SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

SH3-domain alignments in Myotis lucifugus 76_2.0

These alignments are sequences aligned to the 0041374 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1ng2a2               sp............................................................................
ENSMLUP00000003159  irqereqqaaiqlerakskpvafavktnvsycgaldedvp......................................
ENSMLUP00000006192  llknisgsvtlkilpsyrdti.........................................................
ENSMLUP00000001660  tkpvaf........................................................................
ENSMLUP00000010880  mketkgiislkvipnqqnrlpalq......................................................
ENSMLUP00000010026  arrevesqaqqqlerakhkpvafavrtnvsycgvldeec.......................................
ENSMLUP00000016306  lknisgsvtlkilpsyrdtiipqqsgismerhpah...........................................
ENSMLUP00000002731  ttqpk.........................................................................
ENSMLUP00000012398  llrsasgsvilkilpsyqeph.........................................................
ENSMLUP00000007590  kihdlreqmmnssissgsgslrtsqkr...................................................
ENSMLUP00000001366  ilaqsqgaitfkiipsikeetpsk......................................................
ENSMLUP00000005694  sdmhgtltfvlipsqqi.............................................................
ENSMLUP00000016016  ilamsrgtimfkvvpvs.............................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000006692  nssshtgtlrtrggt...............................................................
ENSMLUP00000018425  ..............................................................................
ENSMLUP00000002338  ..............................................................................
ENSMLUP00000010190  kihdlreqmmnssmssgsgslrtsekr...................................................
ENSMLUP00000002296  gwfpashvkllgpssertt...........................................................
ENSMLUP00000013892  ql............................................................................
ENSMLUP00000016474  spgtskvt......................................................................
ENSMLUP00000004080  fggfnssdtvtspqragpl...........................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000013066  ekl...........................................................................
ENSMLUP00000002474  iinssgprppvppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsrsrqgsgvnlrq.......
ENSMLUP00000010063  aea...........................................................................
ENSMLUP00000007412  p.............................................................................
ENSMLUP00000011783  kd............................................................................
ENSMLUP00000007133  ql............................................................................
ENSMLUP00000005117  rylqpggeqlaineli..............................................................
ENSMLUP00000005919  tn............................................................................
ENSMLUP00000011432  qq............................................................................
ENSMLUP00000001119  vp............................................................................
ENSMLUP00000010330  rs............................................................................
ENSMLUP00000002843  qrqsppaspapqpaperppsspvyedavsmkaepsyrgpvsepepvysreatdyreaggqqglaytpeavytsteapg
ENSMLUP00000011946  gni...........................................................................
ENSMLUP00000002942  ilaqsqgsitlkiipatqeedrlke.....................................................
ENSMLUP00000008920  k.............................................................................
ENSMLUP00000000496  hpppppsqyppapppaqqrylqhhhfhqerrggsldindghcglgmgmgsemnatlmhrrhtdpvql...........
ENSMLUP00000013320  p.............................................................................
ENSMLUP00000017214  fggfnssdtvtspqragpl...........................................................
ENSMLUP00000021229  wapk..........................................................................
ENSMLUP00000008092  wapk..........................................................................
ENSMLUP00000001413  tgqv..........................................................................
ENSMLUP00000013669  eee...........................................................................
ENSMLUP00000002497  ppsstpfwsv....................................................................
ENSMLUP00000015970  stlypstsnlltnh................................................................
ENSMLUP00000001413  a.............................................................................
ENSMLUP00000015518  neyklypelpsypervgnss..........................................................
ENSMLUP00000013530  qg............................................................................
ENSMLUP00000001958  a.............................................................................
ENSMLUP00000011783  r.............................................................................
ENSMLUP00000000207  s.............................................................................
ENSMLUP00000007093  aga...........................................................................
ENSMLUP00000013066  pa............................................................................
ENSMLUP00000003166  lypsaevqlnnk..................................................................
ENSMLUP00000007433  fmdklaskklcaddecvytis.........................................................
ENSMLUP00000007981  a.............................................................................
ENSMLUP00000005897  ssltcdnppdylrt................................................................
ENSMLUP00000005860  ppvr..........................................................................
ENSMLUP00000009512  gp............................................................................
ENSMLUP00000002296  eks...........................................................................
ENSMLUP00000007216  arl...........................................................................
ENSMLUP00000001866  kpqgpgnkqspklitgd.............................................................
ENSMLUP00000003210  lqm...........................................................................
ENSMLUP00000008920  ik............................................................................
ENSMLUP00000013622  taee..........................................................................
ENSMLUP00000007577  vk............................................................................
ENSMLUP00000007981  lh............................................................................
ENSMLUP00000015831  a.............................................................................
ENSMLUP00000009890  yggykepaapvstqrs..............................................................
ENSMLUP00000001358  l.............................................................................
ENSMLUP00000004195  e.............................................................................
ENSMLUP00000007864  aay...........................................................................
ENSMLUP00000010897  shsqgygymhqtslssmrsm..........................................................
ENSMLUP00000006579  dpn...........................................................................
ENSMLUP00000019391  dsqtpppplppdnipmfddsppppppppvdykdeeaalvhyndpyadgdpa...........................
ENSMLUP00000001358  al............................................................................
ENSMLUP00000005860  rpq...........................................................................
ENSMLUP00000010009  niddtakrks....................................................................
ENSMLUP00000016474  vk............................................................................
ENSMLUP00000008018  dpn...........................................................................
ENSMLUP00000014609  re............................................................................
ENSMLUP00000009299  ptf...........................................................................
ENSMLUP00000006831  etg...........................................................................
ENSMLUP00000003954  kplpp.........................................................................
ENSMLUP00000011645  tpep..........................................................................
ENSMLUP00000012000  mi............................................................................
ENSMLUP00000013586  np............................................................................
ENSMLUP00000002296  ytv...........................................................................
ENSMLUP00000010009  spqqpqaqqrrvtpdrsqas..........................................................
ENSMLUP00000007216  ph............................................................................
ENSMLUP00000016474  ve............................................................................
ENSMLUP00000001012  md............................................................................
ENSMLUP00000017975  qn............................................................................
ENSMLUP00000018941  ldr...........................................................................
ENSMLUP00000005582  srggariqv.....................................................................
ENSMLUP00000017787  vvpssypag.....................................................................
ENSMLUP00000015689  aq............................................................................
ENSMLUP00000002296  vntswqkksaftrtvspgsvspihgqgqv.................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000012000  e.............................................................................
ENSMLUP00000004960  hr............................................................................
ENSMLUP00000016474  aak...........................................................................
ENSMLUP00000007216  inw...........................................................................
ENSMLUP00000018941  pv............................................................................
ENSMLUP00000007615  mnk...........................................................................
ENSMLUP00000017501  vd............................................................................
ENSMLUP00000005582  pp............................................................................
ENSMLUP00000013066  iq............................................................................
ENSMLUP00000004531  aekktpddkhkqpg................................................................
ENSMLUP00000014222  e.............................................................................
ENSMLUP00000001012  lsa...........................................................................
ENSMLUP00000011016  ymldlqkqlgsfpssyhsnnnqtsvvpvpsassnvigssamtssglvmtspsnlidlkeg..................
ENSMLUP00000014075  eg............................................................................
ENSMLUP00000016089  prkaa.........................................................................
ENSMLUP00000014075  ral...........................................................................
ENSMLUP00000010551  avaa..........................................................................
ENSMLUP00000011784  lr............................................................................
ENSMLUP00000016474  kkp...........................................................................
ENSMLUP00000014409  l.............................................................................
ENSMLUP00000013262  p.............................................................................
ENSMLUP00000014923  iw............................................................................
ENSMLUP00000004002  tpr...........................................................................
ENSMLUP00000020771  iw............................................................................
ENSMLUP00000007028  ..............................................................................
ENSMLUP00000010009  pvqil.........................................................................
ENSMLUP00000018941  smaaarpe......................................................................
ENSMLUP00000010822  fndvkvpspsallgdn..............................................................
ENSMLUP00000015288  nkg...........................................................................
ENSMLUP00000013669  vd............................................................................
ENSMLUP00000022476  tkkrrp........................................................................
ENSMLUP00000011542  seal..........................................................................
ENSMLUP00000011542  pdeede........................................................................
ENSMLUP00000016384  qel...........................................................................
ENSMLUP00000005860  sldsavpiappprqpcsslgsvmnesr...................................................
ENSMLUP00000003137  tqqttvssi.....................................................................
ENSMLUP00000016884  eapaap........................................................................
ENSMLUP00000015858  rrtkfvsftsrl..................................................................
ENSMLUP00000012406  e.............................................................................
ENSMLUP00000009292  l.............................................................................
ENSMLUP00000001413  v.............................................................................
ENSMLUP00000012000  pcptkkgreg....................................................................
ENSMLUP00000007949  epta..........................................................................
ENSMLUP00000001358  kpvd..........................................................................
ENSMLUP00000005582  peevlahq......................................................................
ENSMLUP00000012019  m.............................................................................
ENSMLUP00000007621  gnppgprrgskd..................................................................
ENSMLUP00000000109  ghhnefdddfeddd................................................................
ENSMLUP00000012976  gv............................................................................
ENSMLUP00000010504  cy............................................................................
ENSMLUP00000007384  pklspflscppatpadk.............................................................
ENSMLUP00000002099  pdrt..........................................................................
ENSMLUP00000010226  ldlqkqlgrfpgtfvgttepaspplsstsptttaatmpmepsvagpappgeaalcleeva..................
ENSMLUP00000001012  lp............................................................................
ENSMLUP00000012000  p.............................................................................
ENSMLUP00000014043  e.............................................................................
ENSMLUP00000017916  ppnpsptsplspswpmfsapsspmptsstssdsspirsvagfvwfsvaavvlslawsslhavfsllvnfvpchpnlhl
ENSMLUP00000002503  ie............................................................................
ENSMLUP00000009446  eeveq.........................................................................
ENSMLUP00000013179  stdya.........................................................................
ENSMLUP00000006973  hp............................................................................
ENSMLUP00000013630  r.............................................................................
ENSMLUP00000012141  t.............................................................................
ENSMLUP00000013669  p.............................................................................
ENSMLUP00000006358  mslltsphqppppppasaspsavpngpqspkqqkeplshrfnefmtskpkihcfrslkrglslklgaapedfsnlppe
ENSMLUP00000002296  gasnkk........................................................................
ENSMLUP00000006507  pav...........................................................................
ENSMLUP00000011422  ..............................................................................
ENSMLUP00000008265  v.............................................................................
ENSMLUP00000011428  ie............................................................................
ENSMLUP00000002679  ekeekdfrkkfkydgeirvlysttvvpsltskkw............................................
ENSMLUP00000018941  p.............................................................................
ENSMLUP00000005860  pl............................................................................
ENSMLUP00000011542  ip............................................................................
ENSMLUP00000020371  lsffffnfpa....................................................................
ENSMLUP00000011542  rasllar.......................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000010676  sg............................................................................
ENSMLUP00000011698  tkllanfkkcadvecetli...........................................................
ENSMLUP00000009701  g.............................................................................
ENSMLUP00000004596  s.............................................................................
ENSMLUP00000020371  tdthrskllstyt.................................................................
ENSMLUP00000000207  pl............................................................................
ENSMLUP00000014421  pk............................................................................
ENSMLUP00000013929  sqasreikqllrea................................................................
ENSMLUP00000003615  e.............................................................................
ENSMLUP00000019445  e.............................................................................
ENSMLUP00000003921  l.............................................................................
ENSMLUP00000002679  ekkeqeikkkfkltgpievihqaraccdvkg...............................................
ENSMLUP00000001797  spspgsgsfgee..................................................................
ENSMLUP00000007922  pkesqqep......................................................................
ENSMLUP00000016884  agrdt.........................................................................
ENSMLUP00000021898  tnwasgeddh....................................................................
ENSMLUP00000018532  ekaerefrkkfkfegeiviqtkmmidpnaktrrggg..........................................
