBTAP00000044710  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000041298  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000001294  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000021701  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000007366  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009909  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000029287  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009005  .....HC...............FKVAV...D.S...Q..H.L..F...EY.H..........HRL..........---
ENSBTAP00000009025  .....HC...............FKVAV...D.S...Q..H.L..F...EY.H..........HRL..........---
ENSBTAP00000054057  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000006913  .....RN...............IAISA...D.R...R..Q.V..T...YV.Y..........KDQ..........GNN
ENSBTAP00000043820  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000056333  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000018469  .....GI...............AELWV...N.G...K..P.R..M...RK.S..........LEK..........---
ENSBTAP00000018010  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000046313  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053488  .....QM...............VNLSI...D.G...G..S.P..M...TM.D..........NFG..........K--
ENSBTAP00000017563  .....RQ...............GTLSV...D.G...E..T.P..V...L-.-..........-GQ..........SPS
ENSBTAP00000020080  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000052704  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000031529  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000023092  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000029126  gpskdKV...............AVLSV...D.D...C..D.V..Av..AL.QfgaeignyscAAA..........GTQ
ENSBTAP00000023900  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000034496  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053345  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000005971  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000028802  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000011769  .....GV...............WEAYQ...D.G...T..Q.G..G...N-.-..........-GE..........NLA
ENSBTAP00000054738  .....GM...............WEAFQ...D.G...E..K.L..G...T-.-..........-GE..........NLA
ENSBTAP00000004870  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000018010  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000021676  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042993  .....SH...............LILHI...D.C...N..K.I..Y...ER.V..........VEK..........P--
ENSBTAP00000022890  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053970  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000035935  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000056432  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053607  .....QS...............LSLSV...D.G...G..S.P..K...II.T..........-NL..........SK-
ENSBTAP00000026956  .....KS...............LKLTV...D.D...Q..Q.A..M...TG.Q..........MAG..........DHT
ENSBTAP00000009351  .....SF...............LILFL...F.G...N..E.E..M...KV.S..........VNG..........QH-
ENSBTAP00000022744  .....KD...............GSLQV...N.G...G..R.P..V...LR.S..........SPG..........KSQ
ENSBTAP00000053511  .....--...............F----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042181  .....G-...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000026111  .....LN...............GLLQL...N.N...G..T.P..V...TG.Q..........SQG..........Q--
ENSBTAP00000019994  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000037239  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000032103  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000010571  gpsgeKV...............AVVTV...DdC...D..T.A..V...AV.R..........FGSfvgnyscaaqGTQ
ENSBTAP00000014522  .....GL...............WSAYQ...D.G...E..L.R..G...S-.-..........-GE..........NLA
ENSBTAP00000002600  .....DR...............AQLYI...D.C...E..K.M..E...NA.E..........LDV..........PIQ
ENSBTAP00000054736  .....HT...............LTFFI...N.G...Q..Q.Q..G...P-.-..........---..........---
ENSBTAP00000054420  gpseqKV...............AVVTV...D.G...C..D.T..G...V-.-..........-AL..........RFG
ENSBTAP00000053498  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000027527  .....NY...............ARLVL...D.Q...V..H.T..A...SG.T..........APG..........TLK
ENSBTAP00000026111  .....KN...............GILQV...D.K...Q..K.A..V...EG.M..........AEG..........GF-
ENSBTAP00000025424  .....RE...............ANLTL...D.G...Y..V.-..Q...RF.V..........LNG..........DFE
ENSBTAP00000032310  .....QS...............ISVKI...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042078  .....ET...............YSLYV...G.C...D..L.M..D...SF.A..........LDE..........PFY
ENSBTAP00000056054  .....NE...............YKVFV...N.N...E..S.-..-...--.-..........---..........---
ENSBTAP00000025033  gpseqKV...............AVVTV...D.G...C..D.T..G...V-.-..........-AL..........RFG
ENSBTAP00000051925  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000017563  .....RE...............GSLQV...G.N...E..A.P..V...TG.S..........SPL..........G--
ENSBTAP00000000307  .....NV...............HTLKI...D.S...R..T.V..T...QH.S..........NGA..........---
ENSBTAP00000028276  .....KT...............VTMIV...D.C...K..K.K..T...TK.P..........LDR..........SE-
ENSBTAP00000022744  .....QR...............GSIQV...D.G...E..E.L..V...SG.Q..........SPG..........P--
ENSBTAP00000026133  .....GI...............AEFWI...N.G...K..P.L..V...KR.G..........LKQ..........---
ENSBTAP00000042592  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000023889  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053469  .....KS...............LKLTV...D.D...Q..Q.A..M...TG.Q..........MAG..........DHT
ENSBTAP00000033006  .....KS...............LKLTV...D.D...Q..Q.A..M...TG.Q..........MAG..........DHT
ENSBTAP00000053469  .....RS...............GTISV...N.T...L..R.T..P...YT.A..........PGE..........---
ENSBTAP00000026956  .....RS...............GTISV...N.T...L..R.T..P...YT.A..........PGE..........---
ENSBTAP00000033006  .....RS...............GTISV...N.T...L..R.T..P...YT.A..........PGE..........---
ENSBTAP00000026471  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042646  .....NR...............ITLTL...D.N...D..A.A..S...--.-..........---..........PAQ
ENSBTAP00000013075  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000000793  .....QS...............VTLII...D.C...K..K.R..V...TR.P..........LPR..........SA-
ENSBTAP00000036729  .....TQ...............VNFTV...D.G...H..R.R..R...FR.A..........QGE..........FSS
ENSBTAP00000001939  .....GA...............WKVYI...D.G...N..L.S..D...G-.-..........-GM..........GLS
ENSBTAP00000029353  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000049986  .....TS...............LIFGD...D.D...H..G.V..S...RK.L..........QGG..........ESF
ENSBTAP00000028721  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000035185  .....RN...............LVIKV...N.K...D..A.V..M...KI.A..........VAG..........DL-
ENSBTAP00000053469  .....NL...............HTVKI...D.T...K..I.T..T...QI.T..........AGA..........---
ENSBTAP00000026956  .....NL...............HTVKI...D.T...K..I.T..T...QI.T..........AGA..........---
ENSBTAP00000033006  .....NL...............HTVKI...D.T...K..I.T..T...QI.T..........AGA..........---
ENSBTAP00000053469  .....RQ...............VTISV...D.G...I..L.T..T...TG.Y..........TQE..........DY-
ENSBTAP00000024169  .....HR...............VVLTV...D.G...N..V.V..R...A-.-..........---..........ESP
ENSBTAP00000013134  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036729  .....NY...............LSVVV...D.G...Q..V.A..S...AS.P..........SQG..........---
ENSBTAP00000037790  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053179  .....QE...............GTIYV...D.D...A..S.N..R...T-.-..........ISP..........KK-
ENSBTAP00000054149  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000000788  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000020299  .....NE...............YKVFV...N.N...E..S.F..C...QF.A..........HRL..........---
ENSBTAP00000013292  .....EE...............VTLLV...D.C...E..E.H..G...RV.P..........FPR..........SSQ
ENSBTAP00000000458  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000012225  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036729  .....KE...............ASVRV...D.Q...L..S.P..K...TQ.P..........APA..........DG-
ENSBTAP00000008454  .....NH...............LSVMV...D.G...E..A.A..-...SM.A..........HSL..........---
ENSBTAP00000017076  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000000179  .....PR...............FRVFV...D.G...H..Q.L..F...DF.Y..........HRI..........QTL
ENSBTAP00000042771  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000046486  .....QT...............LNLVV...D.K...G..A.P..K...SLgK..........LQK..........---
ENSBTAP00000031529  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000005332  .....NF...............TSLAL...D.D...S..Y.V..E...RR.R..........APL..........YFQ
ENSBTAP00000008454  .....KE...............ASLQV...G.Q...H..P.R..K...TQ.P..........ASA..........DG-
ENSBTAP00000053720  .....KQ...............ASLQV...D.R...L..P.Q..Q...VR.K..........APT..........EG-
ENSBTAP00000035185  .....DR...............ATLEV...D.G...T..Q.G..Q...SE.V..........SPA..........GLR
ENSBTAP00000017120  .....GI...............AELWM...N.S...R..P.V..G...RK.G..........LRR..........---
ENSBTAP00000053179  .....HR...............IELTV...D.G...N..Q.V..E...AQ.S..........PNR..........A--
ENSBTAP00000011612  .....NV...............VQLDV...D.S...E..V.-..N...HV.V..........GPL..........N--
ENSBTAP00000032513  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000017857  .....--...............-----...-.-...-..-.-..-...--.-..........---..........-N-
ENSBTAP00000008454  .....TD...............VNFTV...D.T...H..T.H..H...FR.A..........KGE..........SSY
ENSBTAP00000027839  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053422  .....SS...............ATLFV...D.C...N..R.I..E...SL.P..........IKP..........---
ENSBTAP00000000307  .....RK...............GSISV...N.S...R..S.T..P...FL.A..........TGE..........SEI
ENSBTAP00000017783  .....TL...............AKVVI...D.C...K..Q.V..G...EK.A..........INA..........SSN
ENSBTAP00000005537  .....DS...............LLLRV...D.G...V..E.V..L...--.-..........---..........---
ENSBTAP00000017563  .....RK...............GAMRV...G.D...G..P.-..-...-R.V..........LGE..........SPV
ENSBTAP00000031529  .....KR...............GISY-...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000000307  .....KS...............LQLSV...D.N...V..T.V..E...GQ.M..........AGA..........HTR
ENSBTAP00000011863  .....GH...............MALWV...N.G...D..S.V..A...TA.V..........DM-..........---
ENSBTAP00000053409  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000018697  .....RN...............TTLFI...D.Q...V..E.A..K...WV.E..........VKS..........K--
ENSBTAP00000024169  .....RR...............GFMTV...D.G...Q..E.S..P...VV.T..........TVG..........-D-
ENSBTAP00000033006  .....-Gighamvnklhcs...VTISV...D.G...I..L.T..T...TG.Y..........TQE..........DY-
ENSBTAP00000026956  .....-Gighamvnklhcs...VTISV...D.G...I..L.T..T...TG.Y..........TQE..........DY-
ENSBTAP00000026725  .....KS...............VKIYI...D.C...Y..E.I..V...EK.D..........IKE..........---
ENSBTAP00000022744  .....TQ...............GSLIV...G.S...L..A.P..V...NG.T..........SQG..........KFQ
ENSBTAP00000011612  .....SS...............GRMII...D.G...L..R.V..L...EE.S..........LPP..........T--
ENSBTAP00000013316  .....MA...............ASLTV...DsCsenQ..E.A..G...YC.T..........VSNv.........AVS
ENSBTAP00000025424  .....NH...............AVISI...D.D...V..E.G..A...EV.R..........VSY..........PLL
ENSBTAP00000042646  .....KH...............VNFTV...D.R...H..T.Q..H...FR.T..........KGE..........ADA
ENSBTAP00000024169  .....KQ...............GLLAVi..D.AyntT..Y.K..E...TK.Q..........GET..........PGA
ENSBTAP00000000307  .....-QhagighamvnklhylVTISV...D.G...I..L.T..T...TG.Y..........TQE..........D--
ENSBTAP00000013440  .....GM...............VTLVA...D.C...E..P.Q..L...PM.L..........AQG..........---
ENSBTAP00000006786  .....GR...............YWLHV...D.R...R..L.V..A...T-.-..........-GS..........RFR
ENSBTAP00000032513  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000025424  .....RN...............LFIQV...D.Y...F..S.L..T...EQ.-..........---..........KFS
ENSBTAP00000054985  .....KN...............VTLIL...D.C...K..K.K..T...TK.F..........LDR..........SE-
ENSBTAP00000004114  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000045584  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053179  .....NI...............SIVDI...D.T...N..Q.E..E...NI.A..........TSS..........PGN
ENSBTAP00000053569  .....SE...............LRCYV...N.G...E..L.A..S...YG.E..........ITW..........FV-
ENSBTAP00000012117  .....GR...............VGVFL...D.C...-..-.-..-...--.-..........---..........---
ENSBTAP00000053727  .....HI...............LHLKL...D.A...E..D.S..Y...TA.-..........-GRh.........PFP
ENSBTAP00000008967  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000005686  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000031460  .....QN...............ASLYV...D.C...A..L.V..Q...TL.P..........LEE..........---
ENSBTAP00000053495  .....GL...............GQITL...D.G...L..F.T..G...SS.A..........TTN..........G--
ENSBTAP00000007877  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000024169  .....RV...............VTVQV...D.E...T..T.P..V...EM.K..........LGP..........SAE
ENSBTAP00000031529  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036729  .....AV...............VFVEI...D.E...S..M.R..R...QV.H..........LAS..........---
ENSBTAP00000001200  .....RT...............VTLVT...A.C...G..Q.-..H...RV.P..........VSL..........PFH
ENSBTAP00000034542  .....AY...............ARLFV...D.C...K..E.V..Q...GQ.P..........LAH..........SLH
ENSBTAP00000000307  .....RR...............TALAV...D.G...E..A.R..A...AE.V..........RSK..........---
ENSBTAP00000053495  .....SI...............ISASM...N.-...E..L.M..E...HV.S..........ESR..........---
ENSBTAP00000024169  .....NI...............GSLSV...K.E...M..S.A..A...QK.P..........PPRts........KSP
ENSBTAP00000023092  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000024358  .....QR...............MALYV...D.G...T..Q.V..A...SS.P..........DQS..........GPL
ENSBTAP00000000307  .....GN...............ATLQV...D.S...W..P.V..N...ER.Y..........PAG..........---
ENSBTAP00000006361  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000032513  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053727  .....GK...............GRLVV...D.G...L..R.T..R...EG.H..........LPG..........---
ENSBTAP00000054420  .....GH...............AILSF...DyG...Q..Q.R..A...EG.N..........LGP..........RLH
ENSBTAP00000032310  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000023376  .....GR...............WSLFA...D.G...R..R.R..S...GA.Rg.........LGA..........---
ENSBTAP00000042646  .....RG...............LTIQM...D.Q...Q..L.R..L...SY.N..........FSP..........---
ENSBTAP00000016055  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000003261  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053720  .....RT...............ITLKL...D.H...Y..P.S..V...SY.H..........LPS..........SS-
ENSBTAP00000025033  .....GH...............AILSF...DyG...Q..Q.R..A...EG.N..........LGP..........RLH
ENSBTAP00000004156  .....DH...............VSLVI...D.K...H..Y.E..M...TG.R..........ITG..........GMH
ENSBTAP00000025424  .....KQ...............ARLRV...D.H...R..P.W..V...LR.P..........MPL..........QTY
ENSBTAP00000054276  .....RV...............ASVHV...D.C...M..S.A..S...SQ.P..........LGP..........---
ENSBTAP00000023092  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000037835  .....RV...............ASVHV...D.C...M..S.A..S...SQ.P..........LGP..........---
ENSBTAP00000032513  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000008454  .....AV...............MFVEV...N.Q...N..A.R..R...QV.I..........LSS..........---
ENSBTAP00000010571  .....ATegkdikyl.......AIMTL...DyG...M..D.Q..D...TV.Q..........IGN..........QLP
ENSBTAP00000015885  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000041534  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000023842  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000013316  .....TA...............TVLSV...D.R...I..H.N..R...DI.I..........HPT..........QDF
ENSBTAP00000053179  .....GM...............FTVQV...D.E...D..R.K..H...MQ.N..........LTM..........---
ENSBTAP00000033786  .....AV...............TLALR...D.D...S..C.M..G...TC.V..........ARA..........PS-
ENSBTAP00000016206  .....HR...............LEISV...D.Q...Y..P.T..-...-R.T..........SNR..........GVL
ENSBTAP00000003981  .....NV...............LRLEV...D.Q...Q..S.N..H...T-.-..........-QG..........PAP
ENSBTAP00000053566  .....TS...............VRLLV...D.S...A..S.S..T...SL.K..........LPE..........NCR
ENSBTAP00000048368  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000025190  .....RS...............FSVW-...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000004156  .....RY...............LGLMV...D.E...Q..R.V..R...A-.-..........-NL..........PLQ
ENSBTAP00000010056  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000001189  .....QD...............VTLYI...D.D...Q..Q.I..E...NK.P..........LHP..........---
ENSBTAP00000046960  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000055054  .....AR...............VRLYV...D.C...R..K.V..A...ER.P..........IGEa.........GGL
ENSBTAP00000006018  .....AR...............VRLYV...D.C...R..K.V..A...ER.P..........IGEa.........GGL
ENSBTAP00000055176  .....AR...............VRLYV...D.C...R..K.V..A...ER.P..........IGEa.........GGL
ENSBTAP00000003981  .....SR...............IQLMT...D.G...V..W.A..H...SQ.E..........EPG..........RQH
ENSBTAP00000033786  .....NK...............IELYE...S.S...Q..N.L..G...FL.S..........AP-..........---
ENSBTAP00000042646  .....KE...............TSLQV...D.N...L..P.R..M...TR.E..........TSE..........EG-
ENSBTAP00000043064  .....PS...............VTLYV...D.G...V..P.H..Epf.SV.T..........EDY..........PLH
ENSBTAP00000033786  .....SR...............WQMEV...D.G...Q..T.P..Pv..TS.A..........VAA..........GSL
ENSBTAP00000053179  .....RN...............GTISVralD.G...P..K.A..SimpST.Y..........HSA..........SPP
ENSBTAP00000011480  .....PV...............VTLYM...D.G...AtyE.P..Y...LV.T..........NDW..........PIH
ENSBTAP00000011612  .....KK...............MILVV...D.R...R..H.V..K...SM.D..........NE-..........---
ENSBTAP00000029126  .....GHhvlmvsld.......FSLFQ...D.T...L..A.V..G...SE.L..........QGL..........---
ENSBTAP00000029938  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000007926  .....GI...............IEFYL...D.G...N..A.M..P...RG.I..........KSL..........KG-
ENSBTAP00000011612  .....AR...............YELIV...D.K...S..R.L..G...SK.N..........PTK..........GK-
ENSBTAP00000018394  .....EG...............LKVYV...N.G...T..L.R..T...SD.P..........SGK..........ASP
ENSBTAP00000003981  .....TG...............VWLYV...D.D...Q..L.Q..E...MK.P..........YRG..........PRP
ENSBTAP00000016206  .....SW...............ALLSV...D.G...L..L.N..D...SA.P..........VQ-..........---
ENSBTAP00000010689  .....PT...............VTLYA...D.G...I..S.F..D...PA.L..........I--..........---
ENSBTAP00000018634  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000010687  .....PT...............VTLYA...D.G...I..S.F..D...PA.L..........I--..........---
ENSBTAP00000024762  .....GS...............FSLTT...D.C...G..P.A..V...DI.M..........ADM..........PFP
ENSBTAP00000053727  .....QR...............MWINV...D.-...-..-.I..Q...SV.K..........IED..........DIF
ENSBTAP00000053802  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000039948  .....HC...............IVVFL...D.C...N..-.-..-...--.-..........---..........---