ENSMLUP00000006141  ekaerefrkkfkfegeiviqtkmmidpnaktrrggg..........................................
ENSMLUP00000012243  hr............................................................................
ENSMLUP00000007949  pv............................................................................
ENSMLUP00000010409  gq............................................................................
ENSMLUP00000000120  yq............................................................................
ENSMLUP00000002448  et............................................................................
ENSMLUP00000006631  g.............................................................................
ENSMLUP00000013267  leppaavlg.....................................................................
ENSMLUP00000002140  gtssm.........................................................................
ENSMLUP00000009401  e.............................................................................
ENSMLUP00000011645  erqvqalltky...................................................................
ENSMLUP00000000142  qiscllfiwlpkmevcqeyygippppgalgpf..............................................
ENSMLUP00000013622  aainplpstqngpvfakavqkrvpca....................................................
ENSMLUP00000002497  tsrqvda.......................................................................
ENSMLUP00000013669  apfps.........................................................................
ENSMLUP00000008144  rhtrppdppasappdsssssnsgsqenkesseeppleegqdtpiytefdedfees.......................
ENSMLUP00000004680  nmmkr.........................................................................
ENSMLUP00000010492  va............................................................................
ENSMLUP00000011542  ege...........................................................................
ENSMLUP00000000726  ssssn.........................................................................
ENSMLUP00000016884  pqgnprgpplctrmtmmaaldydpkdgwag................................................
ENSMLUP00000002474  hpqplggpepgpyaqpsvntplpnlqngpiy...............................................
ENSMLUP00000013417  slgepppppraslssdtsalsydsvkytlvvdehaqlelvslrpcfgdysdesdsatvydncasasspyesaigeeye
ENSMLUP00000012000  qrngipvspvrpkpieksqfihnnl.....................................................
ENSMLUP00000001859  ..............................................................................
ENSMLUP00000016646  geagsgtaps....................................................................
ENSMLUP00000009616  pg............................................................................
ENSMLUP00000010476  f.............................................................................
ENSMLUP00000003844  gpf...........................................................................
ENSMLUP00000012979  eklfrerfeydkeitvintavacsrnsrngif..............................................
ENSMLUP00000010870  lsgk..........................................................................
ENSMLUP00000004205  t.............................................................................
ENSMLUP00000000726  rtsqntldsdkls.................................................................
ENSMLUP00000008845  kslpspssspsvqdqgp.............................................................
ENSMLUP00000012305  tsrpnpaggrp...................................................................
ENSMLUP00000000937  sq............................................................................
ENSMLUP00000002140  sg............................................................................
ENSMLUP00000016537  eaqptd........................................................................
ENSMLUP00000015982  eaqptd........................................................................
ENSMLUP00000009378  wflknypgscglprkrdwtgsyq.......................................................
ENSMLUP00000001358  vsshcv........................................................................
ENSMLUP00000010676  rl............................................................................
ENSMLUP00000011918  a.............................................................................
ENSMLUP00000006188  d.............................................................................
ENSMLUP00000004439  f.............................................................................
ENSMLUP00000004210  ..............................................................................
ENSMLUP00000015169  ky............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000000142  agstkyf.......................................................................
ENSMLUP00000006936  v.............................................................................
ENSMLUP00000010147  ffirsh........................................................................
ENSMLUP00000009801  fyirt.........................................................................
ENSMLUP00000018134  lipcvlhvvhkvylfslat...........................................................
ENSMLUP00000016407  h.............................................................................
ENSMLUP00000010152  lavltdypspdisppi..............................................................
ENSMLUP00000009378  e.............................................................................
ENSMLUP00000020593  ..............................................................................
ENSMLUP00000019238  lipcvlhvvhkvylfslat...........................................................
ENSMLUP00000001358  lpprpkpghplyrkymlsvphgianenivs................................................
ENSMLUP00000000215  ditgp.........................................................................
ENSMLUP00000004531  erv...........................................................................
ENSMLUP00000001760  te............................................................................


                                                                                                    
                                                                                                    
d1ng2a2               ..............................................................................
ENSMLUP00000003159  ..............................................................................
ENSMLUP00000006192  ..............................................................................
ENSMLUP00000001660  ..............................................................................
ENSMLUP00000010880  ..............................................................................
ENSMLUP00000010026  ..............................................................................
ENSMLUP00000016306  ..............................................................................
ENSMLUP00000002731  ..............................................................................
ENSMLUP00000012398  ..............................................................................
ENSMLUP00000007590  ..............................................................................
ENSMLUP00000001366  ..............................................................................
ENSMLUP00000005694  ..............................................................................
ENSMLUP00000016016  ..............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000006692  ..............................................................................
ENSMLUP00000018425  ..............................................................................
ENSMLUP00000002338  ..............................................................................
ENSMLUP00000010190  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000013892  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000004080  ..............................................................................
ENSMLUP00000013902  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000002474  ..............................................................................
ENSMLUP00000010063  ..............................................................................
ENSMLUP00000007412  ..............................................................................
ENSMLUP00000011783  ..............................................................................
ENSMLUP00000007133  ..............................................................................
ENSMLUP00000005117  ..............................................................................
ENSMLUP00000005919  ..............................................................................
ENSMLUP00000011432  ..............................................................................
ENSMLUP00000001119  ..............................................................................
ENSMLUP00000010330  ..............................................................................
ENSMLUP00000002843  hypeeentydeyendl..............................................................
ENSMLUP00000011946  ..............................................................................
ENSMLUP00000002942  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000017214  ..............................................................................
ENSMLUP00000021229  ..............................................................................
ENSMLUP00000008092  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000015970  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000015518  ..............................................................................
ENSMLUP00000013530  ..............................................................................
ENSMLUP00000001958  ..............................................................................
ENSMLUP00000011783  ..............................................................................
ENSMLUP00000000207  ..............................................................................
ENSMLUP00000007093  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000003166  ..............................................................................
ENSMLUP00000007433  ..............................................................................
ENSMLUP00000007981  ..............................................................................
ENSMLUP00000005897  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000009512  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000001866  ..............................................................................
ENSMLUP00000003210  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000007577  ..............................................................................
ENSMLUP00000007981  ..............................................................................
ENSMLUP00000015831  ..............................................................................
ENSMLUP00000009890  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000004195  ..............................................................................
ENSMLUP00000007864  ..............................................................................
ENSMLUP00000010897  ..............................................................................
ENSMLUP00000006579  ..............................................................................
ENSMLUP00000019391  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000008018  ..............................................................................
ENSMLUP00000014609  ..............................................................................
ENSMLUP00000009299  ..............................................................................
ENSMLUP00000006831  ..............................................................................
ENSMLUP00000003954  ..............................................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000013586  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000017975  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000017787  ..............................................................................
ENSMLUP00000015689  ..............................................................................
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000008920  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000004960  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000007216  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000007615  ..............................................................................
ENSMLUP00000017501  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000013066  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000014222  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000011016  ..............................................................................
ENSMLUP00000014075  ..............................................................................
ENSMLUP00000016089  ..............................................................................
ENSMLUP00000014075  ..............................................................................
ENSMLUP00000010551  ..............................................................................
ENSMLUP00000011784  ..............................................................................
ENSMLUP00000016474  ..............................................................................
ENSMLUP00000014409  ..............................................................................
ENSMLUP00000013262  ..............................................................................
ENSMLUP00000014923  ..............................................................................
ENSMLUP00000004002  ..............................................................................
ENSMLUP00000020771  ..............................................................................
ENSMLUP00000007028  ..............................................................................
ENSMLUP00000010009  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000010822  ..............................................................................
ENSMLUP00000015288  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000022476  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000016384  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000003137  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000015858  ..............................................................................
ENSMLUP00000012406  ..............................................................................
ENSMLUP00000009292  ..............................................................................
ENSMLUP00000001413  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000005582  ..............................................................................
ENSMLUP00000012019  ..............................................................................
ENSMLUP00000007621  ..............................................................................
ENSMLUP00000000109  ..............................................................................
ENSMLUP00000012976  ..............................................................................
ENSMLUP00000010504  ..............................................................................
ENSMLUP00000007384  ..............................................................................
ENSMLUP00000002099  ..............................................................................
ENSMLUP00000010226  ..............................................................................
ENSMLUP00000001012  ..............................................................................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000014043  ..............................................................................
ENSMLUP00000017916  lfdrpeeavhedsstp..............................................................
ENSMLUP00000002503  ..............................................................................
ENSMLUP00000009446  ..............................................................................
ENSMLUP00000013179  ..............................................................................
ENSMLUP00000006973  ..............................................................................
ENSMLUP00000013630  ..............................................................................
ENSMLUP00000012141  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000006358  qrrkklqqkvdelnkeiqkemdqreaitkmkdvylknpqmgdpasldhklteviqnidklrleaqkfeawlaevegrl
ENSMLUP00000002296  ..............................................................................
ENSMLUP00000006507  ..............................................................................
ENSMLUP00000011422  ..............................................................................
ENSMLUP00000008265  ..............................................................................
ENSMLUP00000011428  ..............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000018941  ..............................................................................
ENSMLUP00000005860  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000000496  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011698  ..............................................................................
ENSMLUP00000009701  ..............................................................................
ENSMLUP00000004596  ..............................................................................
ENSMLUP00000020371  ..............................................................................
ENSMLUP00000000207  ..............................................................................
ENSMLUP00000014421  ..............................................................................
ENSMLUP00000013929  ..............................................................................
ENSMLUP00000003615  ..............................................................................
ENSMLUP00000019445  ..............................................................................
ENSMLUP00000003921  ..............................................................................
ENSMLUP00000002679  ..............................................................................
ENSMLUP00000001797  ..............................................................................
ENSMLUP00000007922  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000021898  ..............................................................................
ENSMLUP00000018532  ..............................................................................
ENSMLUP00000006141  ..............................................................................
ENSMLUP00000012243  ..............................................................................
ENSMLUP00000007949  ..............................................................................
ENSMLUP00000010409  ..............................................................................
ENSMLUP00000000120  ..............................................................................
ENSMLUP00000002448  ..............................................................................
ENSMLUP00000006631  ..............................................................................
ENSMLUP00000013267  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000009401  ..............................................................................
ENSMLUP00000011645  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000013622  ..............................................................................
ENSMLUP00000002497  ..............................................................................
ENSMLUP00000013669  ..............................................................................
ENSMLUP00000008144  ..............................................................................
ENSMLUP00000004680  ..............................................................................
ENSMLUP00000010492  ..............................................................................
ENSMLUP00000011542  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000016884  ..............................................................................
ENSMLUP00000002474  ..............................................................................
ENSMLUP00000013417  eaprprpsaclsedstpdepdvhfskkflnvfmsgrsrsssaesfglfscvingeeqe....................
ENSMLUP00000012000  ..............................................................................
ENSMLUP00000001859  ..............................................................................
ENSMLUP00000016646  ..............................................................................
ENSMLUP00000009616  ..............................................................................
ENSMLUP00000010476  ..............................................................................
ENSMLUP00000003844  ..............................................................................
ENSMLUP00000012979  ..............................................................................
ENSMLUP00000010870  ..............................................................................
ENSMLUP00000004205  ..............................................................................
ENSMLUP00000000726  ..............................................................................
ENSMLUP00000008845  ..............................................................................
ENSMLUP00000012305  ..............................................................................
ENSMLUP00000000937  ..............................................................................
ENSMLUP00000002140  ..............................................................................
ENSMLUP00000016537  ..............................................................................
ENSMLUP00000015982  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000010676  ..............................................................................
ENSMLUP00000011918  ..............................................................................
ENSMLUP00000006188  ..............................................................................
ENSMLUP00000004439  ..............................................................................
ENSMLUP00000004210  ..............................................................................
ENSMLUP00000015169  ..............................................................................
ENSMLUP00000013320  ..............................................................................
ENSMLUP00000000142  ..............................................................................
ENSMLUP00000006936  ..............................................................................
ENSMLUP00000010147  ..............................................................................