ENSBTAP00000053727  .....SG...............LWLLI...D.D...Q..P.L..K...N-.-..........-NQ..........RLR
ENSBTAP00000027783  .....EG...............LKVYV...N.G...T..L.R..T...SD.P..........SGK..........ASP
ENSBTAP00000047997  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009228  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000048250  .....RS...............INLTL...D.R...S..T.Q..H...FR.T..........NGE..........FDY
ENSBTAP00000046960  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000044872  .....GN...............ATLQV...D.S...W..P.V..I...ER.Y..........PAG..........RQ-
ENSBTAP00000031529  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053650  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000020240  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000025061  .....--...............-----...-.-...-..E.-..-...--.-..........---..........---
ENSBTAP00000055305  .....--...............-----...-.-...-..-.-..-...--.-..........--S..........---
ENSBTAP00000036054  .....--...............-----...-.-...-..-.-..-...--.-..........--S..........---
ENSBTAP00000054766  .....GVle.............LRLWH...E.D...C..P.A..H...LC.V..........ASS..........PMA
ENSBTAP00000040914  .....GVle.............LRLWH...E.D...C..P.A..H...LC.V..........ASS..........PMA
ENSBTAP00000032513  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000025458  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000023092  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000054766  .....SR...............WLLWL...D.G...A..A.T..P...V-.-..........-SL..........--R
ENSBTAP00000009351  .....GG...............LKLAL...N.G...Q..G.V..G...AT.S..........LGQ..........QVL
ENSBTAP00000040914  .....SR...............WLLWL...D.G...A..A.T..P...V-.-..........-SL..........--R
ENSBTAP00000011612  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000054766  .....DQ...............LW---...-.-...-..-.-..-...--.-..........-GV..........---
ENSBTAP00000053495  .....TK...............ISFFI...N.G...L..E.K..D...NA.A..........FDA..........RTL
ENSBTAP00000040914  .....DQ...............LW---...-.-...-..-.-..-...--.-..........-GV..........---
ENSBTAP00000003981  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053932  .....GN...............ATLQV...D.S...W..P.V..I...ER.Y..........PA-..........---
ENSBTAP00000053616  .....RL...............MKLYM...N.G...A..Q.V..A...TS.G..........E--..........QVG
ENSBTAP00000048757  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000044383  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000026111  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009703  .....SR...............ATVAF...D.N...-..-.-..-...--.-..........---..........---
ENSBTAP00000022475  .....--...............-----...-.-...-..-.-..T...SW.R..........TNRt.........NPL
ENSBTAP00000003981  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000048250  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000005537  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000014043  .....--...............-----...-.-...-..-.-..-...--.-..........---..........P--
ENSBTAP00000048757  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000044383  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000037559  .....SL...............GSVGV...N.F...K..RnY..G...TV.S..........CNS..........---
ENSBTAP00000053727  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000022474  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036460  .....GS...............VELFL...D.C...T..R.V..D...S-.-..........---..........---
ENSBTAP00000003367  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000041534  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000055305  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036054  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000054517  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000038137  .....SL...............VYIYD...N.G...Q..Q.K..V...SA.P..........LRF..........P--
ENSBTAP00000053650  .....--...............-----...-.-...-..-.-..-...--.-..........LRV..........GWA
ENSBTAP00000020240  .....--...............-----...-.-...-..-.-..-...--.-..........LRV..........GWA
ENSBTAP00000056645  .....SL...............VYIYD...N.G...Q..Q.K..V...SA.P..........LRF..........P--
ENSBTAP00000047997  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000053365  .....ST...............ATLYI...D.G...Q..L.V..S...TV.K..........LHY..........---
ENSBTAP00000017949  .....ST...............ATLYI...D.G...Q..L.V..S...TV.K..........LHY..........---
ENSBTAP00000042505  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000009228  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000036054  .....--...............--M--...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000032513  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000055305  .....--...............--M--...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000042505  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000031529  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000002970  .....GQ...............IVVTT...S.T...G..Q.DlkD...YH.N..........QTI..........SFR
ENSBTAP00000009228  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000056398  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000031529  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---
ENSBTAP00000000063  .....PSkpspa..........LQLYV...D.C...K..L.-..-...--.-..........---..........---
ENSBTAP00000002071  .....--...............-----...-.-...-..-.-..-...--.-..........---..........---


                         160              170                                                      1
                           |                |                                                       
d2erfa1               S...VFTRDLA..SIAR.....LRIAK........G..........................GVN..........D..
ENSBTAP00000002600  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036460  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000006074  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000000063  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042078  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054517  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000046571  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000002071  -...--RFFTD..RKTH.....LYTLV........M..........................NPD..........D..
ENSBTAP00000005195  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000010569  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000001158  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000008979  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000018459  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054004  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000011393  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000034027  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000015061  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009824  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000012013  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009893  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000013175  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042458  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000020111  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000024852  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036910  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000028561  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000024658  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055797  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055913  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000027907  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000033248  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000045818  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000047271  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000011391  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000027551  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000022024  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000007623  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000015712  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009025  R...IDAIS--..----.....-----........-..........................---..........-..
ENSBTAP00000009005  R...IDAIS--..----.....-----........-..........................---..........-..
ENSBTAP00000012653  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000013346  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000013398  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000013121  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000026179  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055851  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000024853  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000021701  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000044710  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000041298  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000001294  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000021701  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000007366  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009909  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000029287  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009005  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009025  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054057  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000006913  P...RWK----..----.....-----........-..........................---..........-..
ENSBTAP00000043820  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000056333  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000018469  -...--GAILG..TEAS.....IILGQeq......D..........................AFA..........G..
ENSBTAP00000018010  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000046313  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053488  -...--HYTLN..SDAP.....LYVGG........Mpvdvnsaafrlwq.............ILN..........Gt.
ENSBTAP00000017563  G...TDGLN--..LDTD.....LFVGGvpe.....Dqastvlert.................SV-..........Si.
ENSBTAP00000020080  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000052704  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000023092  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000029126  T...SSKKSLD..LTGP.....LLLGGv.......Pnlpenfp...................VSH..........K..
ENSBTAP00000023900  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000034496  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053345  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000005971  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000028802  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000011769  P...YHP--IK..PQGV.....LVLGQeq......D..........................TLG..........G..
ENSBTAP00000054738  P...WHP--IK..PGGV.....LILGQeq......D..........................TVG..........G..
ENSBTAP00000004870  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000018010  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000021676  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042993  -...--STDLP..LGTS.....FWLGQr.......N..........................NAH..........G..
ENSBTAP00000022890  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053970  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000035935  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000056432  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053607  -...--QSTLN..FDSP.....LYVGG........Mpgknnvaaalrqap............GQN..........Gt.
ENSBTAP00000026956  R...LEFHNIE..TGII.....TERRYl.......S..........................SVP..........S..
ENSBTAP00000009351  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000022744  G...-----LN..LHTL.....LYLGGve......Pavqlppat..................NVS..........A..
ENSBTAP00000053511  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042181  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000026111  -...-Y-SKIT..FRTP.....LYLGG........Apsaywlvrat................GTN..........R..
ENSBTAP00000019994  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000037239  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000032103  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000010571  S...GSKKSLD..LTGP.....LLLGGv.......Pnlpedfp...................VRN..........R..
ENSBTAP00000014522  A...WHP--IK..PHGI.....LILGQeq......D..........................TLG..........G..
ENSBTAP00000002600  S...IFTRDLA..SIAR.....LRIAK........G..........................GVN..........D..
ENSBTAP00000054736  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054420  A...MLGNYSC..AAQG.....T----........QggskksldltgplllggvpdlpesfpVRT..........R..
ENSBTAP00000053498  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000027527  -...----TLN..LDSH.....VYFGG........Hvrqqgsrhgrsp..............QVG..........N..
ENSBTAP00000026111  -...---TQIK..CNSD.....IFIGGvpny....Ddvk.......................KNS..........Gil
ENSBTAP00000025424  Rl..NLDNEMF..IGGL.....VGAAQkn......L..........................AYR..........H..
ENSBTAP00000032310  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042078  E...HLQTE--..-RSR.....MYVAK........G..........................AAR..........Es.
ENSBTAP00000056054  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000025033  A...MLGNYSC..AAQG.....T----........QggskksldltgplllggvpdlpesfpVRT..........R..
ENSBTAP00000051925  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000017563  -...--ATQLD..TDGA.....LWLGGl.......Eklptgqalpk................AYG..........T..
ENSBTAP00000000307  -...---RNLD..LKGE.....LYIGGl.......Sknmfnnlpklv...............ASR..........D..
ENSBTAP00000028276  -...--KAIVD..TNGI.....MVFGT........R..........................ILD..........Ee.
ENSBTAP00000022744  -...--NVAVN..TKGS.....IYVGGapnv....Av.........................LTG..........G..
ENSBTAP00000026133  -...--GYAVG..AHPK.....IVLGQeq......D..........................SYG..........G..
ENSBTAP00000042592  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000023889  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053469  R...LEFHNIE..TGII.....TERRYl.......S..........................SVP..........S..
ENSBTAP00000033006  R...LEFHNIE..TGII.....TERRYl.......S..........................SVP..........S..
ENSBTAP00000053469  -...--SEILD..LDDE.....LYLGGl.......Penkaglvfptevwta...........LLN..........Y..
ENSBTAP00000026956  -...--SEILD..LDDE.....LYLGGl.......Penkaglvfptevwta...........LLN..........Y..
ENSBTAP00000033006  -...--SEILD..LDDE.....LYLGGl.......Penkaglvfptevwta...........LLN..........Y..
ENSBTAP00000026471  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042646  D...TSRMQIY..SGNR.....YYFGG........Cpdn.......................L-Tdsqclnpi..K..
ENSBTAP00000013075  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000000793  -...--RPVLD..TRGV.....IIFGA........R..........................ILD..........Ee.
ENSBTAP00000036729  L...HLDYEIS..FGGI.....PAPGKpv......S..........................FPH..........K..
ENSBTAP00000001939  I...--GSPIP..GGGA.....LVIGQeq......Dkkgeg.....................FNP..........Ae.
ENSBTAP00000029353  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000049986  V...AWGARAF..TS--.....-----........-..........................---..........-..
ENSBTAP00000028721  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000035185  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053469  -...---RNLD..LKSD.....LYIGG........Vaketykslpklv..............HAK..........E..
ENSBTAP00000026956  -...---RNLD..LKSD.....LYIGG........Vaketykslpklv..............HAK..........E..
ENSBTAP00000033006  -...---RNLD..LKSD.....LYIGG........Vaketykslpklv..............HAK..........E..
ENSBTAP00000053469  -...---TMLG..SDDF.....FYVGG........Spstadlpgs.................PVS..........N..
ENSBTAP00000024169  H...TQSTSAD..TSDP.....IYVGGypa.....Dvkqnc.....................LSS..........Rt.
ENSBTAP00000013134  -...-------..----.....W----........-..........................---..........-..
ENSBTAP00000036729  -...--PEQIY..SGGI.....FYFGG........C..........................PDSsfgskcksplG..
ENSBTAP00000037790  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053179  -...--ADILD..VVGM.....LYVGGlpinytt.R..........................RIG..........Pvt
ENSBTAP00000054149  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000000788  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000020299  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000013292  -...--ALTFE..PSAG.....IFVGN........A..........................GAT..........Gle
ENSBTAP00000000458  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000012225  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036729  -...--HVLLQ..LNSQ.....LFVGG........T..........................ATR..........Qr.
ENSBTAP00000008454  -...--RGQIE..SGDT.....YYLGGcp......Dn.........................S-Shpgctnsl..G..
ENSBTAP00000017076  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000000179  S...AIDT---..----.....-----........-..........................---..........-..
ENSBTAP00000042771  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000046486  -...--QPAVS..INSP.....LYLGGi.......Ptstglsalrqg...............M-Drpl.......G..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000005332  T...-----LG..TDSA.....IYFGAlvqa....Dsirsltda..................RVTqvl.......S..
ENSBTAP00000008454  -...--HARLQ..LNSQ.....LFVGG........T..........................ASR..........Qr.
ENSBTAP00000053720  -...--HTRLE..LYSQ.....LFVGG........A..........................GGQ..........Q..
ENSBTAP00000035185  EqlaILGRHLE..GSVL.....TFIGG........-..........................---..........-..
ENSBTAP00000017120  -...--GYTLG..QDAR.....IILGQeq......D..........................SFG..........G..
ENSBTAP00000053179  -...--STSAD..TNDP.....VFVGGfpdglnqfG..........................LTT..........Ni.
ENSBTAP00000011612  -...--PKPVD..HREP.....VFVGGv.......Peslltpr...................LAP..........Gr.
ENSBTAP00000032513  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000017857  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000008454  V...DLDYKIS..FGGI.....PGHGKsv......A..........................FPH..........K..
ENSBTAP00000027839  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053422  -...--RGQID..VDGF.....AVLGKl.......V..........................DNP..........Qv.
ENSBTAP00000000307  -...-----LD..LESE.....LYLGGl.......Peggrvdlplppevwta..........ALR..........A..
ENSBTAP00000017783  It..LDGVEVL..GRMV.....RSRGP........N..........................GNS..........A..
ENSBTAP00000005537  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000017563  P...--HTVLN..LKEP.....LFVGG........Apdfsklaraa................AVS..........S..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000000307  L...--EFHNI..ETGI.....MTERRfi......S..........................VVP..........S..
ENSBTAP00000011863  -...ATGHVVP..EGGI.....LQIGQekng....C..........................CVG..........G..
ENSBTAP00000053409  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000018697  -...--RRDMT..VFSG.....LFVGGl.......Ppelraaalkltlasv...........RER..........E..
ENSBTAP00000024169  -...--ATTLD..VEGK.....LYLGGlpsey...R..........................---..........-..
ENSBTAP00000033006  -...---TMLG..SDDF.....FYVGG........Spstadlpgs.................PVS..........N..
ENSBTAP00000026956  -...---TMLG..SDDF.....FYVGG........Spstadlpgs.................PVS..........N..