ENSMLUP00000009801  ..............................................................................
ENSMLUP00000018134  ..............................................................................
ENSMLUP00000016407  ..............................................................................
ENSMLUP00000010152  ..............................................................................
ENSMLUP00000009378  ..............................................................................
ENSMLUP00000020593  ..............................................................................
ENSMLUP00000019238  ..............................................................................
ENSMLUP00000001358  ..............................................................................
ENSMLUP00000000215  ..............................................................................
ENSMLUP00000004531  ..............................................................................
ENSMLUP00000001760  ..............................................................................


                                                                                           10       
                                                                                            |       
d1ng2a2               .............................................................--DETEDPEPNYAGEPY
ENSMLUP00000003159  .............................................................-----------------
ENSMLUP00000006192  .............................................................----------IPQQVFV
ENSMLUP00000001660  .............................................................---------------AV
ENSMLUP00000010880  .............................................................--------------MFM
ENSMLUP00000010026  .............................................................-----------------
ENSMLUP00000016306  .............................................................-----------VRQVFV
ENSMLUP00000002731  .............................................................-----------GRQIYV
ENSMLUP00000012398  .............................................................----------LPRQVFV
ENSMLUP00000007590  .............................................................-------------SLYP
ENSMLUP00000001366  .............................................................-----------EGKMFI
ENSMLUP00000005694  .............................................................-----KPPPAKETVIHV
ENSMLUP00000016016  .............................................................-----DPPVNSQKMVYV
ENSMLUP00000013902  .............................................................---------------YV
ENSMLUP00000006692  .............................................................------------GVTLF
ENSMLUP00000018425  .............................................................-----------------
ENSMLUP00000002338  .............................................................-----------------
ENSMLUP00000010190  .............................................................-------------SLYV
ENSMLUP00000002296  .............................................................--------PAFHPVCQV
ENSMLUP00000013892  .............................................................---------------VV
ENSMLUP00000016474  .............................................................--------PTEPPMCQV
ENSMLUP00000004080  .............................................................----------AGGVTTF
ENSMLUP00000013902  .............................................................-----------------
ENSMLUP00000013066  .............................................................---------------PA
ENSMLUP00000002474  .............................................................-----------EEIEYV
ENSMLUP00000010063  .............................................................---------PWPQGSYF
ENSMLUP00000007412  .............................................................------PWAPRSYLEKV
ENSMLUP00000011783  .............................................................---------------YC
ENSMLUP00000007133  .............................................................---------------IV
ENSMLUP00000005117  .............................................................---------SDGSVVCA
ENSMLUP00000005919  .............................................................------PPASPLQDNLV
ENSMLUP00000011432  .............................................................-PPKHPLRKDVGPMYSY
ENSMLUP00000001119  .............................................................-----------MDQPCC
ENSMLUP00000010330  .............................................................--------MPPLDQPSC
ENSMLUP00000002843  .............................................................-------------GITA
ENSMLUP00000011946  .............................................................---------------LC
ENSMLUP00000002942  .............................................................------------SKVFM
ENSMLUP00000008920  .............................................................--------------EYC
ENSMLUP00000000496  .............................................................--------QVAGRVRWA
ENSMLUP00000013320  .............................................................-------PLQPPRTGFA
ENSMLUP00000017214  .............................................................----------AGGVTTF
ENSMLUP00000021229  .............................................................-----------NYIEKV
ENSMLUP00000008092  .............................................................-----------NYIEKV
ENSMLUP00000001413  .............................................................-------------LHVV
ENSMLUP00000013669  .............................................................--------------EKY
ENSMLUP00000002497  .............................................................--------LSPKVLGIA
ENSMLUP00000015970  .............................................................----------QHEGRKV
ENSMLUP00000001413  .............................................................-----------------
ENSMLUP00000015518  .............................................................------------RPTEV
ENSMLUP00000013530  .............................................................--------------DIV
ENSMLUP00000001958  .............................................................--------------PTV
ENSMLUP00000011783  .............................................................---------------RC
ENSMLUP00000000207  .............................................................-------------VCFV
ENSMLUP00000007093  .............................................................-------------GISA
ENSMLUP00000013066  .............................................................---RPPPPAQPGEIGEA
ENSMLUP00000003166  .............................................................------------VARKV
ENSMLUP00000007433  .............................................................---------------LS
ENSMLUP00000007981  .............................................................-----------------
ENSMLUP00000005897  .............................................................----------VFYPETY
ENSMLUP00000005860  .............................................................---------GIPQLPCA
ENSMLUP00000009512  .............................................................---------PTLPARNY
ENSMLUP00000002296  .............................................................--------EPASELVNY
ENSMLUP00000007216  .............................................................-----------------
ENSMLUP00000001866  .............................................................------------SIVSA
ENSMLUP00000003210  .............................................................--------------NTY
ENSMLUP00000008920  .............................................................-------------KRQC
ENSMLUP00000013622  .............................................................------------NLEYV
ENSMLUP00000007577  .............................................................---------------VF
ENSMLUP00000007981  .............................................................---------------VV
ENSMLUP00000015831  .............................................................------------PLPYW
ENSMLUP00000009890  .............................................................--------APSGGGKRY
ENSMLUP00000001358  .............................................................------------SGEWC
ENSMLUP00000004195  .............................................................--------------VRV
ENSMLUP00000007864  .............................................................------------ANPVW
ENSMLUP00000010897  .............................................................--------QHSPNLRTY
ENSMLUP00000006579  .............................................................---------------LF
ENSMLUP00000019391  .............................................................-------WAPKNYIEKV
ENSMLUP00000001358  .............................................................------------KGRKA
ENSMLUP00000005860  .............................................................-----------TRPSVY
ENSMLUP00000010009  .............................................................----------GSEMRPA
ENSMLUP00000016474  .............................................................-------------VVYY
ENSMLUP00000008018  .............................................................---------------LF
ENSMLUP00000014609  .............................................................--------------ERV
ENSMLUP00000009299  .............................................................-------------KCAV
ENSMLUP00000006831  .............................................................-------------KELV
ENSMLUP00000003954  .............................................................--EPTAAPVSTSELKKV
ENSMLUP00000011645  .............................................................---SPALVASVPAATQV
ENSMLUP00000012000  .............................................................-------------LEQY
ENSMLUP00000013586  .............................................................----------SMPQRTV
ENSMLUP00000002296  .............................................................-------------GEEY
ENSMLUP00000010009  .............................................................-----------QDLFSY
ENSMLUP00000007216  .............................................................----KPPTYQVLEYGEA
ENSMLUP00000016474  .............................................................-------------GLQA
ENSMLUP00000001012  .............................................................------------GVPRA
ENSMLUP00000017975  .............................................................--------------VLA
ENSMLUP00000018941  .............................................................---------------RY
ENSMLUP00000005582  .............................................................----------------F
ENSMLUP00000017787  .............................................................---------LTGGVTIF
ENSMLUP00000015689  .............................................................---------------LA
ENSMLUP00000002296  .............................................................-----------VENLKA
ENSMLUP00000008920  .............................................................----------------Y
ENSMLUP00000012000  .............................................................--------------EKY
ENSMLUP00000004960  .............................................................--------------RRA
ENSMLUP00000016474  .............................................................---------PALSGEEF
ENSMLUP00000007216  .............................................................--------------TPY
ENSMLUP00000018941  .............................................................-----------VQLPCG
ENSMLUP00000007615  .............................................................--------------GVV
ENSMLUP00000017501  .............................................................----------PMVLEQY
ENSMLUP00000005582  .............................................................---EPVSSASLRAPRCM
ENSMLUP00000013066  .............................................................-----------GGGEPF
ENSMLUP00000004531  .............................................................----------FQQSHYF
ENSMLUP00000014222  .............................................................---------------EC
ENSMLUP00000001012  .............................................................--------------NMF
ENSMLUP00000011016  .............................................................-----------SGSRKA
ENSMLUP00000014075  .............................................................--------------SQV
ENSMLUP00000016089  .............................................................------------TGVRV
ENSMLUP00000014075  .............................................................------------EGEAH
ENSMLUP00000010551  .............................................................----------------A
ENSMLUP00000011784  .............................................................--------------PAV
ENSMLUP00000016474  .............................................................--------------EIA
ENSMLUP00000014409  .............................................................----------------V
ENSMLUP00000013262  .............................................................---------------QY
ENSMLUP00000014923  .............................................................-----------------
ENSMLUP00000004002  .............................................................---------PVQPALRM
ENSMLUP00000020771  .............................................................-----------------
ENSMLUP00000007028  .............................................................--PPLPPPEVAEEKTRV
ENSMLUP00000010009  .............................................................------------EYGEA
ENSMLUP00000018941  .............................................................--------PKPFPRERY
ENSMLUP00000010822  .............................................................-------PTPFGNAKEV
ENSMLUP00000015288  .............................................................---------------VI
ENSMLUP00000013669  .............................................................----------PMVLEQY
ENSMLUP00000022476  .............................................................-PPPIPPEEEDNSEEIV
ENSMLUP00000011542  .............................................................------------GNQVY
ENSMLUP00000011542  .............................................................-----------QPGTYG
ENSMLUP00000016384  .............................................................---------PPGFLYKV
ENSMLUP00000005860  .............................................................----------PVVCERH
ENSMLUP00000003137  .............................................................------PSHPSTAGKIF
ENSMLUP00000016884  .............................................................------------KLKIF
ENSMLUP00000015858  .............................................................-----------LDCPQV
ENSMLUP00000012406  .............................................................----------------C
ENSMLUP00000009292  .............................................................---------------LA
ENSMLUP00000001413  .............................................................---------------VV
ENSMLUP00000012000  .............................................................------------QATSY
ENSMLUP00000007949  .............................................................--------------FLA
ENSMLUP00000001358  .............................................................-----------SSAPHA
ENSMLUP00000005582  .............................................................----------DLPVRVF
ENSMLUP00000012019  .............................................................----------------A
ENSMLUP00000007621  .............................................................--------------NIV
ENSMLUP00000000109  .............................................................---------PLPAIGHC
ENSMLUP00000012976  .............................................................--------------VEA