ENSBTAP00000026725  -...--AGNIT..TDGY.....EILGKllk.....G..........................-ER..........Ksa
ENSBTAP00000022744  Gl..DLNEELY..LGGY.....PDYGAipk.....A..........................GLS..........S..
ENSBTAP00000011612  -...--GADWK..IRGP.....IYLGGva......Pgravknv...................QIN..........Svy
ENSBTAP00000013316  D...DWTLDVQ..PNRV.....TVGGI........Ralepilqrrg................HVE..........Sh.
ENSBTAP00000025424  I...RTGTSYF..FGGC.....PKPASrsg.....C..........................HSN..........Qt.
ENSBTAP00000042646  L...DIDYELS..FGGI.....PVPGKpg......T..........................FLK..........K..
ENSBTAP00000024169  -...SSDLNRL..DKDP.....IYVGGlp......Rsrvvrkg...................VSS..........K..
ENSBTAP00000000307  -...--YTMLG..SDDF.....FYIGG........Spntadlpgs.................PVS..........N..
ENSBTAP00000013440  -...--PRFIS..TAGL.....TVLGT........Q..........................DLG..........Ee.
ENSBTAP00000006786  E...--GYEIP..PGGS.....LVLGQeq......D..........................HVG..........G..
ENSBTAP00000032513  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000025424  L...LVDSQLD..SPKA.....LYLGRv.......Metgvidpeiqr...............YNT..........P..
ENSBTAP00000054985  -...--HPVID..VNGI.....VVFGT........R..........................ILD..........Ee.
ENSBTAP00000004114  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000045584  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053179  N...-FGLDLK..ADDK.....IYFGGlptl....R..........................NLSmkarpevnv.K..
ENSBTAP00000053569  -...--NTSDT..FD-K.....CFLGSs.......E..........................TAD..........Anr
ENSBTAP00000012117  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053727  P...ARP----..-LER.....LYIGGvp......G..........................---..........-..
ENSBTAP00000008967  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000005686  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000031460  -...--RENID..IQGK.....TAIGK........R..........................LYD..........Sv.
ENSBTAP00000053495  -...--GTVIG..ENTG.....VFVGGl.......Pqgytilrkdsd...............IVQ..........K..
ENSBTAP00000007877  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000024169  -...--SRTIN..V-SS.....LYVGGi.......Pegegtpml..................KMR..........S..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036729  -...--GTELS..AVRS.....LVLGRii......Ehsdvdqeta.................LAG..........Aq.
ENSBTAP00000001200  R...--DPALD..PDGL.....FLFGK........M..........................SPH..........Av.
ENSBTAP00000034542  -...--DLQLE..PDAR.....LFVAQag......G..........................ADP..........E..
ENSBTAP00000000307  -...--RREMQ..VASD.....LFVGGi.......Ppdvrlsaltlstv.............KYE..........P..
ENSBTAP00000053495  -...--AQALM..VNSP.....VYVGGip......Qelhdpykhl.................KLE..........Q..
ENSBTAP00000024169  Gt..AKVLDVN..NSTM.....MFVGGlggqikksP..........................AVK..........Vt.
ENSBTAP00000023092  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000024358  N...--SPFMA..SCRS.....LLLGG........D..........................SSE..........Dgh
ENSBTAP00000000307  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000006361  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000032513  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053727  -...--NSTIS..LRAP.....VYLGSapsgkp..K..........................SLP..........Qn.
ENSBTAP00000054420  G...LHL----..--SN.....VTVGGvpgpa...S..........................GVA..........R..
ENSBTAP00000032310  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000023376  -...--GHPLP..PDGI.....LVLGQdq......Dslgggf....................SAR..........D..
ENSBTAP00000042646  -...--EVEFR..AMRS.....LTLGK........Vtenlgldaeva...............KAN..........Al.
ENSBTAP00000016055  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000003261  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053720  -...--DTLFN..SPKS.....LFLG-........-..........................---..........-..
ENSBTAP00000025033  G...LHL----..--SN.....VTVGGvpgpa...S..........................GVA..........R..
ENSBTAP00000004156  NlhfQHGIYIA..GHGG.....LEVSYl.......D..........................GQL..........P..
ENSBTAP00000025424  I...WLEYD--..--RP.....LYVGS........A..........................ELK..........Rr.
ENSBTAP00000054276  -...--RRSIE..PVGH.....VFLGL........D..........................AEQ..........Gk.
ENSBTAP00000023092  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000037835  -...--RRSIE..PVGH.....VFLGL........D..........................AEQ..........Gk.
ENSBTAP00000032513  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000008454  -...--GTEFN..AVKS.....LMLGTvl......Eplgadpdtl.................RAG..........Ar.
ENSBTAP00000010571  G...-----LR..MRSL.....IVGGVsedk....V..........................SVR..........R..
ENSBTAP00000015885  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000041534  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000023842  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000013316  G...--GLDV-..--LT.....ISLGGippnqahrD..........................AQT..........Gpa
ENSBTAP00000053179  -...--EQAIE..VKKL.....FIGGAppefqp..S..........................PLR..........Nip
ENSBTAP00000033786  -...--PFESD..GSSAcalqnSFLGGl.......Pegrahsgdallnvyr...........IPS..........Ap.
ENSBTAP00000016206  -...--SY-LE..PRGN.....LLLGGl.......D..........................AEA..........Sr.
ENSBTAP00000003981  A...TWA---N..TLVP.....LHLGGlpe.....P..........................WKR..........P..
ENSBTAP00000053566  G...LKPE---..--RD.....LFLGGlvhshss.P..........................NVS..........Q..
ENSBTAP00000048368  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000025190  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000004156  -...--SKLFV..SAGP.....LFVGGl.......Drhkgeevkrlglasvpgk........SAG..........Gi.
ENSBTAP00000010056  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000001189  -...--VLGIF..ISGQ.....TQIGK........Y..........................SGK..........Ee.
ENSBTAP00000046960  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055054  P...AAGFVML..GRLA.....KARGP........R..........................SSS..........As.
ENSBTAP00000006018  P...AAGFVML..GRLA.....KARGP........R..........................SSS..........As.
ENSBTAP00000055176  P...AAGFVML..GRLA.....KARGP........R..........................SSS..........As.
ENSBTAP00000003981  Q...--RQQGP..RPHT.....LFVGGl.......Pagghsprlpva...............ISS..........P..
ENSBTAP00000033786  -...--TWKLQ..RGDV.....LYVGGlpd.....Rrete......................VSG..........G..
ENSBTAP00000042646  -...--HFRLQ..LNSQ.....LFVGSgg......T..........................SSR..........Qk.
ENSBTAP00000043064  P...-----SK..IETQ.....LVVGA........Cwqeysgvesdnetepvplasaggdl.RMT..........Q..
ENSBTAP00000033786  S...---F-LK..DDTD.....VYVGD........R..........................ASD..........Str
ENSBTAP00000053179  G...YTILDVD..ANAM.....LFVGGltgklkkaD..........................AVR..........Vi.
ENSBTAP00000011480  Ps..HIAMQLT..VGAC.....WQGGEvtk.....P..........................RFA..........Q..
ENSBTAP00000011612  -...--KMKIP..FTDI.....YIGGA........Ppeilqsrtlrah..............LPL..........Di.
ENSBTAP00000029126  -...-KVKQLH..VGGL.....PHGAE........E..........................EAP..........Q..
ENSBTAP00000029938  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000007926  -...--EAITD..GPGT.....LRIGA........G..........................VNG..........Nd.
ENSBTAP00000011612  -...-VEQTQA..DEKK.....FYFGGs.......P..........................ITP..........Qya
ENSBTAP00000018394  A...YG--ESN..DNLV.....LDLTK........S..........................YEN..........R..
ENSBTAP00000003981  -...--QPQPE..GPPQ.....LLLGGs.......P..........................KSS..........Dir
ENSBTAP00000016206  -...--GAPLE..VPYG.....LFLGGt.......Gsldlpylt..................RAS..........R..
ENSBTAP00000010689  H...DNGLIHPprREPA.....LMIGA........Cwaeeknkekekggdnstdatagdpl.PIH..........H..
ENSBTAP00000018634  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000010687  H...DNGLIHPprREPA.....LMIGA........Cwaeeknkekekggdnstdatagdpl.PIH..........H..
ENSBTAP00000024762  A...TLSVR--..-GAR.....FFIGS........R..........................RRT..........Kg.
ENSBTAP00000053727  D...F-STYYL..GGIP.....ISIRErf......N..........................IST..........P..
ENSBTAP00000053802  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000039948  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053727  G...LSGFP--..----.....----Qsl......R..........................LGG..........S..
ENSBTAP00000027783  A...YG--ESN..DNLV.....LDLTK........S..........................YEN..........R..
ENSBTAP00000047997  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009228  -...-------..----.....-----........P..........................WQS..........G..
ENSBTAP00000048250  L...DLDYEIT..FGGI.....PFSGK........P..........................SSS..........Srk
ENSBTAP00000046960  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000044872  -...--LTIFN..SQAT.....IIIGG........K..........................EQG..........Q..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053650  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000020240  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000025061  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055305  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036054  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054766  T...AAP----..--AP.....TPAGSrf......T..........................QLG..........Gv.
ENSBTAP00000040914  T...AAP----..--AP.....TPAGSrf......T..........................QLG..........Gv.
ENSBTAP00000032513  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000025458  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000023092  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054766  -...--G--LA..GDLD.....FLRGPgaar....V..........................LLA..........E..
ENSBTAP00000009351  E...QL-----..----.....-----........-..........................---..........-..
ENSBTAP00000040914  -...--G--LA..GDLD.....FLRGPgaar....V..........................LLA..........E..
ENSBTAP00000011612  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054766  -...--GQQVH..VGGR.....LLPGDa.......E..........................PWG..........G..
ENSBTAP00000053495  S...G-SITDF..ASGT.....MQIGQ........S..........................LNG..........Se.
ENSBTAP00000040914  -...--GQQVH..VGGR.....LLPGDa.......E..........................PWG..........G..
ENSBTAP00000003981  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053932  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053616  G...IFSPLTQ..KCKV.....LMLGG........S..........................TLN..........H..
ENSBTAP00000048757  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000044383  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000026111  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009703  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000022475  G...RQLTIFN..TQAQ.....IAIGG........K..........................DKG..........R..
ENSBTAP00000003981  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000048250  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000005537  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000014043  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000048757  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000044383  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000037559  -...SMGKVIP..GNGK.....LLLGS........N..........................QHDi.........G..
ENSBTAP00000053727  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000022474  -...---TIFN..TQAQ.....IAIGG........K..........................DKG..........R..
ENSBTAP00000036460  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000003367  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000041534  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055305  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036054  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000054517  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000038137  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000053650  S...TEGYSPY..PGGG.....EEWGG........N..........................GVG..........Dd.
ENSBTAP00000020240  S...TEGYSPY..PGGG.....EEWGG........N..........................GVG..........Dd.
ENSBTAP00000056645  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000047997  -...-------..----.....----A........-..........................---..........-..
ENSBTAP00000053365  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000017949  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042505  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000009228  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000036054  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000032513  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000055305  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000042505  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000002970  E...DFHYN-D..TSGY.....FIIGGs.......R..........................YVA..........Gie
ENSBTAP00000009228  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000056398  -...-------..----.....-----........-..........................--Q..........P..
ENSBTAP00000031529  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000000063  -...-------..----.....-----........-..........................---..........-..
ENSBTAP00000002071  -...-------..----.....-----........-..........................---..........-..


                      80                    190          200                                        
                       |                      |            |                                        
d2erfa1               .NFQ.............GVLQNVRFVFGT..T.PEDIL..RN.KGCS...............................
ENSBTAP00000002600  .---.............------------..-.-----..--.----tqsywdtnptraqgysglsvkvvnsttgpge
ENSBTAP00000036460  .---.............------------..-.-----..--.----kqteqtywqatpfravaepgiqlkavksktg
ENSBTAP00000006074  .---.............------------..-.-----..--.----kqmeqtywqanpfravaepgiqlkavksstg
ENSBTAP00000000063  .---.............------------..-.-----..--.----kqteqtywqatpfravaqpglqlkavtsvsg
ENSBTAP00000042078  .---.............------------..-.-----..--.----tywedqptraygysgvslkvvnsttgtgehl
ENSBTAP00000054517  .---.............------------..-.-----..--.----knpktgvyeekhakrpdadlktyftdkkthl
ENSBTAP00000046571  .---.............------------..-.-----..--.----hydtflviryvkrhltimmdidgkhewrdci
ENSBTAP00000002071  .TFE.............VLIDQIVVNKGS..L.LED--..--.----vvppinppkeiedptde..............
ENSBTAP00000005195  .---.............------------..-.-----..--.----lhydtflviryvkrhltimmdidgkhewrdc
ENSBTAP00000010569  .---.............------------..-.-----..--.----ydhskdgrwtelagctadfrnrdhdtflavr
ENSBTAP00000001158  .---.............------------..-.-----..--.----gifldydagevsfynvterchtftfshatfc
ENSBTAP00000008979  .---.............------------..-.-----..--.----dsfdndgkknnpaiviignngqihydhqndg
ENSBTAP00000018459  .---.............------------..-.-----..--.----secafagplrpffnpgfndrgtnsaplilcp
ENSBTAP00000054004  .---.............------------..-.-----..--.----secafagplrpffnpgfndrgtnsaplilcp
ENSBTAP00000011393  .---.............------------..-.-----..--.----gifldyesghiafynvtdesliysfppasfq
ENSBTAP00000034027  .---.............------------..-.-----..--.----gkklypvvsavwghceirmrylngldpeplp
ENSBTAP00000015061  .---.............------------..-.-----..--.----fpgrllpyfspcysiganntaplaics....
ENSBTAP00000009824  .---.............------------..-.-----..--.----hlerprcigifldyeageisfynitngsfiy
ENSBTAP00000012013  .---.............------------..-.-----..--.----gkklypvvsavwghcevtmryingldpeplp
ENSBTAP00000009893  .---.............------------..-.-----..--.----cslkltnnlnkvgiyldyeggqvsfynaktm
ENSBTAP00000013175  .---.............------------..-.-----..--.----qkmdcgggyiklfpadvdqknlngksqyyim
ENSBTAP00000042458  .---.............------------..-.-----..--.----shiytfskasfsgplrpffclwscgkkplti
ENSBTAP00000020111  .---.............------------..-.-----..--.----leddwdflppkkikdpdaakpedwddrakid
ENSBTAP00000024852  .---.............------------..-.-----..--.----andgsllytfpetpfsgtlralfsplssspt
ENSBTAP00000036910  .---.............------------..-.-----..--.----qtfygvlrplfrlwssds.............
ENSBTAP00000028561  .---.............------------..-.-----..--.----lfdssaqdpqnspaiyvlardrhtlyeplgd
ENSBTAP00000024658  .---.............------------..-.-----..--.----iftfpkasfsdtlrpyfqvylysp.......
ENSBTAP00000055797  .---.............------------..-.-----..--.----ivrvfldyesgdvsfynmtdeshiftfpqnp
ENSBTAP00000055913  .---.............------------..-.-----..--.----rvpprcvgifldieagklsffnvsdgshift
ENSBTAP00000027907  .---.............------------..-.-----..--.----walqlnngqywavtspertplscghlsrvrv
ENSBTAP00000033248  .---.............------------..-.-----..--.----qgvdcgggymklfpdtmnqedmhseleyyim
ENSBTAP00000045818  .---.............------------..-.-----..--.----vldmeegtlgyavggtylgpafrglkgrtly
ENSBTAP00000047271  .---.............------------..-.-----..--.----yvallgsddqswgwnlvdnnllhngevngsf
ENSBTAP00000011391  .---.............------------..-.-----..--.----fkrvslreqvhrvgvfldyeyeqisfydatk
ENSBTAP00000027551  .---.............------------..-.-----..--.----vrdkldkvgvfldydqgllifynaddmswly
ENSBTAP00000022024  .---.............------------..-.-----..--.----tsfssrfgqgsiigvhldtwhgtltffknrk
ENSBTAP00000007623  .---.............------------..-.-----..--.----hphrigiylhyeqgeltffdadrpddlrply
ENSBTAP00000015712  .---.............------------..-.-----..--.----yfpttlcpyfnpcncvfpmt...........
ENSBTAP00000009025  .---.............------------..-.-----..--.----itgvvqlssisfqniraap............
ENSBTAP00000009005  .---.............------------..-.-----..--.----itgvvqlssisfqppgiwp............