ENSMLUP00000010504  .............................................................------------DSPQV
ENSMLUP00000007384  .............................................................-------PPESVTSRKA
ENSMLUP00000002099  .............................................................------------SLTQV
ENSMLUP00000010226  .............................................................--------PPASGTRKA
ENSMLUP00000001012  .............................................................-----------QPPPLC
ENSMLUP00000012000  .............................................................-----KPPEPPSVEVEY
ENSMLUP00000014043  .............................................................-------------GYQY
ENSMLUP00000017916  .............................................................--------------FRK
ENSMLUP00000002503  .............................................................----------------A
ENSMLUP00000009446  .............................................................--------------IEA
ENSMLUP00000013179  .............................................................--------------NFY
ENSMLUP00000006973  .............................................................--------------EEF
ENSMLUP00000013630  .............................................................--------------PQV
ENSMLUP00000012141  .............................................................---------------KA
ENSMLUP00000013669  .............................................................-----KPPIPPQVEEEY
ENSMLUP00000006358  pargeqrrqsglydaqpapavnncaqaresrngqlhggaearrsggercwatdfddefdde--------EPLPAIGTC
ENSMLUP00000002296  .............................................................-------------PEIA
ENSMLUP00000006507  .............................................................--------------GAA
ENSMLUP00000011422  .............................................................-----------------
ENSMLUP00000008265  .............................................................--------------RRV
ENSMLUP00000011428  .............................................................----------------A
ENSMLUP00000002679  .............................................................-----------------
ENSMLUP00000018941  .............................................................-----------PTPPQG
ENSMLUP00000005860  .............................................................----------PQPPPQC
ENSMLUP00000011542  .............................................................----------DYSMGQA
ENSMLUP00000020371  .............................................................---------------IF
ENSMLUP00000011542  .............................................................----------YPPEKLF
ENSMLUP00000000496  .............................................................----------------A
ENSMLUP00000010676  .............................................................--------------SQF
ENSMLUP00000011698  .............................................................--------------SRV
ENSMLUP00000009701  .............................................................-----------------
ENSMLUP00000004596  .............................................................---------------YY
ENSMLUP00000020371  .............................................................------------TEELY
ENSMLUP00000000207  .............................................................---------------TC
ENSMLUP00000014421  .............................................................--------------KYA
ENSMLUP00000013929  .............................................................-----------SGILKV
ENSMLUP00000003615  .............................................................-------------GFQY
ENSMLUP00000019445  .............................................................------PPYRGPFCGRA
ENSMLUP00000003921  .............................................................---------------QV
ENSMLUP00000002679  .............................................................-----------------
ENSMLUP00000001797  .............................................................---PPAPQYTGPFCGRA
ENSMLUP00000007922  .............................................................----HAPALPSKPPCEV
ENSMLUP00000016884  .............................................................------------AGRVF
ENSMLUP00000021898  .............................................................--------------VVA
ENSMLUP00000018532  .............................................................-----------------
ENSMLUP00000006141  .............................................................-----------------
ENSMLUP00000012243  .............................................................---------------AV
ENSMLUP00000007949  .............................................................----PPALATRPFPCPA
ENSMLUP00000010409  .............................................................--------------VYI
ENSMLUP00000000120  .............................................................---------------TL
ENSMLUP00000002448  .............................................................----------------L
ENSMLUP00000006631  .............................................................--------------RQA
ENSMLUP00000013267  .............................................................--------SPPAPGQFF
ENSMLUP00000002140  .............................................................-----------------
ENSMLUP00000009401  .............................................................------PPYRGPFCGRA
ENSMLUP00000011645  .............................................................-----------GPGKLY
ENSMLUP00000000142  .............................................................-----------------
ENSMLUP00000013622  .............................................................-----------------
ENSMLUP00000002497  .............................................................------------GLPKM
ENSMLUP00000013669  .............................................................---------ADSPKDLY
ENSMLUP00000008144  .............................................................----------ASPIGHC
ENSMLUP00000004680  .............................................................--------------QKV
ENSMLUP00000010492  .............................................................------PPEPVEDRRRV
ENSMLUP00000011542  .............................................................--------------RLF
ENSMLUP00000000726  .............................................................-------------ISTM
ENSMLUP00000016884  .............................................................-----------------
ENSMLUP00000002474  .............................................................----------------A
ENSMLUP00000013417  .............................................................--------------QTH
ENSMLUP00000012000  .............................................................-------------KDVY
ENSMLUP00000001859  .............................................................-----------------
ENSMLUP00000016646  .............................................................-----------------
ENSMLUP00000009616  .............................................................---------------KY
ENSMLUP00000010476  .............................................................---------------YI
ENSMLUP00000003844  .............................................................-------------CGRA
ENSMLUP00000012979  .............................................................-----------------
ENSMLUP00000010870  .............................................................-------------GLCA
ENSMLUP00000004205  .............................................................---------------QC
ENSMLUP00000000726  .............................................................-----------GGCELT
ENSMLUP00000008845  .............................................................-----VPMQPERRKATA
ENSMLUP00000012305  .............................................................----KPQPKPKPQVPQC
ENSMLUP00000000937  .............................................................-------------GPQL
ENSMLUP00000002140  .............................................................------------GCELT
ENSMLUP00000016537  .............................................................----------------M
ENSMLUP00000015982  .............................................................----------------M
ENSMLUP00000009378  .............................................................-----------IGRGKC
ENSMLUP00000001358  .............................................................-----------NKGPRC
ENSMLUP00000010676  .............................................................-----------------
ENSMLUP00000011918  .............................................................-----------------
ENSMLUP00000006188  .............................................................-----------------
ENSMLUP00000004439  .............................................................---------------YI
ENSMLUP00000004210  .............................................................-----------------
ENSMLUP00000015169  .............................................................----------------V
ENSMLUP00000013320  .............................................................-----------------
ENSMLUP00000000142  .............................................................--------------GTA
ENSMLUP00000006936  .............................................................-----------------
ENSMLUP00000010147  .............................................................-----------------
ENSMLUP00000009801  .............................................................-----------------
ENSMLUP00000018134  .............................................................-----------------
ENSMLUP00000016407  .............................................................---------------FV
ENSMLUP00000010152  .............................................................-----------------
ENSMLUP00000009378  .............................................................-----------------
ENSMLUP00000020593  .............................................................-----------------
ENSMLUP00000019238  .............................................................-----------------
ENSMLUP00000001358  .............................................................-----------------
ENSMLUP00000000215  .............................................................-----------IILQTY
ENSMLUP00000004531  .............................................................----------------H
ENSMLUP00000001760  .............................................................-----------------


                       20                 30               40                                       
                        |                  |                |                                       
d1ng2a2               VAIKAYTAV........EG.DE.......VSLLEGEAVEV...............IHK..........LLDG......
ENSMLUP00000003159  --------V........PS.TA.......ISFDAKDFLHI...............KEK..........YNND......
ENSMLUP00000006192  KCHFDYNPY........ND.NLipckeagLKFSKGEILQI...............VNR..........EDPN......
ENSMLUP00000001660  RTNVSYSAA........HE.DDvpvpgmaISFEAKDFLHV...............KEK..........FNND......
ENSMLUP00000010880  RAQFDYDPKkdnlipc.KE.AG.......LKFATGDIIQI...............INK..........DDSN......
ENSMLUP00000010026  -------PV........QG.SG.......VNFEAKDFLHI...............KEK..........YSND......
ENSMLUP00000016306  KCHFDYNPY........ND.NLipckeagLKFSKGEILQI...............VNR..........EDPN......
ENSMLUP00000002731  RAQFEYDPA........KD.DLipckeagIRFRVGDIIQI...............ISK..........DDHN......
ENSMLUP00000012398  KCHFDYDPArdslipc.KE.AG.......LRFNAGDLLQI...............VNQ..........DDAN......
ENSMLUP00000007590  RALFDYDKT........KD.SGlpsqg..LNFKFGDILHV...............INA..........SDDE......
ENSMLUP00000001366  KALFDYDPN........ED.KAipckeagLSFKKGDILQI...............MSQ..........DDAM......
ENSMLUP00000005694  KAHFDYDPS........DD.PYvpcrelgLSFQKGDILHV...............ISQ..........EDPN......
ENSMLUP00000016016  RAMTEYWPQ........ED.PTipcaeagLPFQKGDILQV...............VDQ..........SDAL......
ENSMLUP00000013902  QALFDFDPQ........ED.GE.......LGFRRGDFIHV...............MDN..........SDPN......
ENSMLUP00000006692  VALYDYEAR........TE.DD.......LSFHKGEKFQI...............LNS..........SEGD......
ENSMLUP00000018425  RAMFDYDKS........KD.SGlpsqg..LSFKYGDILHV...............INA..........SDDE......
ENSMLUP00000002338  RALFDYDKT........DC.GFlsqa...LSFHFGDVLHV...............IDA..........SDEE......
ENSMLUP00000010190  RALFDYDRT........RD.SClpsqg..LSFSYGDILHV...............INA..........SDDE......
ENSMLUP00000002296  IAMYDYAAN........NE.DE.......LNFSKGQLINV...............LNK..........DDPD......
ENSMLUP00000013892  RAKFNFQQT........NE.DE.......LSFTKGDVIHV...............TRV..........EEGG......
ENSMLUP00000016474  IGMYDYTAQ........ND.DE.......LAFSKGQIINV...............LSK..........EDPD......
ENSMLUP00000004080  VALYDYESR........TE.TD.......LSFKKGERLQI...............VNN..........TEGD......
ENSMLUP00000013902  -AKYDFKAT........AD.DE.......LSFKRGDILKV...............LNEe.........CDQN......
ENSMLUP00000013066  KAVYDFKAQ........TS.KE.......LSFKKGDTVYI...............LRK..........IDQN......
ENSMLUP00000002474  RALFDFNGN........DE.ED.......LPFKKGDILKI...............RDK..........PEEQ......
ENSMLUP00000010063  VALFDYQAR........TE.ED.......LSFHAGDKLQV...............LDT..........SHEG......
ENSMLUP00000007412  VAIYDYTKD........KE.DE.......LSFQEGAIIYV...............IKK..........NDDG......
ENSMLUP00000011783  KVIFPYEAQ........ND.DE.......LTIKEGDIVTL...............INKdc........IDVG......
ENSMLUP00000007133  KARFNFKQT........NE.DE.......LSVCKGDIIYV...............TRV..........EEGG......
ENSMLUP00000005117  EALWDHVTM........DD.QE.......LGFKAGDVIQV...............LEA..........SNKD......
ENSMLUP00000005919  IALHSYEPS........HD.GD.......LGFEKGEQLRV...............LEQ..........-NGE......
ENSMLUP00000011432  VALYKFLPQ........EN.ND.......LALQPGDRIML...............VDD..........SNED......
ENSMLUP00000001119  RALYDFEPE........NE.GE.......LGFKEGDIITL...............TNQ..........IDEN......
ENSMLUP00000010330  KALYDFEPE........ND.GE.......LGFHEGDIITL...............TNQ..........IDEN......
ENSMLUP00000002843  VALYDYQAA........GD.DE.......ISFDPDDIITN...............IEM..........IDDG......
ENSMLUP00000011946  KALYSFQAR........QD.DE.......LDLEVGDIVTI...............HRK..........QEEG......
ENSMLUP00000002942  RALFHYNPR........ED.RAipcqeagLPFQRRQVLEV...............VSQ..........DDPT......
ENSMLUP00000008920  RALFAYEGT........NE.DE.......LTFKEGDIIHL...............ISKet........GETG......
ENSMLUP00000000496  QALYDFEAL........ED.DE.......LGFRSGEVVEV...............LDS..........SNPS......
ENSMLUP00000013320  QAQFDFSAQ........DP.SQ.......LSFRRGDIIEV...............LEH..........LDPH......
ENSMLUP00000017214  VALYDYESR........TE.TD.......LSFKKGERLQI...............VNNtrkvdv....REGD......
ENSMLUP00000021229  VAIYDYTKD........KD.DE.......LSFMEGAIIYV...............IKK..........NDDG......
ENSMLUP00000008092  VAIYDYTKD........KD.DE.......LSFMEGAIIYV...............IKK..........NDDG......
ENSMLUP00000001413  QALYPFSSS........ND.EE.......LNFEKGDVMDV...............LEKpe........NDPE......
ENSMLUP00000013669  SVIYPYTAR........DQ.DE.......MNLERGAVVEV...............IQK..........NLEG......
ENSMLUP00000002497  VARYDFCAR........DM.RE.......LSLLKGDVVKI...............YTKm.........SGNG......
ENSMLUP00000015970  RAIYDFEAA........ED.NE.......LTFKAGEIITV...............LDD..........SDPN......
ENSMLUP00000001413  YVKFNYMAE........RE.DE.......LSLIKGTKVIV...............MEK..........CSDG......
ENSMLUP00000015518  TALYSFEGQ........QP.GD.......LSFKAGDRITV...............TSKtd........SNFD......
ENSMLUP00000013530  VALYPYDGI........HP.DD.......LSFRKGEKMKV...............LEE..........-HGE......
ENSMLUP00000001958  VALYDYTAN........RS.DE.......LTIHRGDIIRV...............FYK..........DNED......
ENSMLUP00000011783  QVAFSYLPQ........ND.DE.......LELKVGDIIEV...............VGE..........VEEG......
ENSMLUP00000000207  KALYDYEGQ........TE.DE.......LSFPEGAIIRI...............LNKenq.......DDDG......
ENSMLUP00000007093  RALYDYQGE........GS.DE.......ISFDPDDIITD...............IEM..........VDEG......
ENSMLUP00000013066  IAKYNFNAD........TN.VE.......LSLRKGDRVIL...............LKR..........VDQN......