ENSBTAP00000012653  .---.............------------..-.-----..--.----qvevqlgdgggctvgvvgeevrrkgeqglsa
ENSBTAP00000013346  .---.............------------..-.-----..--.----htnrteggitkgatigvlldfnrktltffin
ENSBTAP00000013398  .---.............------------..-.-----..--.----yaiglayksapkhewigknsaswalcrchnt
ENSBTAP00000013121  .---.............------------..-.-----..--.----fntkisawhnnvektlpstkatrvgvllncd
ENSBTAP00000026179  .---.............------------..-.-----..--.----gsggssvgsgdasssrhhhrrrrlhlpqqpl
ENSBTAP00000055851  .---.............------------..-.-----..--.----pqasfsgtlfpyfmirygdvsmtics.....
ENSBTAP00000024853  .---.............------------..-.-----..--.----apaaftptpvtlaeppshmgifldfeagela
ENSBTAP00000021701  .---.............------------..-.-----..--.----safqrvdlveihgdvtlsyvqi.........
ENSBTAP00000044710  .---.............------------..-.-----..--.----qqahvpinpsgpfqiifegvrgsgylgdiai
ENSBTAP00000041298  .---.............------------..-.-----..--.----nnnwgkeerqmvfpfesgkpfkiqvlvepdh
ENSBTAP00000001294  .---.............------------..-.-----..--.----nlqaplgydkfsyswrskkgtkfhqsigkhy
ENSBTAP00000021701  .---.............------------..-.-----..--.----skqngswgqeerkmsmpfrkgaafelvfmvm
ENSBTAP00000007366  .---.............------------..-.-----..--.----cnfsrnaypyfnpwdcpapmtlcpp......
ENSBTAP00000009909  .---.............------------..-.-----..--.----skdirrkgelrmrpeegvwavrlawgfvsal
ENSBTAP00000029287  .---.............------------..-.-----..--.----gvlldydnnmlsfydpanslhlhtfdvtfil
ENSBTAP00000009005  .---.............------------..-.-----..--.----knlpainnlevggdiqlthvq..........
ENSBTAP00000009025  .---.............------------..-.-----..--.----knlpainnlevggdiqlthvq..........
ENSBTAP00000054057  .---.............------------..-.-----..--.----cnfsrnaypyfnpwdcpapmtlcpp......
ENSBTAP00000006913  .---.............------------..-.-----..--.----qvyedygvlgspviksgrhywevdvskkraw
ENSBTAP00000043820  .---.............------------..-.-----..--.----hpipaacgiyyfevkivskgrdgymgiglsa
ENSBTAP00000056333  .---.............------------..-.-----..--.----hfnprfeegryvvcntkqlgkwgpeerkmqm
ENSBTAP00000018469  .GFDrnqclv.......GDIGDVNMWDFV..L.SPEEI..--.----navylgstlspnvlnwqalnyeakgevfikp
ENSBTAP00000018010  .RFQ.............VDLQ--------..-.-----..--.----cgssvkpradvafhfnprfkrancvvcntlr
ENSBTAP00000046313  .---.............------------..-.-----..--.----gtlfpyfslrgtgaslticstsdhpehcpds
ENSBTAP00000053488  .SFH.............GCIRNLYINNE-..-.-----..--.----lqdftktrmkpgvvpgc..............
ENSBTAP00000017563  .GLR.............GCIRLLDVNN--..-.-----..--.----qrlelsswpesatrssgvgkcgdhpclpspc
ENSBTAP00000020080  .---.............------------..-.-----..--.----rlnleainylsaggdfkikcvaf........
ENSBTAP00000052704  .---.............------------..-.-----..--.----sfpqnivpyfnpmncv...............
ENSBTAP00000031529  .---.............------------..-.-----..--.----gnqgpiwirkslnlfsrkpfqisveasvgdg
ENSBTAP00000023092  .---.............------------..-.-----..--.----tgkhcltffyhmygagtgllnvylkkegdse
ENSBTAP00000029126  .DFV.............GCMRDLHIDGR-..-.-----..--.----rvdmasfvanngtvagcqak...........
ENSBTAP00000023900  .---.............------------..-.-----..--.----dskgiflllcikensqhslftsfpplpqyvk
ENSBTAP00000034496  .---.............------------..-.-----..--.----raafqeplypalrlwegaisi..........
ENSBTAP00000053345  .---.............------------..-.-----..--.----laidevkvlghpct.................
ENSBTAP00000005971  .---.............------------..-.-----..--.----slsvslhrvgvfldyeahtvlflnvtnhgfp
ENSBTAP00000028802  .---.............------------..-.-----..--.----rlghshlsylgvqn.................
ENSBTAP00000011769  .GFDatqafv.......GELAHFNIWDRK..L.TPGEV..YNlATC-stkalsgnviawaeshieiyggatk......
ENSBTAP00000054738  .RFDatqafv.......GELSQFNIWDRV..L.RAQEI..INiANC-stnmpgniipwvdnnvdvfggaskw......
ENSBTAP00000004870  .---.............------------..-.-----..--.----sfpqnivpyfnp...................
ENSBTAP00000018010  .---.............------------..-.-----..--.----geeernitcfpfspgmyfemiiycdarefkv
ENSBTAP00000021676  .---.............------------..-.-----..--.----lllcvskdghfslfstfpflphyiqrpqgyi
ENSBTAP00000042993  .YFK.............GIMQDVQLLVMP..Q.-----..--.----gfiaqcpdlnrtc..................
ENSBTAP00000022890  .---.............------------..-.-----..--.----rgmkrdqilgrttdswcvewkgasqlsawcm
ENSBTAP00000053970  .---.............------------..-.-----..--.----kvgvhvnhecgkvvfydattsnhlytfhasf
ENSBTAP00000035935  .---.............------------..-.-----..--.----hmygqhigvlnvylrlkgqttienplwsssg
ENSBTAP00000056432  .---.............------------..-.-----..--.----pgrvralevggdlqlelvk............
ENSBTAP00000053607  .SFH.............GCIRNLYINSE-..-.-----..--.----lqdfrkvpmqtgilpgc..............
ENSBTAP00000026956  .NFI.............GHLQSLTF----..-.-----..--.----n..............................
ENSBTAP00000009351  .---.............------------..-.-----..--.----flhyryrlplsrvdtlgifgdisvtavgf..
ENSBTAP00000022744  .HFH.............GCVGEVSVNGK-..-.-----..--.----rldltysflgsqgvgqc..............
ENSBTAP00000053511  .---.............------------..-.-----..--.----rfshdgqheplallrcpaqlgvlldlqaqel
ENSBTAP00000042181  .---.............------------..-.-----..--.----rvralevggdlqlelvk..............
ENSBTAP00000026111  .GFQ.............GCVQALTVNGK-..-.-----..--.----rldlrpwplgkalsgadvgecssg.......
ENSBTAP00000019994  .---.............------------..-.-----..--.----rhkyeflhnkmtpdiritvppkkigilldye
ENSBTAP00000037239  .---.............------------..-.-----..--.----dalellfafherlpgpvypffdvcwhdkgkn
ENSBTAP00000032103  .---.............------------..-.-----..--.----pqasfsgtlfpyfmissgnvsltvc......
ENSBTAP00000010571  .QFV.............GCMRNLSIDGR-..-.-----..--.----hvdmasfianngtragcaaq...........
ENSBTAP00000014522  .RFDatqafv.......GDIAQFNLWDHA..L.TPAQV..L-.----gianctgpllgnilpwedklveafggat...
ENSBTAP00000002600  .NFQ.............GVLQNVRFVFGT..T.PEDIL..RN.KGCS...............................
ENSBTAP00000054736  .---.............------------..-.-----..--.----tafshvdgvfmpalslnrnvqidlw......
ENSBTAP00000054420  .QFV.............GCIRNLQVDSR-..-.-----..--.----hvdmadfianngtmpgcpakk..........
ENSBTAP00000053498  .---.............------------..-.-----..--.----pgtlnilvrvnkgplanpiwnvtgftgrdwl
ENSBTAP00000027527  .GFR.............GCMDSIYLNGQ-..-.-----..--.----elplnnrprsyahieesvdvspgcllt....
ENSBTAP00000026111  kPFS.............GSIQKIILNDRT..-.-----..--.----ihvkhdftwgvnvenaahpcvgspc......
ENSBTAP00000025424  .NFR.............GCIENVIF----..-.-----..--.----n..............................
ENSBTAP00000032310  .---.............------------..-.-----..--.----akeavmninkpgslfkptngfletkvyfagv
ENSBTAP00000042078  .HFR.............GLLQNVYLVFEN..S.VEDLL..SK.KGC-...............................
ENSBTAP00000056054  .---.............------------..-.-----..--.----fcqfahrlplqsvkmlkvkgdtvltsv....
ENSBTAP00000025033  .QFV.............GCIRNLQVDSR-..-.-----..--.----hvdmadfianngtmpgcpakk..........
ENSBTAP00000051925  .---.............------------..-.-----..--.----pplvqfvkrplgkigvfldydngalsfydvs
ENSBTAP00000017563  .GFV.............GCLRDVVVGQRP..-.-----..--.----vhlledaitkpelrpcp..............
ENSBTAP00000000307  .GFQ.............GCLASVDL----..-.-----..--.----n..............................
ENSBTAP00000028276  .VFE.............GDIQQLLIIGDP..K.AAYDY..CE.H---yspdc..........................
ENSBTAP00000022744  .RFSsgit.........GCIKNLVLH---..-.-----..--.----sa.............................
ENSBTAP00000026133  .GFDknqsfm.......GEIGDLYMWDSV..L.SPEEI..L-.----lvyqgsssisptildwqalkyeikgyvivkp
ENSBTAP00000042592  .---.............------------..-.-----..--.----ydnhpdpafgvaridvmkdvmlgkddkawai
ENSBTAP00000023889  .---.............------------..-.-----..--.----svvswgtrafasgrhyweldvthssswilgi
ENSBTAP00000053469  .NFI.............GHLQSLTF----..-.-----..--.----n..............................
ENSBTAP00000033006  .NFI.............GHLQSLTF----..-.-----..--.----n..............................
ENSBTAP00000053469  .GYV.............GCIRDLFIDGQ-..-.-----..--.----skdirqmaevqstagvkpsc...........
ENSBTAP00000026956  .GYV.............GCIRDLFIDGQ-..-.-----..--.----skdirqmaevqstagvkpsc...........
ENSBTAP00000033006  .GYV.............GCIRDLFIDGQ-..-.-----..--.----skdirqmaevqstagvkpsc...........
ENSBTAP00000026471  .---.............------------..-.-----..--.----spvvysqnaahcmtfwyhmsgshvgtlrvkl
ENSBTAP00000042646  .AFQ.............GCMRLIFI----..-.-----..--.----d..............................
ENSBTAP00000013075  .---.............------------..-.-----..--.----qasldlgtdkfgfgfggtgkkshnkqfdnyg
ENSBTAP00000000793  .VFE.............GDIQELSIIPGV..Q.AAYES..CD.----q..............................
ENSBTAP00000036729  .HFH.............GCLENLF-----..-.-----..--.----yd.............................
ENSBTAP00000001939  .SFV.............GSISQLNLWDYV..L.SPQQV..--.----kslatscpeelskgnvlawpdflsgivgrvk
ENSBTAP00000029353  .---.............------------..-.-----..--.----seltrrrqgphtdnigrgpsswglciqedct
ENSBTAP00000049986  .---.............------------..-.-----..--.----grhyweadvtqsfnwilgvckniltsdtsis
ENSBTAP00000028721  .---.............------------..-.-----..--.----vnlinntcfytknghslgiaftdlppnlypt
ENSBTAP00000035185  .---.............------------..-.-----..--.----fqldrglyhlnltvggipfqekdlvhpmnpr
ENSBTAP00000053469  .GFQ.............GCLASVDL----..-.-----..--.----n..............................
ENSBTAP00000026956  .GFQ.............GCLASVDL----..-.-----..--.----n..............................
ENSBTAP00000033006  .GFQ.............GCLASVDL----..-.-----..--.----n..............................
ENSBTAP00000053469  .NFM.............GCLKEVV-----..-.-----..--.----yknndvrl.......................
ENSBTAP00000024169  .SFR.............GCVRRLTLTKGP..Q.VQ---..--.----sfdfstafdlqgvfphscp............
ENSBTAP00000013134  .---.............------------..-.-----..--.----yvgrtqgvdgdhcvtsdpaasplvpaiprrl
ENSBTAP00000036729  .GFQ.............GCMR--------..-.-----..--.----lis............................
ENSBTAP00000037790  .---.............------------..-.-----..--.----tvlhggyhrtlgvlldcaagclsfygvaggv
ENSBTAP00000053179  ySID.............GCIRNLHMVEA-..-.-----..--.----padleqptssyqvgt................
ENSBTAP00000054149  .---.............------------..-.-----..--.----ptgpggrrervglltlpldptpeqaclsfwy
ENSBTAP00000000788  .---.............------------..-.-----..--.----ptgpggrrervglltlpldptpeqaclsfwy
ENSBTAP00000020299  .---.............------------..-.-----..--.----piqsvkmlkvrgdtvltsv............
ENSBTAP00000013292  .RFI.............GSIQQLIIHPDP..R.TPEEM..CE.----...............................
ENSBTAP00000000458  .---.............------------..-.-----..--.----iysflpsafsspmipflclk...........
ENSBTAP00000012225  .---.............------------..-.-----..--.----tmlanekapvegmgqpekvgllleyeaqkls
ENSBTAP00000036729  .GFL.............GCIRSLQL----..-.-----..--.----n..............................
ENSBTAP00000008454  .GFQ.............GCLR--------..-.-----..--.----lis............................
ENSBTAP00000017076  .---.............------------..-.-----..--.----tfwpneyqvlfealvspdrrgymglddilll
ENSBTAP00000000179  .---.............------------..-.-----..--.----ikingdlqitkl...................
ENSBTAP00000042771  .--N.............------------..-.-----..--.----qeegvgdthnsyaydgnrvrkwnvtttnygk
ENSBTAP00000046486  .GFH.............GCIHEVRINNE-..-.-----..--.----lqdfkalppqalgvspgc.............
ENSBTAP00000031529  .---.............------------..-.-----..--.----igaltliqvsvsnqtkvllnltveqgnfwqr
ENSBTAP00000005332  .GFQ.............GCLDSVVLNNN-..-.-----..--.----elplqnkr.......................
ENSBTAP00000008454  .GFL.............GCIRSLRLNG--..-.-----..--.----laldleerammtpgvepgcpghc........
ENSBTAP00000053720  .GFL.............GCIRSLRMNG--..-.-----..--.----vtldleerakvtsgfksgcsgh.........
ENSBTAP00000035185  .---.............--LPDVPVTSA-..-.-----..--.----pvtafyrgcmtlevnrkaldldeaaykhsdi
ENSBTAP00000017120  .KFDakqsfv.......GEIWDVSLWDHV..V.S----..--.----lknlcftcytsnilnwkaliyqakgyvvvkp
ENSBTAP00000053179  .PFR.............GCIRSLKLTKG-..-.-----..--.----tgkplevnfakalelrgvqpvsc........
ENSBTAP00000011612  .PFT.............GCIRHFVIDGRP..V.-----..--.----sfskaalvsgavsinscpa............
ENSBTAP00000032513  .---.............------------..-.-----..--.----esrgprydhttgqghfvlldpvdppargpaa
ENSBTAP00000017857  .---.............------------..-.-----..--.----kvkaldvavperigvfcdfdggqlsfydans
ENSBTAP00000008454  .NFH.............GCFENL------..-.-----..--.----yyn............................
ENSBTAP00000027839  .---.............------------..-.-----..--.----fssatmvanafqggrwgqeeassifplvlge
ENSBTAP00000053422  .SVP.............FELQWMLIHCDP..L.RP---..--.----r..............................
ENSBTAP00000000307  .GYV.............GCVRDLFIDGRS..-.-----..--.----rdlrglaeaqgavgvapfc............
ENSBTAP00000017783  .PFQ.............--LQMFDIVCST..S.WAN--..KD.KCC-...............................
ENSBTAP00000005537  .---.............------------..-.-----..--.----clrqvfgqqannsqlimrialggllfpasdl
ENSBTAP00000017563  .GFD.............GAIQLVSLNGRQ..L.LT---..--.----renvvra........................
ENSBTAP00000031529  .---.............------------..-.-----..--.----igdvavddisfqdc.................
ENSBTAP00000000307  .NFI.............GHLSGL------..-.-----..--.----vfn............................