ENSMLUP00000003166  RALYDFEAV........ED.NE.......LTFKHGEIIIV...............LDD..........SDAN......
ENSMLUP00000007433  RAQEDYNAP........DC.RF.......INVKKGQQIYV...............YSKlvken.....EAGE......
ENSMLUP00000007981  FVKFAYVAE........RE.DE.......LSLVKGSRVTV...............MEK..........CSDG......
ENSMLUP00000005897  RVLFDYQPE........AP.DE.......LPLRKGDEVKV...............LRKtt........EDEG......
ENSMLUP00000005860  KALYNYEGK........EP.GD.......LKFSKGDIIIL...............RRQ..........VDEN......
ENSMLUP00000009512  RVVYDYKAQ........NS.DE.......LDISAGDILEV...............ILE..........GEDG......
ENSMLUP00000002296  RALYPFEAR........SH.DE.......MSFNSGDIIQV...............DEKtt........GEPG......
ENSMLUP00000007216  --KFDFQAQ........SP.KE.......LTLKKGDIVYI...............HKE..........VDKN......
ENSMLUP00000001866  EAVWDHVTM........AN.RE.......LAFKAGDVIKV...............LDA..........SNKD......
ENSMLUP00000003210  VALYKFVPQ........EN.ED.......LEMRPGDMITL...............LED..........SNED......
ENSMLUP00000008920  KVLFEYIPQ........ND.DE.......LELKVGDIIDI...............NDE..........VEEG......
ENSMLUP00000013622  RTLYDFLGN........DA.ED.......LPFKKGEILVI...............IEK..........PEEQ......
ENSMLUP00000007577  RALYTFEPR........TP.DE.......LYFEEGDIIYI...............TDM..........SDTS......
ENSMLUP00000007981  QTLYPFSSV........TE.EE.......LNFEKGETMEV...............IEKpe........NDPE......
ENSMLUP00000015831  TAVFEYEAA........GE.DE.......LTLRLGDVVEV...............LSKdsqvs.....GDEG......
ENSMLUP00000009890  RAVYDYSAA........DE.DE.......VSFQDGDTIVN...............VQQ..........IDDG......
ENSMLUP00000001358  EALHSFTAE........TS.DD.......LPFRRGERILI...............LQR..........LDSD......
ENSMLUP00000004195  RALYDYEGQ........EH.DE.......LSFKAGDELTK...............IEDe.........DEQG......
ENSMLUP00000007864  TALFDYEPN........GQ.DE.......LALRKGDRVEV...............LSRdaais.....GDEG......
ENSMLUP00000010897  RAMYDYSAQ........DE.DE.......VSFRDGDYIVN...............VQP..........IDDG......
ENSMLUP00000006579  VALYDFVAS........GD.NT.......LSITKGEKLRV...............LGYn.........QNGE......
ENSMLUP00000019391  VAIYDYTKD........KD.DE.......LSFMRVQSFYV...............IKK..........NDDG......
ENSMLUP00000001358  KALYDFHGD........NE.DE.......LSFKAGDTITE...............LES..........VDDD......
ENSMLUP00000005860  VAIYPYTPR........KE.DE.......LELRKGEMFLV...............FER..........CQDG......
ENSMLUP00000010009  RAKFDFKAQ........TL.KE.......LPLQKGDIVYI...............YKQ..........IDQN......
ENSMLUP00000016474  RALYPFESR........SH.DE.......ISIQPGDIVMV...............DESqt........GEPG......
ENSMLUP00000008018  VALYDFVAS........GD.NT.......LSITKGEKLRV...............LGYn.........HNGE......
ENSMLUP00000014609  VALYDFQAR........SN.RE.......VTMKKDDVLTL...............LSS..........INKD......
ENSMLUP00000009299  KALFDYKAQ........RD.DE.......LTFTKSAIIQN...............VEK..........QDGG......
ENSMLUP00000006831  LALYDYQEK........SP.RE.......VTMKKGDILTL...............LNS..........TNKD......
ENSMLUP00000003954  VALYDYMPM........NA.ND.......LQLRKGDEYFI...............LEE..........SNLP......
ENSMLUP00000011645  VAMYPFVAR........NS.HE.......VSLQAGQPVTV...............LEApdkk......GNPE......
ENSMLUP00000012000  VVVSNYKKQ........EN.SE.......LSLQAGEVVDV...............IEK..........NESG......
ENSMLUP00000013586  KALYDYKAK........QS.DE.......LSFCRGALIHN...............VSK..........EPGG......
ENSMLUP00000002296  IALYPYSSV........EP.GD.......LTFSEGEEILV...............TQK..........-DGE......
ENSMLUP00000010009  QALYSYIPQ........ND.DE.......LELRDGDIVDV...............MEK..........CDDG......
ENSMLUP00000007216  VAQYNFKGD........LE.VE.......LSFRKGERICL...............IRK..........VNEN......
ENSMLUP00000016474  QALYPWRAK........KD.NH.......LNFNKNDVITV...............LEQ..........-QDM......
ENSMLUP00000001012  KALCNYRGQ........NP.GD.......LRFNKGDVILL...............RRQ..........LDEN......
ENSMLUP00000017975  KALYDNVAE........SP.DE.......LSFRKGDIMTV...............LERdtq.......GLDG......
ENSMLUP00000018941  LALYTYKPQ........KS.DE.......LELRKGEMYCV...............LEK..........CQDG......
ENSMLUP00000005582  LARYSYNPFegpnen..PE.AE.......LPLTAGEYIYI...............YGNm.........DEDG......
ENSMLUP00000017787  VALYDYEAR........TT.ED.......LSFKKGERFQI...............INN..........TEGD......
ENSMLUP00000015689  RALYDNTAE........SP.QE.......LSFRQGDVLRV...............LQRegag......GLDG......
ENSMLUP00000002296  QALCSWTAK........KD.NH.......LNFSKHDVITV...............LEQ..........-QEN......
ENSMLUP00000008920  IVEYDYDAV........HD.DE.......LTIRVGEIIRN...............VKKl.........QEEG......
ENSMLUP00000012000  VTVQPYTSQ........SK.DE.......IGFEKGVTVEV...............IRK..........NLEG......
ENSMLUP00000004960  KALLDFERH........DD.DE.......LGFRKNDIITI...............ISQ..........KDEH......
ENSMLUP00000016474  VAMYTYESA........EQ.GD.......LTFQQGDVILV...............TKK..........-DGD......
ENSMLUP00000007216  RAVYQYRPQ........NE.DE.......LELREGDRVDV...............MQQ..........CDDG......
ENSMLUP00000018941  KALYSYEGK........EP.GD.......LKFNKGDVIIL...............RRR..........VDEH......
ENSMLUP00000007615  YALWSYEAQ........NS.DE.......LSFREGDAITI...............LRRkde.......HETQ......
ENSMLUP00000017501  VVVANYQKQ........ES.SE.......ISLSVGQVVDI...............IEK..........NESG......
ENSMLUP00000005582  VAAFDYNPResspnmd.VE.AE.......LPFRAGDIITV...............FGGm.........DDDG......
ENSMLUP00000013066  QALYNYTPR........NE.DE.......LELRESDVIDV...............MEK..........CDDG......
ENSMLUP00000004531  VALYRFKAL........EK.DD.......LDFPPGEKITV...............IDD..........SNEE......
ENSMLUP00000014222  IAVGDFIAQ........QA.GD.......LTFKKGEILLI...............IEK..........HPDG......
ENSMLUP00000001012  VALHSYSAH........GP.DE.......LDLQRGEGIRV...............LGK..........YQDG......
ENSMLUP00000011016  RVLYDYDAA........NS.SE.......LSLLADEVITV...............FSVvg........MDSD......
ENSMLUP00000014075  VAIFSYEAT........QP.ED.......LEFLEGDIIQV...............VSMa.........VNDE......
ENSMLUP00000016089  RALYDYAGQ........EA.DE.......LSFRAGEELLK...............MSEe.........DEQG......
ENSMLUP00000014075  RVLFGFVPE........TP.EE.......LHVQPGNIVFV...............LKK..........GSDN......
ENSMLUP00000010551  HVVKRYTAQ........AP.DE.......LSFEVGDIVSV...............IDMppt.......EDRS......
ENSMLUP00000011784  VTLYPYTGQ........KD.NE.......LSFSEGTVICI...............TRR..........HSDG......
ENSMLUP00000016474  QVIASYTAT........GP.EQ.......LTLAPGQLILI...............RKK..........NPGG......
ENSMLUP00000014409  IALYDYQTN........DP.QE.......LTLQRNDEYYL...............LDS..........SEIH......
ENSMLUP00000013262  VGLWDFKAR........TN.EE.......LSFRAGDLFHV...............ARK..........-EEE......
ENSMLUP00000014923  TAVFDYEVT........GD.EE.......LTLRRGDRVQV...............LSQdcavs.....GDEG......
ENSMLUP00000004002  QVLFEFEAR........NP.KE.......LTVAPGEVVEV...............LDH..........-SKR......
ENSMLUP00000020771  TAVFDYEVT........GD.EE.......LTLRRGDRVQV...............LSQdcavs.....GDEG......
ENSMLUP00000007028  MALYDFLPR........EP.CD.......LALKRAEEYLI...............LEK..........HDTH......
ENSMLUP00000010009  IAKFNFNGD........TQ.VE.......MSFRKGERITL...............LRQ..........VDEN......
ENSMLUP00000018941  RVVVSYPPQ........SE.AE.......IELKEGDIVFV...............HKK..........REDG......
ENSMLUP00000010822  IAIKDYCPN........NF.TT.......LKFSKGDHLYV...............LDT..........SGGE......
ENSMLUP00000015288  YALWDYEPQ........NE.DE.......LPMKEGDCMTV...............LRR..........EDEDeve...
ENSMLUP00000013669  VVVANYQKQ........ES.SE.......ISLSVGQVVDI...............IEK..........NESG......
ENSMLUP00000022476  VAMYDFQAT........EA.HD.......LRLERGQEYII...............LEK..........NDVH......
ENSMLUP00000011542  FAVYTFKAR........NP.NE.......LSVSANQRLKI...............LDFkdvt......GNTE......
ENSMLUP00000011542  IALYRFQAL........EP.NE.......LDFEVGDKIRI...............LGT..........LEDG......
ENSMLUP00000016384  EALHDFEAA........NS.DE.......LTLQRGDVVLV...............VPSdsead.....QDAG......
ENSMLUP00000005860  RVVVSYPPQ........SE.AE.......LELKEGDIVFV...............HKK..........REDG......
ENSMLUP00000003137  RAMYDYMAA........DA.DE.......VSFKDGDAIVN...............VQA..........IDEG......
ENSMLUP00000016884  LVRYSYNPFegpneh..PE.TE.......LPLTAGEYVYI...............FGEm.........DEDG......
ENSMLUP00000015858  QCVHPYVAQ........QP.DE.......LTLELADILNI...............LDK..........TEDG......
ENSMLUP00000012406  IAKYNFHGT........AE.QD.......LPFCKGDVLTI...............VAVt.........KDPN......
ENSMLUP00000009292  RALYNNDPD........CS.DE.......LAFCKGDILTI...............LEQhvp.......ESEG......
ENSMLUP00000001413  VAKFDYVAQ........QE.QE.......LDIKKNERLWL...............LDD..........-SKS......
ENSMLUP00000012000  MTCSAYQKV........QD.SE.......ISFPAGVEVQV...............LEK..........LESG......
ENSMLUP00000007949  RALYSYTGQ........SA.EE.......LSFPEGALIRL...............LPRaqdg......VDDG......
ENSMLUP00000001358  VILHDFPAE........QV.GD.......LNLTSGEIVYL...............LEK..........IDTD......
ENSMLUP00000005582  VALFDYDPVsmspnpdaGE.EE.......LPFREGQILKV...............FGDk.........DADG......
ENSMLUP00000012019  RALYDNVPE........CA.EE.......LAFRKGEILTV...............IEQntg.......GLEG......