ENSBTAP00000011863  .GFDetlafs.......GRLTGFNIWDGV..L.SNEEI..RE.A---ggaeschirgnvvgwg...............
ENSBTAP00000053409  .---.............------------..-.-----..--.----vldmeartisfgkngeepklafedvdaaely
ENSBTAP00000018697  .PFK.............GWIRDVRV----..-.-----..--.----n..............................
ENSBTAP00000024169  .---.............------------..-.-----..--.----arntgnithsvpaclgevtvnsqqlhmdi..
ENSBTAP00000033006  .NFM.............GCLKEVV-----..-.-----..--.----yknndvrl.......................
ENSBTAP00000026956  .NFM.............GCLKEVV-----..-.-----..--.----yknndvrl.......................
ENSBTAP00000026725  .TFQ.............--IQNFDIVCSP..V.WTS--..RD.RCCD...............................
ENSBTAP00000022744  .GFI.............GCVRELRIQGE-..-.-----..--.----eivfhdlnltahgishcpt............
ENSBTAP00000011612  .SFS.............GCLSNLQLNGAS..-.-----..--.----itsasqt........................
ENSBTAP00000013316  .DFV.............GCIMEFAVNGRP..L.EPSQ-..--.----alaaqgildqcprle................
ENSBTAP00000025424  .AFH.............GCMELLKV----..-.-----..--.----d..............................
ENSBTAP00000042646  .NFH.............GCIENLY-----..-.-----..--.----yn.............................
ENSBTAP00000024169  .SYV.............GCIKNLEISRS-..-.-----..--.----tfdllrnsygvrkgcile.............
ENSBTAP00000000307  .NFM.............GCLKDVV-----..-.-----..--.----yknndfk........................
ENSBTAP00000013440  .TFE.............GDVQELVISPDP..Q.AAFQA..CE.R---ylpgc..........................
ENSBTAP00000006786  .GFDsseafv.......GSMAGLAIWDRV..L.VPGEI..S-.----nlamgkalptgailtldnatsvggfvqrvnc
ENSBTAP00000032513  .---.............------------..-.-----..--.----yqgelrvllssaqgqlavwgaggrhrhqwle
ENSBTAP00000025424  .GFS.............GCLSGVRF----..-.-----..--.----n..............................
ENSBTAP00000054985  .VFE.............------------..-.-----..--.----...............................
ENSBTAP00000004114  .---.............------------..-.-----..--.----gdkfaendvigcfadfecgndvelsftkngk
ENSBTAP00000045584  .---.............------------..-.-----..--.----atnkfrvvfegvrgagaslgglsiddinlse
ENSBTAP00000053179  .KYS.............GCLKDIEISRTP..-.-----..--.----ynilsspdyvgvtkgcsle............
ENSBTAP00000053569  .VFC.............GQMTAVYLF---..-.-----..--.----seal...........................
ENSBTAP00000012117  .---.............------------..-.-----..--.----dsgsiissdtssshvrtqthiytqhtsvh..
ENSBTAP00000053727  .---.............------------..-.-----..--.----nlktpklpvwtsffgclrniqvnhipvpvtg
ENSBTAP00000008967  .---.............------------..-.-----..--.----arvgilldyttqrllfinaetgqmlfiirhr
ENSBTAP00000005686  .---.............------------..-.-----..--.----iahvtlreekkfrylfqgtkgdpqnssggiy
ENSBTAP00000031460  .PVD.............FDLQRVVIYCDS..R.HAE--..LE.TCC-...............................
ENSBTAP00000053495  .GFV.............GCLKDVYFMK--..-.-----..--.----ny.............................
ENSBTAP00000007877  .---.............------------..-.-----..--.----khankakmldapvpdclgvhcdfhqgllsfy
ENSBTAP00000024169  .SFH.............GCIRNLVFN---..-.-----..--.----melldftsaadyehadldscsl.........
ENSBTAP00000031529  .---.............------------..-.-----..--.----feadlsgkqnifialddisftpec.......
ENSBTAP00000036729  .GFL.............GCLSAV------..-.-----..--.----qv.............................
ENSBTAP00000001200  .QFE.............GALCQFSIYPVA..Q.VAHNY..CT.----hlrkqc.........................
ENSBTAP00000034542  .KFQ.............GLISELRLRRDP..Q.VSPRQ..C-.----q..............................
ENSBTAP00000000307  .PFR.............GLLANL------..-.-----..--.----k..............................
ENSBTAP00000053495  .GFG.............GCMKDVKFARGA..V.-----..--.----inlasvssgavrvnldgclstd.........
ENSBTAP00000024169  .HFK.............GCMGEAFLNGQSigL.WNYIE..RE.GEC-hgcf...........................
ENSBTAP00000023092  .---.............------------..-.-----..--.----aglyeeiwkagdpgnavwnlaeaefsapypk
ENSBTAP00000024358  .SFR.............GHLGILVFWSTA..R.SQS--..--.----hlq............................
ENSBTAP00000000307  .---.............------------..-.-----..--.----nfdnerlaiarqripyrlgrvvdewlldkgr
ENSBTAP00000006361  .---.............------------..-.-----..--.----eyscaydgcrqliwynarskphlhpcwkegd
ENSBTAP00000032513  .---.............------------..-.-----..--.----gafrvtfsatrnathrgtvalddvafwrc..
ENSBTAP00000053727  .SFV.............GCLRNFQLDLKP..-.-----..--.----letpsasfgvspc..................
ENSBTAP00000054420  .GFR.............GCLQGVRVSETP..-.-----..--.----egvssldpsrgesinvepgc...........
ENSBTAP00000032310  .---.............------------..-.-----..--.----qdilvsvesmvigrieaislcsdqqtfleir
ENSBTAP00000023376  .AFS.............GNLTDFHLWARA..L.SPGQMh.RA.RAC-apppggllfrwdl..................
ENSBTAP00000042646  .GFV.............GCLAS-------..-.-----..--.----vqyn...........................
ENSBTAP00000016055  .---.............------------..-.-----..--.----nmtdethifsfthtnfsgsvypyfklksme.
ENSBTAP00000003261  .---.............------------..-.-----..--.----lpmkegctevsllrvgwsvdfshpqlgedef
ENSBTAP00000053720  .---.............------------..-.-----..--.----kv.............................
ENSBTAP00000025033  .GFR.............GCLQGVRVSETP..-.-----..--.----egvssldpsrgesinvepgc...........
ENSBTAP00000004156  .NFR.............GCMEDVVFNQR-..-.-----..--.----eilssl.........................
ENSBTAP00000025424  .PFV.............GCLRAMRLNG--..-.-----..--.----vtlnlegranasegtspnctg..........
ENSBTAP00000054276  .PVS.............FDLQQAHIYCDP..E.-----..--.----fvleegcc.......................
ENSBTAP00000023092  .---.............------------..-.-----..--.----rfyyaisgflkmsdtlavyifeenhvvqdki
ENSBTAP00000037835  .PVS.............FDLQQAHIYCDP..E.-----..--.----fvleegcc.......................
ENSBTAP00000032513  .---.............------------..-.-----..--.----aawrlgsvdlqagqawrvvfeavaagvehsy
ENSBTAP00000008454  .GFT.............GCLSAVR-----..-.-----..--.----f..............................
ENSBTAP00000010571  .GFQ.............GCMQGVRMG---..-.-----..--.----etatniatlnmndalkvrvkdgc........
ENSBTAP00000015885  .---.............------------..-.-----..--.----grgvalqvvreasqeskllwviredqggewk
ENSBTAP00000041534  .---.............------------..-.-----..--.----kfsqegqsyklvsrpfcapgaicvaftyhmd
ENSBTAP00000023842  .---.............------------..-.-----..--.----lawektrsmdeqwrmgkiqlyhridtpksii
ENSBTAP00000013316  .GFD.............GCIASM------..-.-----..--.----lyggeslpfsgkhslasisktdpsvkigcrg
ENSBTAP00000053179  .PFE.............GCIWNLVINSV-..-.-----..--.----pmdfaqpvsfknadigrcah...........
ENSBTAP00000033786  .SLV.............GCLQDVHLDSNA..I.TAENV..--.----ssdqslnvkagcarkdwc.............
ENSBTAP00000016206  .HLQehrlglavnvsllGCMEDLSVNG--..-.-----..--.----qrqglrealltrnmaagc.............
ENSBTAP00000003981  .HYN.............GCMRNLVLN---..-.-----..--.----qvsvtwprtagvqgavgasgcp.........
ENSBTAP00000053566  .GFE.............GCLDAVVINREV..-.-----..--.----lel............................
ENSBTAP00000048368  .---.............------------..-.-----..--.----tsgmllgeeefsygyslkgiktcncetedyg
ENSBTAP00000025190  .---.............------------..-.-----..--.----fhgqeaplphpfsptvgicleyadralafya
ENSBTAP00000004156  .SFK.............GCLRGL------..-.-----..--.----eansekralkdafvskdisagc.........
ENSBTAP00000010056  .---.............------------..-.-----..--.----etrlrdlpdtprrftfypcvlategftsgrh
ENSBTAP00000001189  .TVQ.............FEVQKLRIYCDP..E.QN---..--.----n..............................
ENSBTAP00000046960  .---.............------------..-.-----..--.----ggtvtftnaesqeliytftatftrrllpflw
ENSBTAP00000055054  .KFQ.............--LQVLQLVCND..S.WAE--..ED.RCC-...............................
ENSBTAP00000006018  .KFQ.............--LQVLQLVCND..S.WAE--..ED.RCC-...............................
ENSBTAP00000055176  .KFQ.............--LQVLQLVCND..S.WAE--..ED.RCC-...............................
ENSBTAP00000003981  .EFR.............GCVKRLRLDGRL..L.RA---..--.----ptrmv..........................
ENSBTAP00000033786  .FFK.............GCIQDMRLNNE-..-.-----..--.----nleffpnptssaahnavlvnvtegcpgdnl.
ENSBTAP00000042646  .GFL.............GCIRSLHLNGQ-..-.-----..--.----kldleerakvtsgvrpgcpghcss.......
ENSBTAP00000043064  .FFR.............GNLAGLTIRSGK..L.TDKKVidCL.YTC-...............................
ENSBTAP00000033786  .ALR.............GCLSTIAIS---..-.-----..--.----glylsyfenvrgl..................
ENSBTAP00000053179  .TFT.............GCMGEAYFDSKPigL.WNFRE..IE.GDC-kgc............................
ENSBTAP00000011480  .FFH.............GSLASLTIRPGK..MdSQKVIs.CL.QAC-...............................
ENSBTAP00000011612  .NFR.............GCMKGFQF----..-.-----..--.----qkkdfnlleqtetlgvgygcped........
ENSBTAP00000029126  .GLV.............GCIQGVWFGSTP..-.-----..--.----sgspallppshrvnvepgcvvtna.......
ENSBTAP00000029938  .---.............------------..-.-----..--.----ghgwrqthitlrgadiksvifkgekrhghtg
ENSBTAP00000007926  .RFT.............GLMQDVR-----..-.-----..--.----...............................
ENSBTAP00000011612  .NFT.............GCISNAYF----..-.-----..--.----trldrdvevedfqrysekvhtslyecpi...
ENSBTAP00000018394  .AFD.............----EFIIWERA..L.TPDEI..--.----amyft..........................
ENSBTAP00000003981  .NFS.............GCISNVFVL---..-.-----..--.----rllgpqrvfdlqenlgsfnvssgcap.....
ENSBTAP00000016206  .PLR.............GCLHSATLNGR-..-.-----..--.----sl.............................
ENSBTAP00000010689  .YFH.............GYLAGFSVRSGR..LeSREVIe.CL.YAC-...............................
ENSBTAP00000018634  .---.............------------..-.-----..--.----rdavspryeqdsghdsgsedacvdssqpftl
ENSBTAP00000010687  .YFH.............GYLAGFSVRSGR..LeSREVIe.CL.YAC-...............................
ENSBTAP00000024762  .RFT.............GLVRQLVLLPGS..D.ATPRL..C-.----...............................
ENSBTAP00000053727  .AFR.............GCMKNLK-----..-.-----..--.----kttgvvrlndtvgvtkkc.............
ENSBTAP00000053802  .---.............------------..-.-----..--.----nvdkdkpylycfrtskgvgysahfvgncliv
ENSBTAP00000039948  .---.............------------..-.-----..--.----tdvlfvnvtnqgiliyklsscsfsrkmfphf
ENSBTAP00000053727  .HFE.............GCISNVFIQRSS..E.SPEV-..--.----ldlasksskrdvslgfcsln...........
ENSBTAP00000027783  .AFD.............----EFIIWERA..L.TPDEI..--.----amyft..........................
ENSBTAP00000047997  .---.............------------..-.-----..--.----spqrfqvifqgqmisaqdeviaiddlsfssg
ENSBTAP00000009228  .DVV.............GCM---------..-.-----..--.----idltentiiftlngevlmsdsgsetafrdie
ENSBTAP00000048250  .NFK.............GCMESIN-----..-.-----..--.----ynginitdlarrkklepsnvgnlsfsc....
ENSBTAP00000046960  .---.............------------..-.-----..--.----vtysglyqgaylypqqfdcepgvlgskgftw
ENSBTAP00000044872  .PFQ.............GQLSGLY-----..-.-----..--.----ynglkvlnmaaendaniaivgnvr.......
ENSBTAP00000031529  .---.............------------..-.-----..--.----avvqlgrltqpfhlllhkvslgiyvgvsaid
ENSBTAP00000053650  .---.............------------..-.-----..--.----qgnehygrswqagdvvgcmvdmtehtmmftl
ENSBTAP00000020240  .---.............------------..-.-----..--.----qgnehygrswqagdvvgcmvdmtehtmmftl
ENSBTAP00000025061  .---.............------------..-.-----..--.----knrlpanslpqegdvvgitydhvelnvylng
ENSBTAP00000055305  .---.............------------..-.-----..--.----rgqrwhqgsgyfgrtwqpgdvvgcminldda
ENSBTAP00000036054  .---.............------------..-.-----..--.----rgqrwhqgsgyfgrtwqpgdvvgcminldda
ENSBTAP00000054766  .AFA.............GCLQDVQVDGHL..L.LPEDL..--.----genvllgcwhqehcqppp.............
ENSBTAP00000040914  .AFA.............GCLQDVQVDGHL..L.LPEDL..--.----genvllgcwhqehcqppp.............
ENSBTAP00000032513  .---.............------------..-.-----..--.----lhgseagclqvflqtaspaapqtpvllrrrh
ENSBTAP00000025458  .---.............------------..-.-----..--.----hlactllqiqmgepcwhggisvdykmgisfy
ENSBTAP00000023092  .---.............------------..-.-----..--.----kiliegvlghgntssialfeikmttgyc...
ENSBTAP00000054766  .NFT.............GCLGRVALGGHP..-.-----..--.----lplarp.........................
ENSBTAP00000009351  .---.............------------..-.-----..--.----relrisgsvqlycvhy...............
ENSBTAP00000040914  .NFT.............GCLGRVALGGHP..-.-----..--.----lplarp.........................
ENSBTAP00000011612  .---.............------------..-.-----..--.----kpvstwpayfsivkiervgkhgkvfltvpsl
ENSBTAP00000054766  .PFR.............GCMQDVRLND--..-.-----..--.----lhlpffppl......................
ENSBTAP00000053495  .QFV.............GRMQDFRLYQVA..L.TNREI..--.----qevfsrdl.......................
ENSBTAP00000040914  .PFR.............GCMQDVRLND--..-.-----..--.----lhlpffppl......................
ENSBTAP00000003981  .---.............------------..-.-----..--.----keagplqqpppqltatskaiqvfllggnrkr
ENSBTAP00000053932  .---.............------------..-.-----..--.----gnndnerlaiarqripyrlgrvvdewlldkg
ENSBTAP00000053616  .NYR.............GSVERFSLWKVA..R.TQREI..--.----lldmg..........................
ENSBTAP00000048757  .---.............------------..-.-----..--.----efiyefsstftgrifpflwlnymr.......
ENSBTAP00000044383  .---.............------------..-.-----..--.----sfdvqtaqifftkngkrvgstimpmspdglf
ENSBTAP00000026111  .---.............------------..-.-----..--.----galvf..........................
ENSBTAP00000009703  .---.............------------..-.-----..--.----isvsld.........................
ENSBTAP00000022475  .LFQ.............GQLSGL------..-.-----..--.----yydglkvlnmaaennpniking.........
ENSBTAP00000003981  .---.............------------..-.-----..--.----edigeqfaavsidrilqfgrmsvtvenrmvq
ENSBTAP00000048250  .---.............------------..-.-----..--.----eskvgvhinvtqt..................
ENSBTAP00000005537  .---.............------------..-.-----..--.----sgpgldlplilglrlqlnltvsgvvlsqgak
ENSBTAP00000014043  .---.............------------..-.-----..--.----fafltigmgkillgagasanagltgrdgpaa
ENSBTAP00000048757  .---.............------------..-.-----..--.----tglwlkkcqhgqqfdlepgvlgskgfmwgkv
ENSBTAP00000044383  .---.............------------..-.-----..--.----haddgkifhgsgvgdpfgprcykgdimgcgi
ENSBTAP00000037559  .SLK.............GDIYNFRLWNFT..I.SSKIL..SN.LSCSvkgnvvdwqndfwnip...............
ENSBTAP00000053727  .---.............------------..-.-----..--.----lgegeaelqvdqtltesktqeavmdrvkfqr
ENSBTAP00000022474  .LFQ.............GQLSGL------..-.-----..--.----yydglkvlnmaaennpniking.........
ENSBTAP00000036460  .---.............------------..-.-----..--.----ih.............................
ENSBTAP00000003367  .---.............------------..-.-----..--.----wrqvlaqqsl.....................
ENSBTAP00000041534  .---.............------------..-.-----..--.----gqpgpnwqpvsvnytgqgqiqftlmgvfaki
ENSBTAP00000055305  .---.............------------..-.-----..--.----ldlgapsisfringqpvqgmfenfntdglff
ENSBTAP00000036054  .---.............------------..-.-----..--.----ldlgapsisfringqpvqgmfenfntdglff
ENSBTAP00000054517  .---.............------------..-.-----..--.----fivcgdrrvvddwandgwg............
ENSBTAP00000038137  .---.............------------..-.-----..--.----amnepfisccigsagqrt.............
ENSBTAP00000053650  .LFS.............YGFDGLHLWSGC..I.A----..--.----rtvsspnqhllrtddvisccldlsapsisfr
ENSBTAP00000020240  .LFS.............YGFDGLHLWSGC..I.A----..--.----rtvsspnqhllrtddvisccldlsapsisfr
ENSBTAP00000056645  .---.............------------..-.-----..--.----amnepfisccigsagqrt.............
ENSBTAP00000047997  .---.............------------..-.-----..--.----kqastlnhldsraylnssvchclgrschlqf
ENSBTAP00000053365  .---.............------------..-.-----..--.----vhstpggsgsanppvvstvyayigtppaqrq
ENSBTAP00000017949  .---.............------------..-.-----..--.----vhstpggsgsanppvvstvyayigtppaqrq
ENSBTAP00000042505  .---.............------------..-.-----..--.----vrredgtlhffvngmtqgpaawnvppgvyav
ENSBTAP00000009228  .---.............---------T--..-.-----..--.----ghvprlvtypgqhllapedvvsccldlsvps
ENSBTAP00000036054  .---.............------------..-.-----..--.----vwggdivatsqrasrsnvdleigclvdlamg
ENSBTAP00000032513  .---.............-------L----..-.-----..--.----papdrgmpspdahgaaghflavqrawgqlae
ENSBTAP00000055305  .---.............------------..-.-----..--.----vwggdivatsqrasrsnvdleigclvdlamg
ENSBTAP00000042505  .---.............------------..-.-----..--.----gvertaagelrlwvngrdcgvaatglparvw
ENSBTAP00000031529  .---.............------------..-.-----..--.----slrpprdhtlen...................
ENSBTAP00000002970  .GF-.............------------..-.-----..--.----fgplkyyrlhalhpaq...............
ENSBTAP00000009228  .---.............------------..-.-----..--.----tdlvigclvdlatglmtftangkesntffqv
ENSBTAP00000056398  .SFQ.............GCMQLIQVDDQ-..-.-----..--.----lvnlsevaqrrpgsfanvsidmcai......
ENSBTAP00000031529  .---.............------------..-.-----..--.----tmsfwyfistkatgsiqilik..........
ENSBTAP00000000063  .---.............------------..-.-----..--.----gdqh...........................
ENSBTAP00000002071  .---.............-Y----------..-.-----..--.----fdnfiicsekevadrwaadgwg.........


                                                                                                    
                                                                                                    
d2erfa1               ..............................................................................
ENSBTAP00000002600  hlrnalwhtgntsgqvrtlwhdprhigwkdftayrwhlshrpktgfirvvmyegkkimadsgpiydktyaggrlglfv
ENSBTAP00000036460  pgehlrnslwhtgdtsdqvrllwkdsrnvgwkdkvsyrwflqhrpqvgyirvrfyegselvadsgvtidttmrggrlg
ENSBTAP00000006074  pgeqlrnalwhtgdtasqvrllwkdprnvgwkdktsyrwflqhrpqvgyirvrfyegpelvadsnvildttmrggrlg
ENSBTAP00000000063  pgehlrnalwhtgntpdqvrllwtdprnvgwrdktsyrwqllhrpqvgyirvklyegpqlvadsgviidtsmrggrlg
ENSBTAP00000042078  rnalwhtgntegqvrtlwhdpknigwkdytayrwhlthrpktgyirvlvhegkqvmadsgpiydqtyaggrlglfvfs
ENSBTAP00000054517  ytlilnpdnsfeilvdqsvvnsgnllhdmtp...............................................
ENSBTAP00000046571  evpgvrlprgyyfgtssitgdlsdnhdvislklfel..........................................
ENSBTAP00000002071  ..............................................................................
ENSBTAP00000005195  ievpgvrlprgyyfgtssitgdlsdnhdvislklfel.........................................
ENSBTAP00000010569  ysrgrltvmtdledknewknciditgvrlptgyyfgasagtgdlsdnhdiismklfql....................
ENSBTAP00000001158  gpvrpyfslsysggksaapliicpm.....................................................
ENSBTAP00000008979  anqalsscqrdfrnkpypvrakityyqktltvminngftpdkndyefcakvenmiipaqghfgisaatggladdhdvl
ENSBTAP00000018459  l.............................................................................
ENSBTAP00000054004  l.............................................................................
ENSBTAP00000011393  ealrpifspclpnegtntgplvics.....................................................
ENSBTAP00000034027  lmdlcrrsvr....................................................................
ENSBTAP00000015061  ..............................................................................
ENSBTAP00000009824  tfnhlfsgflrpyfficdttplilppmte.................................................
ENSBTAP00000012013  lmdlcrrcir....................................................................
ENSBTAP00000009893  thiytfssvfmeklypyfcpclndggenkeplhilh..........................................
ENSBTAP00000013175  fgpdicgfdiktvhiilhfknqyhankksirckvdsfthlytlvlrpdltyevkidgqsiesgsieydwqltslkkme
ENSBTAP00000042458  cpv...........................................................................
ENSBTAP00000020111  dptdskpedwdkpehipdpdakkpedwdeemdgeweppviqnpeykgewkprqidnpeykgiwihpeidnpeyspdsn
ENSBTAP00000024852  pmticr........................................................................
ENSBTAP00000036910  ..............................................................................
ENSBTAP00000028561  ggslllgscrqdfrnrpypfraritywgqrlrvslnsgltpsgpdevcvdvgplllapggffgvsaatsiladdhdvl
ENSBTAP00000024658  ..............................................................................
ENSBTAP00000055797  fygvlkplfrlwssesg.............................................................
ENSBTAP00000055913  ftdtfpgmlcayfrprahdgsehpdplticpl..............................................
ENSBTAP00000027907  aldlevgavsfyaaedmrhiytfrvnfqervfplfsvcstgtylr.................................
ENSBTAP00000033248  fgpdicgfgnnkvqvilhyqgkyhennktikcrinkdthpytliihpsatyevkidnkqveageleddwtflppkikn
ENSBTAP00000045818  pavsavwgqcqvrinylg............................................................
ENSBTAP00000047271  pqcnnapkyqigerirvildmedktlafergyeflgvafrglpkvclypavsavygntevtlvylgkp..........
ENSBTAP00000011391  ssliynfsylafqgalrpifslsissggvnsdslsic.........................................
ENSBTAP00000027551  tfrekfpgklcsyfspgqshangknvqplrin..............................................
ENSBTAP00000022024  cigvaatqlqnkrfypmvcstaakssmkvirscasvtslqylccfrl...............................
ENSBTAP00000007623  sfqadfqgklypildtcwhergsnslpmvlpp..............................................
ENSBTAP00000015712  ..............................................................................
ENSBTAP00000009025  ..............................................................................
ENSBTAP00000009005  ..............................................................................
ENSBTAP00000012653  eegvwavvlshqqcwastspgtdlplsdiprhvgvaldyeagrvalldadtqapiftftasfsgkvfpffavwkkg..
ENSBTAP00000013346  deqqgpiafenveglffpavslnrnvqvtlhtglqvpd........................................
ENSBTAP00000013398  wvvrhnskeipiepaphlrrvgilldydngsiafydalnsihlytfditfsqpvcptftvwnkcltiitglpipd...
ENSBTAP00000013121  hgfvlffaaadkvhllykykvdfteavypafwlfstgatlsics..................................
ENSBTAP00000026179  lqrevwcvgtngkryqaqssteqtllspsekprrfgvyldyeagrlgfynaetlahvhtfsaaflgervfpffrvlsk
ENSBTAP00000055851  ..............................................................................
ENSBTAP00000024853  fynandgshlhsysqpafpgplqpffclgapk..............................................
ENSBTAP00000021701  ..............................................................................
ENSBTAP00000044710  ddvtlkkgec....................................................................
ENSBTAP00000041298  fkvavndahllqynhrvknfgeistlgisgditltsas........................................
ENSBTAP00000001294  ssgygqgdvlgfyinlpedtetakslpdtykdkalikfksylyfeekdfvdkaekslkqtphseiifykngvnqgvay
ENSBTAP00000021701  tehfkvvvngtpfyefkhrillqmvthlhvdgdlmlqsinfiggq.................................
ENSBTAP00000007366  ..............................................................................
ENSBTAP00000009909  nsfptrltleeqpqqvrvsidyevgwvtfanavtqepiytftasftqkvfpffglwgrg...................
ENSBTAP00000029287  pvcptftiwnkslmilsglpa.........................................................
ENSBTAP00000009005  ..............................................................................
ENSBTAP00000009025  ..............................................................................
ENSBTAP00000054057  ..............................................................................
ENSBTAP00000006913  ilgvygekhveyntklplkadgnhqnvysrcqpkngywviglsygsvynafdessssdpmiltlslsvpphrigifld
ENSBTAP00000043820  qgvnmnrlpgwdkhsygyhgddghsfcssgtgqpygptfttgdvigccvnlingtcfytknghslgiaftdlpanlyp
ENSBTAP00000056333  pfqkgslfeicfevessafkvmvnkniflyyvhrvpfyqlnaisvkggvhlsyisf......................
ENSBTAP00000018469  ql............................................................................
ENSBTAP00000018010  nekwgweeitydmpfkkeksfeivimvlkekfqvavngrhtllyahrisperidtlgiygkviihsvgf.........
ENSBTAP00000046313  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000020080  ..............................................................................
ENSBTAP00000052704  ..............................................................................
ENSBTAP00000031529  ftgdiaiddlsfmdct..............................................................
ENSBTAP00000023092  esllwrrrgeqsiswlralieyscerqhqiiieairgmsvrsdiaiddikfqagsc......................
ENSBTAP00000029126  ..............................................................................
ENSBTAP00000023900  kplgqvgmfldydggilsfydvanrslicsflycsfssplkpflcs................................
ENSBTAP00000034496  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000005971  icqfsscsfpqnivpyfnpmncgvpmtlcsp...............................................
ENSBTAP00000028802  ..............................................................................
ENSBTAP00000011769  ..............................................................................
ENSBTAP00000054738  ..............................................................................
ENSBTAP00000004870  ..............................................................................
ENSBTAP00000018010  avngvhsleykhrfkelskvdtleidgdihllevr...........................................
ENSBTAP00000021676  gvfldyecgmisfinvargslicnflsrsfsfplrpfiwcg.....................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000022890  vketvlgsdrpsvvgiwldleegklafyskadqakplfecpisvsvplhpafwlygldpgnsl...............
ENSBTAP00000053970  pgqifpffrllvpg................................................................
ENSBTAP00000035935  nkgqrwneahvniypitsfqlifegirgpgiegdiaiddvsiaegec...............................
ENSBTAP00000056432  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000009351  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000053511  lfyepasgtvlhihhasfpgplfpvfavadqtis............................................
ENSBTAP00000042181  ..............................................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000019994  naklsffnvdisqhlytfscqlhqfvhpcfslekpgclkiyngismp...............................
ENSBTAP00000037239  aqplllv.......................................................................
ENSBTAP00000032103  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000014522  ..............................................................................
ENSBTAP00000002600  ..............................................................................
ENSBTAP00000054736  ..............................................................................
ENSBTAP00000054420  ..............................................................................
ENSBTAP00000053498  raelavstfwpneyqvifeaevsggrsgyiaiddiqvlsypc....................................
ENSBTAP00000027527  ..............................................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000032310  prkmenalirpinprldgcirgwn......................................................
ENSBTAP00000042078  ..............................................................................
ENSBTAP00000056054  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000051925  rgslihsflpssissplkpflclrsp....................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000028276  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000026133  mv............................................................................
ENSBTAP00000042592  teggitkgatigvlldfnrktltffindeqqgpiafenveglffpavslnrnvqvtlhtglqvp..............
ENSBTAP00000023889  ckdilitntsiniyseeacilfskkvnnhyslftntppyiqyvkrplgrigvfldydngtvsfydvcrgsliyrflps
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000026471  ryqkpeeydqlvwmaighqgdhwkegrvllhkslklyqvifegeigkgnlggiavddisinnh...............
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000013075  eeftmhdtigcyldidkghvkfskngkdlglafeipphmknqalfpacvlknaelkfnfgeeefkfp...........
ENSBTAP00000000793  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000001939  inp...........................................................................
ENSBTAP00000029353  qawhdgkaqrlpvvsgrllgvdlnlasgcltfyslepktqplhtfhaiftrplypifwllegrtltlc..........
ENSBTAP00000049986  idseeafllfsvnvndhyslftntrpsvqyvkrplgrigvfldydngavsfydvfrssliysflpssissplkpfl..
ENSBTAP00000028721  vglqtpgevvdanfgqhpfvfdiedymrewr...............................................
ENSBTAP00000035185  ldgclkswhw....................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000013134  rveleceegelsfydaerrchlytfharfgevrpyfylggsrgdgspeplricpl.......................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000037790  sllyrflasfleplypavmvssgasvtl..................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000054149  ymygenvyklsinissdqnmektifqkegnygqnwnygqvtlnetvefkvsfygfknqilsdialddisltygic...
ENSBTAP00000000788  ymygenvyklsinissdqnmektifqkegnygqnwnygqvtlnetvefkvsfygfknqilsdialddisltygic...
ENSBTAP00000020299  ..............................................................................
ENSBTAP00000013292  ..............................................................................
ENSBTAP00000000458  ..............................................................................
ENSBTAP00000012225  lvdvsriavvhilqtdfrgpvvpafalwdgellthsgle.......................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000017076  sypc..........................................................................
ENSBTAP00000000179  ..............................................................................
ENSBTAP00000042771  awaagdivsclidldegtlsfslngvslgtafenlsrglgmayfpaislsfkesvafnfgsrplrypvagyrplqd..
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031529  kelalsgdedfqlkfegrvgkghrgdialddivltknc........................................
ENSBTAP00000005332  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000053720  ..............................................................................
ENSBTAP00000035185  tshscppv......................................................................
ENSBTAP00000017120  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000032513  hlltqprvpsapqeclsfwfhlfgpqigtlrlamrregeaethlwsrsgthgncwheawatlhhqpdsgakyqllfeg
ENSBTAP00000017857  kqllysfkakftqpvlpgfmvwcgglslstgmqv............................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000027839  pfemevssdaehfhvhaqehkvlqfahrhrplaaitrvqvlsdhrlaqvelar.........................
ENSBTAP00000053422  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000017783  ..............................................................................
ENSBTAP00000005537  rlplvpaldaclrq................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000011863  ..............................................................................
ENSBTAP00000053409  pcvmfyssnpgekvkicdmqmrgtprdllpgdpicspv........................................
ENSBTAP00000018697  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000026725  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000013440  ..............................................................................
ENSBTAP00000006786  t.............................................................................