ENSMLUP00000007621  IALYDYEAI........HH.ED.......LSFQKGDQMAV...............LEE..........-SGE......
ENSMLUP00000000109  KAIYPFDGH........NE.GT.......LAMKEGEVLYI...............IEEd.........KGDG......
ENSMLUP00000012976  VACFSYTGR........TA.KE.......LTFQRGDVLRL...............HER..........ASDD......
ENSMLUP00000010504  QCLRAYKPR........EN.DE.......LALEKADVVMV...............TQQ..........SSDG......
ENSMLUP00000007384  RAVYPCEAE........HS.SE.......LSFEIGAIFED...............VQTs.........REPG......
ENSMLUP00000002099  EIIRSFTAK........QP.DE.......LSLQVADVVLI...............YQR..........VSDG......
ENSMLUP00000010226  RVLYDYEAA........DS.SE.......LALLADELITV...............YSLpg........MDPD......
ENSMLUP00000001012  RALYNFDLRnkdknd..NQ.DC.......LTFLKDDIITV...............ISR..........VDEN......
ENSMLUP00000012000  YTIAEFQSC........IS.DG.......ISFRGGQKAVV...............IDK..........NSGG......
ENSMLUP00000014043  RALYDYKKE........RE.ED.......IDLHLDDILTVnkgslvalgfsdgqeARP..........EEIG......
ENSMLUP00000017916  KALYACKAE........HD.SE.......LSFIAGTVFDN...............VHPs.........QEPG......
ENSMLUP00000002503  IAKFDYVGR........TA.RE.......LSFKKGASLLL...............YQR..........ASDD......
ENSMLUP00000009446  IAKFDYVGR........SP.RE.......LSFKKGASLLL...............YHR..........ASED......
ENSMLUP00000013179  QGLWDCTGA........LS.DE.......LSFKRGDVIYI...............LSKey........NRYG......
ENSMLUP00000006973  VAIADYSAT........DE.TQ.......LSFLRGEKILI...............LRQ..........TTAD......
ENSMLUP00000013630  QCVRTYKAL........QP.DE.......LTLEKTDILAV...............RTR..........TSDG......
ENSMLUP00000012141  RVLYDFAAEp.......GN.NE.......LTVTEGEIITI...............TNPd.........VGGG......
ENSMLUP00000013669  YTIAEFQTT........IP.DG.......ISFQAGLKVEV...............IEK..........NLSG......
ENSMLUP00000006358  KALYTFDGQ........NE.GT.......ISVVEGETLYV...............IEEd.........KGDG......
ENSMLUP00000002296  QVTSAYVAS........GS.EQ.......LSLAPGQLILI...............LKK..........NASG......
ENSMLUP00000006507  HVIKRYTAR........AP.DE.......LTLEVGDIVSV...............IDMppk.......VLST......
ENSMLUP00000011422  ---------........--.--.......-----------...............--K..........YNND......
ENSMLUP00000008265  KTIYDCQAD........NE.DE.......LTFIEGEVIIV...............TGE..........EDQE......
ENSMLUP00000011428  IAKFDYVGR........SA.RE.......LSFKKGASLLL...............YHR..........ASED......
ENSMLUP00000002679  ---------........GN.RE.......LQVKPGESLEV...............IQN..........TDDT......
ENSMLUP00000018941  KALYDFEMKdrdq....DQ.DC.......LTFTKDEILTV...............IRR..........VDDN......
ENSMLUP00000005860  KALYDFEVKdkea....DK.DC.......LPFAKDDVLTV...............IRR..........VDEN......
ENSMLUP00000011542  RALMGLSAQ........LD.EE.......LDFREGDVITI...............IGV..........PEPG......
ENSMLUP00000020371  YAVHAFEAR........SN.CE.......LSLQEYQRVHI...............LRFcdls......GNKE......
ENSMLUP00000011542  QADRNFNAA........QD.LD.......VSLLEGDLVGV...............IKKkdpm......GSPN......
ENSMLUP00000000496  IAKFDFTAS........GE.DE.......LSFHTGDTLKI...............LSN..........-QEE......
ENSMLUP00000010676  CASQAYEGS........RA.DE.......LSVPAGARVRV...............LEM..........SDRG......
ENSMLUP00000011698  LAMRDYRGP........DC.LY.......LNFTKGEEISV...............YVKlag.......ERED......
ENSMLUP00000009701  RALYDFHSE........NK.EE.......INIQQGEDLVI...............FSEn.........SLDG......
ENSMLUP00000004596  QGLWDCHGD........QP.DE.......LSFQRGDLIRI...............LSKeh........NMYG......
ENSMLUP00000020371  QAKRKCNAT........QE.YD.......INLLEGELVAV...............MEQkdpl......GSTS......
ENSMLUP00000000207  KVVYSYKAS........QP.DE.......LTIEEHEVLEV...............IEDg.........DMED......
ENSMLUP00000014421  KSKYDFAAR........NN.SE.......LSVQKDSILEI...............LDD..........-RKQ......
ENSMLUP00000013929  RALKDFWNLh.......DP.TA.......LNVRAGDVITV...............LEQ..........HPDG......
ENSMLUP00000003615  RALYPFRRE........RP.ED.......LELLPGDVLVV...............SRA..........ALQGlgvaeg
ENSMLUP00000019445  RVHTDFTPSpy......DT.DS.......LKLKKGDIIDI...............ISK..........PPMG......
ENSMLUP00000003921  RATQDYCNNy.......DL.TS.......LNVKAGDIITV...............LEQ..........HPDG......
ENSMLUP00000002679  ---------........GK.NE.......LSFKQGEPIEI...............IRLtd........NPEG......
ENSMLUP00000001797  RVHTDFTPSpy......DH.DS.......LKLQKGDVIQI...............IEK..........PPVG......
ENSMLUP00000007922  KALCHHLAT........GP.GQ.......LSFHKGDVLRV...............LGP..........AGGD......
ENSMLUP00000016884  VALFDYEPLvmsanpeaAE.EE.......LAFQKGQLLRV...............WGSq.........DTHG......
ENSMLUP00000021898  RAEYDFAAL........SE.EE.......ISFRAGDMLNL...............ALKaeqqp.....RVRG......
ENSMLUP00000018532  ---------........--.KH.......LGIRRGEILEV...............IEF..........TNKE......
ENSMLUP00000006141  ---------........--.KH.......LGIRRGEILEV...............IEF..........TNKE......
ENSMLUP00000012243  RALCDHTAA........GP.DQ.......LSFQRGEVLRV...............IAT..........VDED......
ENSMLUP00000007949  HVVFGYQAG........HE.DE.......LTITEGEWLEV...............LEEg.........DADE......
ENSMLUP00000010409  EVEYDYEYE........AK.DRk......IVIRQGERYIL...............VKK..........TNDD......
ENSMLUP00000000120  RALFQYKPQ........NV.DE.......LTLSPGEYIFV...............DPTqqee......ASEG......
ENSMLUP00000002448  QVIYPYTPQ........ND.DE.......LELVPGDFIFM...............SPVeqas......TSEG......
ENSMLUP00000006631  KAMYSCQAE........HS.HE.......LSFPQGALFSN...............VYPs.........VEPG......
ENSMLUP00000013267  RALCDFTAR........YA.DE.......LSVSRGDRLYA...............LKE..........-EGD......
ENSMLUP00000002140  AVIKDYYAL........KE.NE.......ICVSQGEVVQV...............LAV..........NQQN......
ENSMLUP00000009401  RVHTDFTPSpy......DT.DS.......LKLKKGDIIDI...............ISK..........PPMG......
ENSMLUP00000011645  QVTSNTSGS........RT.LD.......LSLPRGQIVGL...............LQNkdtk......GNSS......
ENSMLUP00000000142  ---------........--.--.......LRLNPGDIVEL...............TKAe.........AEQN......
ENSMLUP00000013622  --------Y........DK.TA.......LALEVGDIVKV...............TRM..........NING......
ENSMLUP00000002497  QVIKNYAGTpppaph..AG.PP.......LHIQAGDTVEL...............LRGd.........AHSL......
ENSMLUP00000013669  VAVANFEGD........ED.AS.......-SFQEGTVFEV...............REK..........NSSG......
ENSMLUP00000008144  VAIYHFEGS........SE.GT.......ISMAEGEDLSL...............MEEd.........KGDG......
ENSMLUP00000004680  KTIFPHTAG........T-.NQ.......LGFEQGDVITL...............LVAe.........ERDG......
ENSMLUP00000010492  RAILPYTKVp.......DT.DE.......ISFLKGDMFIV...............HNE..........LEDG......
ENSMLUP00000011542  VCICEFTSQ........EP.NS.......LPLYRGDLVIL...............DGA..........PTAG......
ENSMLUP00000000726  LVTHDYTAV........KE.DE.......INVYQGEVVQI...............LAS..........NQQN......
ENSMLUP00000016884  -------GQ........AK.GK.......LSLKAGDLVTV...............YGPv.........DDRG......
ENSMLUP00000002474  RVIQKRVPNay......DK.TA.......LALEVGELVKV...............TKI..........NVNG......
ENSMLUP00000013417  RAIFRFVPR........HE.DE.......LELEVDDPLLV...............ELQ..........AEDY......
ENSMLUP00000012000  VSIADYEGD........EE.TA.......-GFQEGVSMEV...............LER..........NPNG......
ENSMLUP00000001859  ---YNYDAR........GV.DE.......LSLQIGDTVHI...............LET..........-YEG......
ENSMLUP00000016646  ----DNSAL........DE.DE.......VSFQDEDIIVS...............VQQ..........IGDS......
ENSMLUP00000009616  TVVVDDEKG........SP.NT.......LAVRSGDVVEV...............VQE..........GEEG......
ENSMLUP00000010476  RALYDRLAE........VE.HE.......LSFKKDDILYV...............DDT..........LPQGtfg...
ENSMLUP00000003844  RVHTDFTPSpy......DT.DS.......LKIKKGDIIDI...............ICK..........TPMG......
ENSMLUP00000012979  ---------........--.-D.......LPITPGEELDV...............IDV..........TEEN......
ENSMLUP00000010870  RALYDYQAA........DK.TE.......ISFDPKNLITA...............SKR..........----......
ENSMLUP00000004205  ITKCEHTRP........KP.GE.......LAFHKGDMVTI...............LEAc.........ESKS......
ENSMLUP00000000726  VVIHDFTAC........NS.TE.......LTIRRGQTVEV...............LERph........DKPD......
ENSMLUP00000008845  VALGSFPVG........EQ.AE.......LSLRLGEPLTI...............ISE..........-DGD......
ENSMLUP00000012305  KALYAYDAQ........DT.DE.......LSFNANDIIDI...............IKE..........D---......
ENSMLUP00000000937  CALYAFTYT........AA.DGrq.....VSMAEGDRFLL...............IRK..........TNSD......
ENSMLUP00000002140  VVLQDFNAG........HS.SE.......LTIQVGQTVEL...............LERps........ERPG......
ENSMLUP00000016537  RALQDFE--........EP.DK.......LHIQMNDVITV...............IEGr.........AENY......
ENSMLUP00000015982  RALQDFE--........EP.DK.......LHIQMNDVITV...............IEGr.........AENY......
ENSMLUP00000009378  KAWKDYERE........EK.DE.......LDLRQGESIEI...............VGFvi........PGLQ......
ENSMLUP00000001358  GAQFEYIGD........QK.DV.......LSFLEGESIVP...............NEY..........VNEE......
ENSMLUP00000010676  HCLQPFSTQ........DT.RGqp.....FHAQAQEALDV...............LLR..........HPSG......
ENSMLUP00000011918  -VIASFRGT........VP.YG.......LSLEIGDTVQI...............LEK..........-CDG......
ENSMLUP00000006188  ---------........--.--.......-----------...............---..........-SSG......
ENSMLUP00000004439  RTHFEYEKE........SP.YG.......LSFNKGEVFRV...............VDTlyng......KLGS......