ENSBTAP00000032513  gqvdvasarefqivfeatlggqpalgpialddveylag........................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000054985  ..............................................................................
ENSBTAP00000004114  wmgiafriqkealggqalyphvlvkncavefnfgqraep.......................................
ENSBTAP00000045584  trc...........................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000053569  ..............................................................................
ENSBTAP00000012117  ..............................................................................
ENSBTAP00000053727  aaevqgtvslngcpd...............................................................
ENSBTAP00000008967  fnegvhpafalekpgkctlhlgiep.....................................................
ENSBTAP00000005686  ldditltetpc...................................................................
ENSBTAP00000031460  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000007877  ngrtkqllhtfkakftqpllpaftvwcgsfhvttglqvp.......................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000001200  ..............................................................................
ENSBTAP00000034542  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000023092  evifevafngpkggyvalddisfspvhc..................................................
ENSBTAP00000024358  ..............................................................................
ENSBTAP00000000307  qltifnsqaaikiggrdqgrpfqgqvsglyyn..............................................
ENSBTAP00000006361  tvgflldlnekqmifflngnqlppekqvfsstvsgffaaasfmsyqqcefnfgakpfkyp..................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000054420  ..............................................................................
ENSBTAP00000032310  vnrnnlelstqlrkdsfhsedfqrqfaildeamkgtvvtylgglpdvpfsatpvnafyqgcmevningvqvdldeais
ENSBTAP00000023376  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000016055  ..............................................................................
ENSBTAP00000003261  sygfdgrglkaengqfeefgqtfgendvigcfanfeaeevelsfskngedlgvafriskesladrallphvlckncvv
ENSBTAP00000053720  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000004156  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000054276  ..............................................................................
ENSBTAP00000023092  wsvlesprgiwmqaeitfrkpmptkvvfmslckslwdcglvaldditielgsc.........................
ENSBTAP00000037835  ..............................................................................
ENSBTAP00000032513  valddlllqdgpc.................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000015885  hgriilpsydmeyqivfegvigkgrageiaiddiristd.......................................
ENSBTAP00000041534  grgkgtklrlllgspagsppsslwervgsqgpdwlndsmtipsghqqpmqlmfevergshaafvvalgfifigqgtc.
ENSBTAP00000023842  feaergkgktgeiavdgvfqvsglc.....................................................
ENSBTAP00000013316  p.............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000016206  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000053566  ..............................................................................
ENSBTAP00000048368  ekfdendvitcfanfesdevelsyakngqdlgiafkiskevlagrplfphvlchncavefnfgqkekpy.........
ENSBTAP00000025190  vrdgkmsllrrlr.................................................................
ENSBTAP00000004156  ..............................................................................
ENSBTAP00000010056  yweveaahc.....................................................................
ENSBTAP00000001189  ..............................................................................
ENSBTAP00000046960  lkwpg.........................................................................
ENSBTAP00000055054  ..............................................................................
ENSBTAP00000006018  ..............................................................................
ENSBTAP00000055176  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000043064  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000011480  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000029126  ..............................................................................
ENSBTAP00000029938  eiglddvslkkghc................................................................
ENSBTAP00000007926  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000018394  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000016206  ..............................................................................
ENSBTAP00000010689  ..............................................................................
ENSBTAP00000018634  vtigmkkvfipksptssnepenrvlpmptsigvfldydkgkvafydmdhmkclyerqvdcshtmypafalmgsg....
ENSBTAP00000010687  ..............................................................................
ENSBTAP00000024762  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000053802  tslkskgkgfqhcvkydfqprkffqisiihyfgrcrrsqifqylygrligymdlcwqsnnnrsydkcflnyndtydtd
ENSBTAP00000039948  npgkcnapvtv...................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000027783  ..............................................................................
ENSBTAP00000047997  c.............................................................................
ENSBTAP00000009228  igdgflpvcslgpgqvghlnlgqd......................................................
ENSBTAP00000048250  ..............................................................................
ENSBTAP00000046960  gkvywevevereg.................................................................
ENSBTAP00000044872  ..............................................................................
ENSBTAP00000031529  dirfenc.......................................................................
ENSBTAP00000053650  ngeillddsgselafkdfdvgdgfipvcsl................................................
ENSBTAP00000020240  ngeillddsgselafkdfdvgdgfipvcsl................................................
ENSBTAP00000025061  knmhcpasgirgtvypvvyvddsaildcqfsefyhtpppgfe....................................
ENSBTAP00000055305  smiftlngellit.................................................................
ENSBTAP00000036054  smiftlngellit.................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000032513  gelgaawvrdrvdiqsehpfrillagqtgpggvvglddlilsnhc.................................
ENSBTAP00000025458  nvtakshitatgyfppgplqpilsprthdgeknmdplticpv....................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000009351  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000011612  sstaeekfikkgefagddslldldpedtvfyvggvpsnfklpaslnlpgfvgclelatlnndvislynfkhiynmdps
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000003981  vlvrverttvfsveqenvleladayylggvppsqlpaslrqlfpsggsvrgcikgikalgkyvdlkrlnttgvsagct
ENSBTAP00000053932  rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvr.......................
ENSBTAP00000053616  ..............................................................................
ENSBTAP00000048757  ..............................................................................
ENSBTAP00000044383  pavgmhslgeevrlhln.............................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000009703  ..............................................................................
ENSBTAP00000022475  ..............................................................................
ENSBTAP00000003981  etkgdtvapgaegllnvqpddfvfyvggypsnftppeplrfpgyrgcieldtlneevvslynf...............
ENSBTAP00000048250  ..............................................................................
ENSBTAP00000005537  keilalpptgpgslldlwvqphgrlflgalpgeatsasfcldglwaqgrsldmdraqsrslniwthscpqnp......
ENSBTAP00000014043  sctvplpprlgicldyergrvsfldavsfrgllecpldcsgpvcpafcfigggavq......................
ENSBTAP00000048757  ywevkvdriw....................................................................
ENSBTAP00000044383  mfpr..........................................................................
ENSBTAP00000037559  ..............................................................................
ENSBTAP00000053727  iyqfarlnytlkatsskpethqfhdmdsgnsntllnldpenavfyvggyptdfrppsrlkfppykgcielddlnenvl
ENSBTAP00000022474  ..............................................................................
ENSBTAP00000036460  ..............................................................................
ENSBTAP00000003367  ..............................................................................
ENSBTAP00000041534  pepavavdaisiapc...............................................................
ENSBTAP00000055305  pvvsfsagvkvrfllggrhgefkflppsgy................................................
ENSBTAP00000036054  pvvsfsagvkvrfllggrhgefkflppsgy................................................
ENSBTAP00000054517  ..............................................................................
ENSBTAP00000038137  ..............................................................................
ENSBTAP00000053650  ingqpvqgmfenfnidglffpvvsfsagikvrfllggrhgefkflpppgya...........................
ENSBTAP00000020240  ingqpvqgmfenfnidglffpvvsfsagikvrfllggrhgefkflpppgya...........................
ENSBTAP00000056645  ..............................................................................
ENSBTAP00000047997  yyamensvlrvgls................................................................
ENSBTAP00000053365  iaslvwrlgpthfleevlppsnvttiyelg................................................
ENSBTAP00000017949  iaslvwrlgpthfleevlppsnvttiyelg................................................
ENSBTAP00000042505  vdlygqaaqati..................................................................
ENSBTAP00000009228  isfringcpvqgvfeafnldglffpvvsfsagvkvrfllgg.....................................
ENSBTAP00000036054  mlsfsangrelgtcyqvepntkvfpavflqptsts...........................................
ENSBTAP00000032513  earaltptlgpsgprcelrlvyylqsh...................................................
ENSBTAP00000055305  mlsfsangrelgtcyqvepntkvfpavflqptsts...........................................
ENSBTAP00000042505  avvdlygkctqitvlppepgf.........................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000002970  ..............................................................................
ENSBTAP00000009228  epntklfpavfvlpt...............................................................
ENSBTAP00000056398  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000000063  ..............................................................................
ENSBTAP00000002071  ..............................................................................


                                                                                                    
                                                                                                    
d2erfa1               ..............................................................................
ENSBTAP00000002600  fsqemvffsdlkyecrd.............................................................
ENSBTAP00000036460  vfcfsqeniiwsnlkyrcndt.........................................................
ENSBTAP00000006074  vfcfsqeniiwanlryrcndt.........................................................
ENSBTAP00000000063  vfcfsqeniiwsnlqyrcndt.........................................................
ENSBTAP00000042078  qemvyfsdlkyecr................................................................
ENSBTAP00000054517  ..............................................................................
ENSBTAP00000046571  ..............................................................................
ENSBTAP00000002071  ..............................................................................
ENSBTAP00000005195  ..............................................................................
ENSBTAP00000010569  ..............................................................................
ENSBTAP00000001158  ..............................................................................
ENSBTAP00000008979  sfltfqlte.....................................................................
ENSBTAP00000018459  ..............................................................................
ENSBTAP00000054004  ..............................................................................
ENSBTAP00000011393  ..............................................................................
ENSBTAP00000034027  ..............................................................................
ENSBTAP00000015061  ..............................................................................
ENSBTAP00000009824  ..............................................................................
ENSBTAP00000012013  ..............................................................................
ENSBTAP00000009893  ..............................................................................
ENSBTAP00000013175  kasaeaegwdqaakdksqdwekhfldasaskpsdwkgeldgdwqaamlqkppyqdglkpegidkdvwlhqkmknsylt
ENSBTAP00000042458  ..............................................................................
ENSBTAP00000020111  iyayenfavlgldlwqvksgtifdnflitndeayaeefgnetwg..................................
ENSBTAP00000024852  ..............................................................................
ENSBTAP00000036910  ..............................................................................
ENSBTAP00000028561  sfltfslwe.....................................................................
ENSBTAP00000024658  ..............................................................................
ENSBTAP00000055797  ..............................................................................
ENSBTAP00000055913  ..............................................................................
ENSBTAP00000027907  ..............................................................................
ENSBTAP00000033248  pyaqkprkwdeqlqiedgedkkpedwedfeyipdpeaekpddwneamdgewegplipnvkykgkwkpriidnskyqge
ENSBTAP00000045818  ..............................................................................
ENSBTAP00000047271  ..............................................................................
ENSBTAP00000011391  ..............................................................................
ENSBTAP00000027551  ..............................................................................
ENSBTAP00000022024  ..............................................................................
ENSBTAP00000007623  ..............................................................................
ENSBTAP00000015712  ..............................................................................
ENSBTAP00000009025  ..............................................................................
ENSBTAP00000009005  ..............................................................................
ENSBTAP00000012653  ..............................................................................
ENSBTAP00000013346  ..............................................................................
ENSBTAP00000013398  ..............................................................................
ENSBTAP00000013121  ..............................................................................
ENSBTAP00000026179  gtrik.........................................................................
ENSBTAP00000055851  ..............................................................................
ENSBTAP00000024853  ..............................................................................
ENSBTAP00000021701  ..............................................................................
ENSBTAP00000044710  ..............................................................................
ENSBTAP00000041298  ..............................................................................
ENSBTAP00000001294  kdifegvyfpaislyksctvsinfgpcfky................................................
ENSBTAP00000021701  ..............................................................................
ENSBTAP00000007366  ..............................................................................
ENSBTAP00000009909  ..............................................................................
ENSBTAP00000029287  ..............................................................................
ENSBTAP00000009005  ..............................................................................
ENSBTAP00000009025  ..............................................................................
ENSBTAP00000054057  ..............................................................................
ENSBTAP00000006913  ysartllflnvtnhgfliykfsscsfsqkifpyfnpmtcnvpmnlcs...............................
ENSBTAP00000043820  tvglqtpgeivdanfgqqpflfdiedymrewra.............................................
ENSBTAP00000056333  ..............................................................................
ENSBTAP00000018469  ..............................................................................
ENSBTAP00000018010  ..............................................................................
ENSBTAP00000046313  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000020080  ..............................................................................
ENSBTAP00000052704  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000029126  ..............................................................................
ENSBTAP00000023900  ..............................................................................
ENSBTAP00000034496  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000005971  ..............................................................................
ENSBTAP00000028802  ..............................................................................
ENSBTAP00000011769  ..............................................................................
ENSBTAP00000054738  ..............................................................................
ENSBTAP00000004870  ..............................................................................
ENSBTAP00000018010  ..............................................................................
ENSBTAP00000021676  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000022890  ..............................................................................
ENSBTAP00000053970  ..............................................................................
ENSBTAP00000035935  ..............................................................................
ENSBTAP00000056432  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000009351  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000053511  ..............................................................................
ENSBTAP00000042181  ..............................................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000019994  ..............................................................................
ENSBTAP00000037239  ..............................................................................
ENSBTAP00000032103  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000014522  ..............................................................................
ENSBTAP00000002600  ..............................................................................
ENSBTAP00000054736  ..............................................................................
ENSBTAP00000054420  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000027527  ..............................................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000042078  ..............................................................................
ENSBTAP00000056054  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000051925  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000028276  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000026133  ..............................................................................
ENSBTAP00000042592  ..............................................................................
ENSBTAP00000023889  pfsfplkpflclr.................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000026471  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000013075  ..............................................................................
ENSBTAP00000000793  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000029353  ..............................................................................
ENSBTAP00000049986  ..............................................................................
ENSBTAP00000028721  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000053469  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000013134  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000037790  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000054149  ..............................................................................
ENSBTAP00000000788  ..............................................................................
ENSBTAP00000020299  ..............................................................................
ENSBTAP00000013292  ..............................................................................
ENSBTAP00000000458  ..............................................................................
ENSBTAP00000012225  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000000179  ..............................................................................
ENSBTAP00000042771  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000005332  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000053720  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000017120  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000032513  lrdgyhgsmalddvtlrpgpc.........................................................
ENSBTAP00000017857  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000027839  ..............................................................................
ENSBTAP00000053422  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000017783  ..............................................................................
ENSBTAP00000005537  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000011863  ..............................................................................
ENSBTAP00000053409  ..............................................................................
ENSBTAP00000018697  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000033006  ..............................................................................
ENSBTAP00000026956  ..............................................................................
ENSBTAP00000026725  ..............................................................................
ENSBTAP00000022744  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000013440  ..............................................................................
ENSBTAP00000006786  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000054985  ..............................................................................
ENSBTAP00000004114  ..............................................................................
ENSBTAP00000045584  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000053569  ..............................................................................
ENSBTAP00000012117  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000008967  ..............................................................................
ENSBTAP00000005686  ..............................................................................
ENSBTAP00000031460  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000007877  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000036729  ..............................................................................
ENSBTAP00000001200  ..............................................................................
ENSBTAP00000034542  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000024169  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000024358  ..............................................................................
ENSBTAP00000000307  ..............................................................................
ENSBTAP00000006361  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000054420  ..............................................................................
ENSBTAP00000032310  khndirahscpsv.................................................................
ENSBTAP00000023376  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000016055  ..............................................................................
ENSBTAP00000003261  elnfgqkeepf...................................................................
ENSBTAP00000053720  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000004156  ..............................................................................
ENSBTAP00000025424  ..............................................................................
ENSBTAP00000054276  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000037835  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000008454  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000015885  ..............................................................................
ENSBTAP00000041534  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000016206  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000053566  ..............................................................................
ENSBTAP00000048368  ..............................................................................
ENSBTAP00000025190  ..............................................................................
ENSBTAP00000004156  ..............................................................................
ENSBTAP00000010056  ..............................................................................
ENSBTAP00000001189  ..............................................................................
ENSBTAP00000046960  ..............................................................................
ENSBTAP00000055054  ..............................................................................
ENSBTAP00000006018  ..............................................................................
ENSBTAP00000055176  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000042646  ..............................................................................
ENSBTAP00000043064  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000011480  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000029126  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000007926  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000018394  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000016206  ..............................................................................
ENSBTAP00000010689  ..............................................................................
ENSBTAP00000018634  ..............................................................................
ENSBTAP00000010687  ..............................................................................
ENSBTAP00000024762  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000053802  rvicgrigavyifsrkl.............................................................
ENSBTAP00000039948  ..............................................................................
ENSBTAP00000053727  ..............................................................................
ENSBTAP00000027783  ..............................................................................
ENSBTAP00000047997  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000048250  ..............................................................................
ENSBTAP00000046960  ..............................................................................
ENSBTAP00000044872  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000025061  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000025458  ..............................................................................
ENSBTAP00000023092  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000009351  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000011612  ..............................................................................
ENSBTAP00000054766  ..............................................................................
ENSBTAP00000053495  ..............................................................................
ENSBTAP00000040914  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000053932  ..............................................................................