ENSMLUP00000004210  IAIYPHQPR........TA.DE.......IPMEPGDIIGV...............AGN..........HWDG......
ENSMLUP00000015169  VALQDNPNP........AG.EEsgf....LSFAKGDLIIL...............DHDtgeqv.....MNSG......
ENSMLUP00000013320  VALYSFQAT........ES.DE.......LAFNKGDTLKI...............LNMe.........DDQN......
ENSMLUP00000000142  KVRYDFCAR........DR.SE.......LNLKEGDIVKI...............LNKk.........GQQG......
ENSMLUP00000006936  --TCSFRGS........VP.QG.......LVLEIGETVQI...............LEK..........-CEG......
ENSMLUP00000010147  ---FECEKE........TP.QS.......LAFTRGEIFRV...............VDTlydg......KLGH......
ENSMLUP00000009801  --HFELEPS........PP.YG.......LGFTRGDVFHV...............LDTlypgpgqghaRGGQ......
ENSMLUP00000018134  ---------........--.EK.......LKFEKGETVKV...............IEKpg........NDQE......
ENSMLUP00000016407  VALYDYVAV........ND.RD.......LQMLKGEKLQI...............LKE..........-SGD......
ENSMLUP00000010152  ---------........--.--.......--FRRGEKLRV...............ISD..........-EGG......
ENSMLUP00000009378  --------Q........EG.EC.......LTLGEGELISV...............KTA..........DGGS......
ENSMLUP00000020593  ---------........--.--.......-----------...............---..........-EGG......
ENSMLUP00000019238  ---------........--.EK.......LKFEKGETVKV...............IEKpg........NDQE......
ENSMLUP00000001358  ---------........NP.GE.......LSCKRGDGLVL...............LKQ..........AENN......
ENSMLUP00000000215  RAIADYEKS........SG.TE.......MALAMGDVVDV...............VEK..........G---......
ENSMLUP00000004531  RVTRSFVGN........REiGQ.......ITLKKDQIVVQ...............KGD..........EAGG......
ENSMLUP00000001760  ---------........-E.PR.......IPLQKGEFILA...............TRG..........-LRY......


                               50                    60        70        80        90       100     
                                |                     |         |         |         |         |     
d1ng2a2               .........WWVIRK..........DDV..TGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRL
ENSMLUP00000003159  .........WWIGRLvke.......GCE..IGFIPSP-----------------------------------------
ENSMLUP00000006192  .........WWQASHvke.......GGS..AGLIPSQFLEEKRKAFV-------------------------------
ENSMLUP00000001660  .........WWIGRLvke.......GCE..IGFIPSP-----------------------------------------
ENSMLUP00000010880  .........WWQGRVegss......KES..AGLIPSPELQEWRVASVAQSAPSEAPSCSPFGKKK-------------
ENSMLUP00000010026  .........WWIGRLvke.......GGD..IAFIPSP-----------------------------------------
ENSMLUP00000016306  .........WWQASHvke.......GGS..AGLIPSQFLEEKRKAFV-------------------------------
ENSMLUP00000002731  .........WWQGKLensk......NGT..AGLIPSPELQEWR-----------------------------------
ENSMLUP00000012398  .........WWQACHve........GGS..AGLIPSQLLEEKRKA---------------------------------
ENSMLUP00000007590  .........WWQARQvtpdge....SDE..VGVIPS------------------------------------------
ENSMLUP00000001366  .........WWQAKHegda......NPR..AGLIPSKHFQERRLALRRPEII--------------------------
ENSMLUP00000005694  .........WWQAYRdgdedn....QPL..AGLVP-------------------------------------------
ENSMLUP00000016016  .........WWQARKvsal......GTC..AGLIPSSHLLKRKQREFWWSQPYQPHTH--------------------
ENSMLUP00000013902  .........WWKGAC..........HGQ..TGMFPRNY----------------------------------------
ENSMLUP00000006692  .........WWEARSlt........TGE..TGYIPSNYVAPVDSIQ--------------------------------
ENSMLUP00000018425  .........WWQARRvtldgd....SEE..MGVIPS------------------------------------------
ENSMLUP00000002338  .........WWQARRvhsdse....TDD..IGFIPS------------------------------------------
ENSMLUP00000010190  .........WWQARLvtphge....SEQ..IGVIPS------------------------------------------
ENSMLUP00000002296  .........WWQGEI..........NGA..TGLFPSNYVKMTT-----------------------------------
ENSMLUP00000013892  .........WWEGTH..........NGR..TGWFPSNYVREIKPSEKPVSPKSG------------------------
ENSMLUP00000016474  .........WWKGEV..........GGH..VGLFPSNYVKLTTDTDPS------------------------------
ENSMLUP00000004080  .........WWLAHSls........TGQ..TGYIPSNYVAPSDSI---------------------------------
ENSMLUP00000013902  .........WYKAEL..........NGK..DGFIPKNY----------------------------------------
ENSMLUP00000013066  .........WYEGEH..........HGR..VGIFPISYVEKLSPPEKAQPARPPPPA---------------------
ENSMLUP00000002474  .........WWNAEDm.........EGK..RGMIPVPYVEKYRPVPASVSAM--------------------------
ENSMLUP00000010063  .........WWFARLlerrgassg.QQL..EGYIPSNYVAEDRSL---------------------------------
ENSMLUP00000007412  .........WYEGVM..........NGV..TGLFPGNYVE--------------------------------------
ENSMLUP00000011783  .........WWEGEL..........NGR..RGVFPDNFVKLLPPDFEKEGNRPKKPPPPSAPVI--------------
ENSMLUP00000007133  .........WWEGTL..........NGR..TGWFPSNYVREIKSSERPLSPKA-------------------------
ENSMLUP00000005117  .........WWWGRS..........EEK..EAWFPASFVRLRV-----------------------------------
ENSMLUP00000005919  .........WWKAQSlt........TGQ..EGFIPFNFVAKANSLEPEP-----------------------------
ENSMLUP00000011432  .........WWKGKI..........GDR..VGFFPANFVQRVRP----------------------------------
ENSMLUP00000001119  .........WYEGML..........HGQ..SGFFPINYVEI-------------------------------------
ENSMLUP00000010330  .........WYEGML..........HGQ..SGFFPLSYVEVL------------------------------------
ENSMLUP00000002843  .........WWRGLC..........KGR..YGLFPANYVE--------------------------------------
ENSMLUP00000011946  .........WWFGSL..........NGK..KGHFPAAYVQELPS----------------------------------
ENSMLUP00000002942  .........WWQAKRvgdt......NLR..AGLIPSKQFQERQ-----------------------------------
ENSMLUP00000008920  .........WWKGEL..........NGK..EGVFPDNFAVQLNELDKDFPKPKKPPPPAKGP----------------
ENSMLUP00000000496  .........WWTGRL..........HNK..LGLFPANYVAP-------------------------------------
ENSMLUP00000013320  .........WWRGRF..........CGQ..VGFFPRSYVQPV------------------------------------
ENSMLUP00000017214  .........WWLAHSls........TGQ..TGYIPSNYVAPSDSI---------------------------------
ENSMLUP00000021229  .........WYEGVC..........NRV..TGLFPGNYVE--------------------------------------
ENSMLUP00000008092  .........WYEGVC..........NRV..TGLFPGNYVE--------------------------------------
ENSMLUP00000001413  .........WWKCRKi.........NGM..VGLVPKNYVTIMQNNPLTSGLEPSP-----------------------
ENSMLUP00000013669  .........WWKIRY..........QGK..EGWAPASYLKKSSGEPSSLKLGPGSPAHTGVLDLDGVSRPQNLGGR--
ENSMLUP00000002497  .........WWRGEA..........NGK..VGWFPSTYVEV-------------------------------------
ENSMLUP00000015970  .........WWKGET..........HQG..MGLFPSNFVT--------------------------------------
ENSMLUP00000001413  .........WWRGSY..........NGQ..VGWFPSNYVTEEGD----------------------------------
ENSMLUP00000015518  .........WWEGRL..........RGQ..TGIFPANYVT--------------------------------------
ENSMLUP00000013530  .........WWKAKSls........TKR..EGFIPSNYVAKVNTLE--------------------------------
ENSMLUP00000001958  .........WWYGSLg.........KGQ..EGYFPANHVA--------------------------------------
ENSMLUP00000011783  .........WWEGVL..........NGK..TGMFPSNFIKELSGE---------------------------------
ENSMLUP00000000207  .........FWEGEF..........SGR..IGVFPSVLVEELPASENGDAPGMREIRISPSPKPP-------------
ENSMLUP00000007093  .........WWRGRC..........HGH..FGLFPANYVN--------------------------------------
ENSMLUP00000013066  .........WYEGKIpg........TNR..QGIFPVSYVEVVKRNTAKGAEDYPDPPIPHSYSSDRIHSLS-------
ENSMLUP00000003166  .........WWKGEN..........HRG..IGLFPSNFVT--------------------------------------
ENSMLUP00000007433  .........FWAGSVygddhede..MGT..VGYFPRNLVEEQH-----------------------------------
ENSMLUP00000007981  .........WWRGSY..........NGQ..IGWFPSNYVL--------------------------------------
ENSMLUP00000005897  .........WWEGES..........QGR..RGVFPDNFVLP-------------------------------------
ENSMLUP00000005860  .........WYHGEV..........NGI..HGFFPTNFVQIIKPLPQPP-----------------------------
ENSMLUP00000009512  .........WWTVEQ..........NGQ..RGFVPGSYLE--------------------------------------
ENSMLUP00000002296  .........WLYGSF..........QGK..FGWFPCNYVEKMPSSEKS------------------------------
ENSMLUP00000007216  .........WLEGEH..........HGR..LGIFPANYVEVLPADEIPKPHKP-------------------------
ENSMLUP00000001866  .........WWWGQI..........DDE..EGWFPASFVRLWVNQ---------------------------------
ENSMLUP00000003210  .........WWKGKI..........QDR..IGFFPANFVQRVQ-----------------------------------
ENSMLUP00000008920  .........WWSGTL..........NNK..LGLFPSNFVKELE-----------------------------------
ENSMLUP00000013622  .........WWSARNk.........DGR..IGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEP--------------
ENSMLUP00000007577  .........WWKGTS..........KGR..TGLIPSNYVAEQ------------------------------------
ENSMLUP00000007981  .........WWKCKNa.........RGQ..VGLVPKNYVVVLSDGPVLPPSHVPQISYPGP-----------------
ENSMLUP00000015831  .........WWTGQL..........NQR..VGIFPSNYVTPRSAFSSRCQPGGEDP----------------------
ENSMLUP00000009890  .........WMYGTVer........TGD..TGMLPANYVE--------------------------------------
ENSMLUP00000001358  .........WYKGRL..........RDR..EGIFPAVFVRPCPADM--------------------------------
ENSMLUP00000004195  .........WCKGRLd.........NGQ..VGLYPANYVEA-------------------------------------
ENSMLUP00000007864  .........WWAGQV..........GGQ..VGIFPSNYVSRGGP----------------------------------
ENSMLUP00000010897  .........WMYGTVqr........TGK..TGMLPANYIEF-------------------------------------
ENSMLUP00000006579  .........WSEVRS..........KNG..QGWVPSNYITPVNSLEKHS-----------------------------
ENSMLUP00000019391  .........WYEGVY..........NRV..TGLFPGNYVE--------------------------------------
ENSMLUP00000001358  .........WMSGEL..........MGK..SGIFPKNYVQV-------------------------------------
ENSMLUP00000005860  .........WFKGTSmh........TSK..IGVFPGNYVAPVTS----------------------------------
ENSMLUP00000010009  .........WYEGEH..........HGR..VGIFPRTYIELLPPAEKAQ-----------------------------
ENSMLUP00000016474  .........WLGGEL..........KGK..TGWFPANYAEKIPENEVPAPAKP-------------------------
ENSMLUP00000008018  .........WCEAQT..........KNG..QGWVPSNYITPVNSLEKHS-----------------------------
ENSMLUP00000014609  .........WWKVEH..........EDH..QGFVPAVYVRKLAHDEFPTLPQRWREEPGSITQ---------------
ENSMLUP00000009299  .........WWRGDYg.........GKK..QLWFPSNYVEEM------------------------------------
ENSMLUP00000006831  .........WWKVEV..........NDR..QGFVPAAYVKKLDP----------------------------------
ENSMLUP00000003954  .........WWRARDk.........NGQ..EGYIPSNYVTE-------------------------------------
ENSMLUP00000011645  .........WSLVEV..........DGR..RGYVPSSFLARAPSP---------------------------------
ENSMLUP00000012000  .........WWFVST..........SEE..QGWVPATYLEA-------------------------------------
ENSMLUP00000013586  .........WWKGDYg.........TKI..QHYFPSNYVEDIST----------------------------------
ENSMLUP00000002296  .........WWTGSI..........GDR..TGIFPSNYVKPKD-----------------------------------
ENSMLUP00000010009  .........WFVGTSrr........TRQ..FGTFPGNYVKPL------------------------------------
ENSMLUP00000007216  .........WYEGRIsg........TGR..QGIFPVSYVQVSREPRLRLCDEGPQLPA--------------------
ENSMLUP00000016474  .........WWFGEV..........QGQ..KGWFPKSYVKLISGPTRKAASP--------------------------
ENSMLUP00000001012  .........WYQGEI..........NGV..SGFFPASSVEVIKQLPQPP-----------------------------
ENSMLUP00000017975  .........WWLCSL..........HGR..QGIVPGNRLKILVGMHDKKPAGPGPGPP--------------------
ENSMLUP00000018941  .........WFKGTSlr........SGL..SGVFPGNYVTPASS----------------------------------
ENSMLUP00000005582  .........FFEGELm.........DGR..RGLVPSNFVERVSDD---------------------------------
ENSMLUP00000017787  .........WWEARSia........TGK..NGYIPSNYVAP-------------------------------------
ENSMLUP00000015689  .........WCLCSL..........HGQ..QGIVPANRVKLLPDGPAPKPSLSQVPPA--------------------
ENSMLUP00000002296  .........WWFGEV..........HGG..RGWFPKSYVKIIPG----------------------------------
ENSMLUP00000008920  .........WLEGEL..........NGR..RGMFPDNFVKEIKR----------------------------------
ENSMLUP00000012000  .........WWYIRY..........LGK..EGWAPASYLKKAKDDLPARKKNLA------------------------
ENSMLUP00000004960  .........CWVGEL..........NGL..RGWFPAKFVEVLDER---------------------------------
ENSMLUP00000016474  .........WWTGTV..........GDK..SGVFPSNYVRL-------------------------------------
ENSMLUP00000007216  .........WFVGVSrr........TQK..FGTFPGNYVAP-------------------------------------
ENSMLUP00000018941  .........WFHGEL..........RGT..HGFLPASYVQCLRPLPPT------------------------------
ENSMLUP00000007615  .........WWWARL..........GDR..EGYVPRNLLGLCPR----------------------------------
ENSMLUP00000017501  .........WWFVST..........AEE..QGWVPATCLE--------------------------------------
ENSMLUP00000005582  .........FYYGEL..........NGQ..RGLVPSNFLE--------------------------------------
ENSMLUP00000013066  .........WFVGTSrr........TKF..FGTFPGNYVK--------------------------------------
ENSMLUP00000004531  .........WWRGKI..........GEK..VGFFPPNFII--------------------------------------
ENSMLUP00000014222  .........WWMAKNa.........KGN..KGLVPRTYLEPH------------------------------------
ENSMLUP00000001012  .........WLKGVSlv........TGR..VGIFPNNYVIPI------------------------------------
ENSMLUP00000011016  .........WLMGER..........GNQ..KGRVPITYLEL-------------------------------------
ENSMLUP00000014075  .........WLEGEC..........KGK..FGIFPKAFVEERAA----------------------------------
ENSMLUP00000016089  .........WCQGQLq.........SGR..IGLYPANYVE--------------------------------------
ENSMLUP00000014075  .........WATVMF..........NGQ..KGLVPCNFLEPVELRIQPQQQPQDD-----------------------
ENSMLUP00000010551  .........WWRGKR..........GFQ..VGFFPSECVELFTERPCPGLKGDADGLLCGVPAPQGVSSL--------
ENSMLUP00000011784  .........WCEGVT..........SEG..TGFFPGNYVAP-------------------------------------
ENSMLUP00000016474  .........WWEGELqargk.....KRQ..IGWFPANYVKLLSPGT--------------------------------
ENSMLUP00000014409  .........WWRVQDk.........NGH..EGYVPSSYLVEKSA----------------------------------
ENSMLUP00000013262  .........WWWATLldae......GGAlaEGYVPHNYLAERETVESEP-----------------------------
ENSMLUP00000014923  .........WWTGRLp.........GGR..VGVFPSDYVAPP------------------------------------
ENSMLUP00000004002  .........WWLVKDq.........TGD..SGYVPSNILEPLQSGPSGRQSPALRAPMLRL-----------------
ENSMLUP00000020771  .........WWTGRLp.........GGR..VGVFPSDYVAPP------------------------------------
ENSMLUP00000007028  .........WWKARDr.........WGN..EGFIPSNYVAE-------------------------------------
ENSMLUP00000010009  .........WYEGRIpg........TTR..QGIFPITYVDVIKRPLVKNRVDYIDLPYSSPSR---------------
ENSMLUP00000018941  .........WYKGTLqr........NGR..TGLFPGSFVE--------------------------------------
ENSMLUP00000010822  .........WWYAHN..........TTE..MGYIPSSYVQPL------------------------------------
ENSMLUP00000015288  .........WWWARL..........NDK..EGYVPRNLLGLYP-----------------------------------
ENSMLUP00000013669  .........WWFVST..........AEE..QGWVPATCLE--------------------------------------
ENSMLUP00000022476  .........WWRARDk.........YGS..EGYIPSNYVT--------------------------------------
ENSMLUP00000011542  .........WWLAEV..........NGK..KGYVPSNYIRK-------------------------------------
ENSMLUP00000011542  .........WLEGSL..........KGR..TGIFPYRFVNLCPKT---------------------------------
ENSMLUP00000016384  .........WLVGVKesdwlqyrdlATY..KGLFPENFTQR-------------------------------------
ENSMLUP00000005860  .........WFKGTLq.........RNK..TGLFPGSFVE--------------------------------------
ENSMLUP00000003137  .........WMYGTVqr........TGR..TGMLPANYVE--------------------------------------
ENSMLUP00000016884  .........FYEGELe.........DGR..RGLVPSNLVVQIPD----------------------------------
ENSMLUP00000015858  .........WIFGERlh........DQE..RGWFPSNMTEEI------------------------------------
ENSMLUP00000012406  .........WYKAKNk.........VGR..EGIIPANYVQKREGVKVGTKLSLMPWFHGKITR---------------
ENSMLUP00000009292  .........WWRCLL..........HGR..QGLAPANRLQILSGAPADSPCPP-------------------------
ENSMLUP00000001413  .........WWRVRNs.........VNK..TGFVPSNYVER-------------------------------------
ENSMLUP00000012000  .........WWYVRF..........GEL..EGWAPSHYLVLGENEPPDPSGKEPDAVTAKSKQKEGKSDSLEKIEKRV
ENSMLUP00000007949  .........FWRGEF..........GGH..VGVFPSLLVEELLGPLGPSESSDPEQMLPSP-----------------
ENSMLUP00000001358  .........WYRGKC..........RNQ..TGVFPANHVKVI------------------------------------
ENSMLUP00000005582  .........FYRGEG..........GGR..RGYIPCNMVAEVAV----------------------------------
ENSMLUP00000012019  .........WWLCSL..........HGR..QGIVPGNRVKLLIGP---------------------------------
ENSMLUP00000007621  .........WWKARSla........TRK..EGYIPSNYVA--------------------------------------
ENSMLUP00000000109  .........WTRARRq.........NGE..EGYVPTSYID--------------------------------------
ENSMLUP00000012976  .........WWRGEH..........AGT..CGLIPHKYITL-------------------------------------
ENSMLUP00000010504  .........WLEGMRls........DGE..RGWFPVHQVEFISNP---------------------------------
ENSMLUP00000007384  .........WLEGTL..........NGK..RGLIPQNYVK--------------------------------------
ENSMLUP00000002099  .........WYEGERlr........DGE..RGWFPMECAKEITC----------------------------------
ENSMLUP00000010226  .........WLIGER..........GNK..KGKVPVTYLEL-------------------------------------
ENSMLUP00000001012  .........WAEGKL..........GDK..IGIFPILFVEP-------------------------------------
ENSMLUP00000012000  .........WWYVQI..........GEK..EGWAPASYIDKRKKPNLSRRTSTLTRPKVPPPAP--------------
ENSMLUP00000014043  .........WLNGYNet........TGE..RGDFPGTYVEYIGR----------------------------------
ENSMLUP00000017916  .........WLEGTL..........NGK..TGLIPENYVE--------------------------------------
ENSMLUP00000002503  .........WWEGRH..........NGI..DGLIPHQYIVV-------------------------------------
ENSMLUP00000009446  .........WWEGRH..........NGV..DGLIPHQYIVVQD-----------------------------------
ENSMLUP00000013179  .........WWVGEM..........KGA..IGLVPKAYIME-------------------------------------
ENSMLUP00000006973  .........WWWGER..........AGY..CGYIPANHL---------------------------------------
ENSMLUP00000013630  .........WLEGVRla........DGE..KGWVPQAYVEEISS----------------------------------
ENSMLUP00000012141  .........WLEAKNs.........KGE..RGLVPTDYVEILSSDGKDP-----------------------------
ENSMLUP00000013669  .........WWYIQI..........EDK..EGWAPATFIDKYKKTSNASRPNFLAPLP--------------------
ENSMLUP00000006358  .........WTRIRRn.........EDE..EGYVPTSYVEV-------------------------------------
ENSMLUP00000002296  .........WWQGELqargk.....KRQ..KGWFPASHVKLLGP----------------------------------
ENSMLUP00000006507  .........WWRGKH..........GFQ..VGLFPGHCVELINQKVPQSVTNSVP-----------------------
ENSMLUP00000011422  .........WWIGRLvke.......GCE..VGFIPSP-----------------------------------------
ENSMLUP00000008265  .........WWIGHIege.......PER..KGVFPVSFVHIL------------------------------------
ENSMLUP00000011428  .........WWEGRH..........NGI..DGLVPHQYIVVQD-----------------------------------
ENSMLUP00000002679  .........KVLCRNd.........EGK..YGYVLRSYL---------------------------------------
ENSMLUP00000018941  .........WAEGML..........GDK..IGIFPLLYVELN------------------------------------
ENSMLUP00000005860  .........WAEGML..........ADK..IGIFPISYVEFN------------------------------------
ENSMLUP00000011542  .........WFEGEL..........EGR..RGIFPEGFVELLG-----------------------------------
ENSMLUP00000020371  .........WWLAEA..........RGQ..KGYVPANYL---------------------------------------
ENSMLUP00000011542  .........RWLIDN..........GVT..KGFVYSSFLKPYNA----------------------------------
ENSMLUP00000000496  .........WFKAEL..........GSQ..EGYVPKNFIDI-------------------------------------
ENSMLUP00000010676  .........WWLCRF..........GGR..TGLLPSVLLQ--------------------------------------
ENSMLUP00000011698  .........LWAGSK..........GKD..FGYFPRDAVQIEEVFIPEEI----------------------------
ENSMLUP00000009701  .........WLQGQNs.........LGE..TGLFPASYVEIISS----------------------------------
ENSMLUP00000004596  .........WWVGEL..........NSL..IGIVPKEYLT--------------------------------------
ENSMLUP00000020371  .........RWLVDT..........GII..KGYVYSSFLKPYNP----------------------------------
ENSMLUP00000000