ENSBTAP00000053616  ..............................................................................
ENSBTAP00000048757  ..............................................................................
ENSBTAP00000044383  ..............................................................................
ENSBTAP00000026111  ..............................................................................
ENSBTAP00000009703  ..............................................................................
ENSBTAP00000022475  ..............................................................................
ENSBTAP00000003981  ..............................................................................
ENSBTAP00000048250  ..............................................................................
ENSBTAP00000005537  ..............................................................................
ENSBTAP00000014043  ..............................................................................
ENSBTAP00000048757  ..............................................................................
ENSBTAP00000044383  ..............................................................................
ENSBTAP00000037559  ..............................................................................
ENSBTAP00000053727  slynfk........................................................................
ENSBTAP00000022474  ..............................................................................
ENSBTAP00000036460  ..............................................................................
ENSBTAP00000003367  ..............................................................................
ENSBTAP00000041534  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000054517  ..............................................................................
ENSBTAP00000038137  ..............................................................................
ENSBTAP00000053650  ..............................................................................
ENSBTAP00000020240  ..............................................................................
ENSBTAP00000056645  ..............................................................................
ENSBTAP00000047997  ..............................................................................
ENSBTAP00000053365  ..............................................................................
ENSBTAP00000017949  ..............................................................................
ENSBTAP00000042505  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000036054  ..............................................................................
ENSBTAP00000032513  ..............................................................................
ENSBTAP00000055305  ..............................................................................
ENSBTAP00000042505  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000002970  ..............................................................................
ENSBTAP00000009228  ..............................................................................
ENSBTAP00000056398  ..............................................................................
ENSBTAP00000031529  ..............................................................................
ENSBTAP00000000063  ..............................................................................
ENSBTAP00000002071  ..............................................................................


                                                                                  
                                                                                  
d2erfa1               ............................................................
ENSBTAP00000002600  ............................................................
ENSBTAP00000036460  ............................................................
ENSBTAP00000006074  ............................................................
ENSBTAP00000000063  ............................................................
ENSBTAP00000042078  ............................................................
ENSBTAP00000054517  ............................................................
ENSBTAP00000046571  ............................................................
ENSBTAP00000002071  ............................................................
ENSBTAP00000005195  ............................................................
ENSBTAP00000010569  ............................................................
ENSBTAP00000001158  ............................................................
ENSBTAP00000008979  ............................................................
ENSBTAP00000018459  ............................................................
ENSBTAP00000054004  ............................................................
ENSBTAP00000011393  ............................................................
ENSBTAP00000034027  ............................................................
ENSBTAP00000015061  ............................................................
ENSBTAP00000009824  ............................................................
ENSBTAP00000012013  ............................................................
ENSBTAP00000009893  ............................................................
ENSBTAP00000013175  eydlsefenigavglelwqvrsgtifdnflitddeeyaenfgkatwg.............
ENSBTAP00000042458  ............................................................
ENSBTAP00000020111  ............................................................
ENSBTAP00000024852  ............................................................
ENSBTAP00000036910  ............................................................
ENSBTAP00000028561  ............................................................
ENSBTAP00000024658  ............................................................
ENSBTAP00000055797  ............................................................
ENSBTAP00000055913  ............................................................
ENSBTAP00000027907  ............................................................
ENSBTAP00000033248  wihpeidnpeykpdpsichyynisvlgldlwqvksgsifdnflptndeefaeevgnmtwg
ENSBTAP00000045818  ............................................................
ENSBTAP00000047271  ............................................................
ENSBTAP00000011391  ............................................................
ENSBTAP00000027551  ............................................................
ENSBTAP00000022024  ............................................................
ENSBTAP00000007623  ............................................................
ENSBTAP00000015712  ............................................................
ENSBTAP00000009025  ............................................................
ENSBTAP00000009005  ............................................................
ENSBTAP00000012653  ............................................................
ENSBTAP00000013346  ............................................................
ENSBTAP00000013398  ............................................................
ENSBTAP00000013121  ............................................................
ENSBTAP00000026179  ............................................................
ENSBTAP00000055851  ............................................................
ENSBTAP00000024853  ............................................................
ENSBTAP00000021701  ............................................................
ENSBTAP00000044710  ............................................................
ENSBTAP00000041298  ............................................................
ENSBTAP00000001294  ............................................................
ENSBTAP00000021701  ............................................................
ENSBTAP00000007366  ............................................................
ENSBTAP00000009909  ............................................................
ENSBTAP00000029287  ............................................................
ENSBTAP00000009005  ............................................................
ENSBTAP00000009025  ............................................................
ENSBTAP00000054057  ............................................................
ENSBTAP00000006913  ............................................................
ENSBTAP00000043820  ............................................................
ENSBTAP00000056333  ............................................................
ENSBTAP00000018469  ............................................................
ENSBTAP00000018010  ............................................................
ENSBTAP00000046313  ............................................................
ENSBTAP00000053488  ............................................................
ENSBTAP00000017563  ............................................................
ENSBTAP00000020080  ............................................................
ENSBTAP00000052704  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000023092  ............................................................
ENSBTAP00000029126  ............................................................
ENSBTAP00000023900  ............................................................
ENSBTAP00000034496  ............................................................
ENSBTAP00000053345  ............................................................
ENSBTAP00000005971  ............................................................
ENSBTAP00000028802  ............................................................
ENSBTAP00000011769  ............................................................
ENSBTAP00000054738  ............................................................
ENSBTAP00000004870  ............................................................
ENSBTAP00000018010  ............................................................
ENSBTAP00000021676  ............................................................
ENSBTAP00000042993  ............................................................
ENSBTAP00000022890  ............................................................
ENSBTAP00000053970  ............................................................
ENSBTAP00000035935  ............................................................
ENSBTAP00000056432  ............................................................
ENSBTAP00000053607  ............................................................
ENSBTAP00000026956  ............................................................
ENSBTAP00000009351  ............................................................
ENSBTAP00000022744  ............................................................
ENSBTAP00000053511  ............................................................
ENSBTAP00000042181  ............................................................
ENSBTAP00000026111  ............................................................
ENSBTAP00000019994  ............................................................
ENSBTAP00000037239  ............................................................
ENSBTAP00000032103  ............................................................
ENSBTAP00000010571  ............................................................
ENSBTAP00000014522  ............................................................
ENSBTAP00000002600  ............................................................
ENSBTAP00000054736  ............................................................
ENSBTAP00000054420  ............................................................
ENSBTAP00000053498  ............................................................
ENSBTAP00000027527  ............................................................
ENSBTAP00000026111  ............................................................
ENSBTAP00000025424  ............................................................
ENSBTAP00000032310  ............................................................
ENSBTAP00000042078  ............................................................
ENSBTAP00000056054  ............................................................
ENSBTAP00000025033  ............................................................
ENSBTAP00000051925  ............................................................
ENSBTAP00000017563  ............................................................
ENSBTAP00000000307  ............................................................
ENSBTAP00000028276  ............................................................
ENSBTAP00000022744  ............................................................
ENSBTAP00000026133  ............................................................
ENSBTAP00000042592  ............................................................
ENSBTAP00000023889  ............................................................
ENSBTAP00000053469  ............................................................
ENSBTAP00000033006  ............................................................
ENSBTAP00000053469  ............................................................
ENSBTAP00000026956  ............................................................
ENSBTAP00000033006  ............................................................
ENSBTAP00000026471  ............................................................
ENSBTAP00000042646  ............................................................
ENSBTAP00000013075  ............................................................
ENSBTAP00000000793  ............................................................
ENSBTAP00000036729  ............................................................
ENSBTAP00000001939  ............................................................
ENSBTAP00000029353  ............................................................
ENSBTAP00000049986  ............................................................
ENSBTAP00000028721  ............................................................
ENSBTAP00000035185  ............................................................
ENSBTAP00000053469  ............................................................
ENSBTAP00000026956  ............................................................
ENSBTAP00000033006  ............................................................
ENSBTAP00000053469  ............................................................
ENSBTAP00000024169  ............................................................
ENSBTAP00000013134  ............................................................
ENSBTAP00000036729  ............................................................
ENSBTAP00000037790  ............................................................
ENSBTAP00000053179  ............................................................
ENSBTAP00000054149  ............................................................
ENSBTAP00000000788  ............................................................
ENSBTAP00000020299  ............................................................
ENSBTAP00000013292  ............................................................
ENSBTAP00000000458  ............................................................
ENSBTAP00000012225  ............................................................
ENSBTAP00000036729  ............................................................
ENSBTAP00000008454  ............................................................
ENSBTAP00000017076  ............................................................
ENSBTAP00000000179  ............................................................
ENSBTAP00000042771  ............................................................
ENSBTAP00000046486  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000005332  ............................................................
ENSBTAP00000008454  ............................................................
ENSBTAP00000053720  ............................................................
ENSBTAP00000035185  ............................................................
ENSBTAP00000017120  ............................................................
ENSBTAP00000053179  ............................................................
ENSBTAP00000011612  ............................................................
ENSBTAP00000032513  ............................................................
ENSBTAP00000017857  ............................................................
ENSBTAP00000008454  ............................................................
ENSBTAP00000027839  ............................................................
ENSBTAP00000053422  ............................................................
ENSBTAP00000000307  ............................................................
ENSBTAP00000017783  ............................................................
ENSBTAP00000005537  ............................................................
ENSBTAP00000017563  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000000307  ............................................................
ENSBTAP00000011863  ............................................................
ENSBTAP00000053409  ............................................................
ENSBTAP00000018697  ............................................................
ENSBTAP00000024169  ............................................................
ENSBTAP00000033006  ............................................................
ENSBTAP00000026956  ............................................................
ENSBTAP00000026725  ............................................................
ENSBTAP00000022744  ............................................................
ENSBTAP00000011612  ............................................................
ENSBTAP00000013316  ............................................................
ENSBTAP00000025424  ............................................................
ENSBTAP00000042646  ............................................................
ENSBTAP00000024169  ............................................................
ENSBTAP00000000307  ............................................................
ENSBTAP00000013440  ............................................................
ENSBTAP00000006786  ............................................................
ENSBTAP00000032513  ............................................................
ENSBTAP00000025424  ............................................................
ENSBTAP00000054985  ............................................................
ENSBTAP00000004114  ............................................................
ENSBTAP00000045584  ............................................................
ENSBTAP00000053179  ............................................................
ENSBTAP00000053569  ............................................................
ENSBTAP00000012117  ............................................................
ENSBTAP00000053727  ............................................................
ENSBTAP00000008967  ............................................................
ENSBTAP00000005686  ............................................................
ENSBTAP00000031460  ............................................................
ENSBTAP00000053495  ............................................................
ENSBTAP00000007877  ............................................................
ENSBTAP00000024169  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000036729  ............................................................
ENSBTAP00000001200  ............................................................
ENSBTAP00000034542  ............................................................
ENSBTAP00000000307  ............................................................
ENSBTAP00000053495  ............................................................
ENSBTAP00000024169  ............................................................
ENSBTAP00000023092  ............................................................
ENSBTAP00000024358  ............................................................
ENSBTAP00000000307  ............................................................
ENSBTAP00000006361  ............................................................
ENSBTAP00000032513  ............................................................
ENSBTAP00000053727  ............................................................
ENSBTAP00000054420  ............................................................
ENSBTAP00000032310  ............................................................
ENSBTAP00000023376  ............................................................
ENSBTAP00000042646  ............................................................
ENSBTAP00000016055  ............................................................
ENSBTAP00000003261  ............................................................
ENSBTAP00000053720  ............................................................
ENSBTAP00000025033  ............................................................
ENSBTAP00000004156  ............................................................
ENSBTAP00000025424  ............................................................
ENSBTAP00000054276  ............................................................
ENSBTAP00000023092  ............................................................
ENSBTAP00000037835  ............................................................
ENSBTAP00000032513  ............................................................
ENSBTAP00000008454  ............................................................
ENSBTAP00000010571  ............................................................
ENSBTAP00000015885  ............................................................
ENSBTAP00000041534  ............................................................
ENSBTAP00000023842  ............................................................
ENSBTAP00000013316  ............................................................
ENSBTAP00000053179  ............................................................
ENSBTAP00000033786  ............................................................
ENSBTAP00000016206  ............................................................
ENSBTAP00000003981  ............................................................
ENSBTAP00000053566  ............................................................
ENSBTAP00000048368  ............................................................
ENSBTAP00000025190  ............................................................
ENSBTAP00000004156  ............................................................
ENSBTAP00000010056  ............................................................
ENSBTAP00000001189  ............................................................
ENSBTAP00000046960  ............................................................
ENSBTAP00000055054  ............................................................
ENSBTAP00000006018  ............................................................
ENSBTAP00000055176  ............................................................
ENSBTAP00000003981  ............................................................
ENSBTAP00000033786  ............................................................
ENSBTAP00000042646  ............................................................
ENSBTAP00000043064  ............................................................
ENSBTAP00000033786  ............................................................
ENSBTAP00000053179  ............................................................
ENSBTAP00000011480  ............................................................
ENSBTAP00000011612  ............................................................
ENSBTAP00000029126  ............................................................
ENSBTAP00000029938  ............................................................
ENSBTAP00000007926  ............................................................
ENSBTAP00000011612  ............................................................
ENSBTAP00000018394  ............................................................
ENSBTAP00000003981  ............................................................
ENSBTAP00000016206  ............................................................
ENSBTAP00000010689  ............................................................
ENSBTAP00000018634  ............................................................
ENSBTAP00000010687  ............................................................
ENSBTAP00000024762  ............................................................
ENSBTAP00000053727  ............................................................
ENSBTAP00000053802  ............................................................
ENSBTAP00000039948  ............................................................
ENSBTAP00000053727  ............................................................
ENSBTAP00000027783  ............................................................
ENSBTAP00000047997  ............................................................
ENSBTAP00000009228  ............................................................
ENSBTAP00000048250  ............................................................
ENSBTAP00000046960  ............................................................
ENSBTAP00000044872  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000053650  ............................................................
ENSBTAP00000020240  ............................................................
ENSBTAP00000025061  ............................................................
ENSBTAP00000055305  ............................................................
ENSBTAP00000036054  ............................................................
ENSBTAP00000054766  ............................................................
ENSBTAP00000040914  ............................................................
ENSBTAP00000032513  ............................................................
ENSBTAP00000025458  ............................................................
ENSBTAP00000023092  ............................................................
ENSBTAP00000054766  ............................................................
ENSBTAP00000009351  ............................................................
ENSBTAP00000040914  ............................................................
ENSBTAP00000011612  ............................................................
ENSBTAP00000054766  ............................................................
ENSBTAP00000053495  ............................................................
ENSBTAP00000040914  ............................................................
ENSBTAP00000003981  ............................................................
ENSBTAP00000053932  ............................................................
ENSBTAP00000053616  ............................................................
ENSBTAP00000048757  ............................................................
ENSBTAP00000044383  ............................................................
ENSBTAP00000026111  ............................................................
ENSBTAP00000009703  ............................................................
ENSBTAP00000022475  ............................................................
ENSBTAP00000003981  ............................................................
ENSBTAP00000048250  ............................................................
ENSBTAP00000005537  ............................................................
ENSBTAP00000014043  ............................................................
ENSBTAP00000048757  ............................................................
ENSBTAP00000044383  ............................................................
ENSBTAP00000037559  ............................................................
ENSBTAP00000053727  ............................................................
ENSBTAP00000022474  ............................................................
ENSBTAP00000036460  ............................................................
ENSBTAP00000003367  ............................................................
ENSBTAP00000041534  ............................................................
ENSBTAP00000055305  ............................................................
ENSBTAP00000036054  ............................................................
ENSBTAP00000054517  ............................................................
ENSBTAP00000038137  ............................................................
ENSBTAP00000053650  ............................................................
ENSBTAP00000020240  ............................................................
ENSBTAP00000056645  ............................................................
ENSBTAP00000047997  ............................................................
ENSBTAP00000053365  ............................................................
ENSBTAP00000017949  ............................................................
ENSBTAP00000042505  ............................................................
ENSBTAP00000009228  ............................................................
ENSBTAP00000036054  ............................................................
ENSBTAP00000032513  ............................................................
ENSBTAP00000055305  ............................................................
ENSBTAP00000042505  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000002970  ............................................................
ENSBTAP00000009228  ............................................................
ENSBTAP00000056398  ............................................................
ENSBTAP00000031529  ............................................................
ENSBTAP00000000063  ............................................................
ENSBTAP00000002071  ............................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0052500 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 6312
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma mobile 163K
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes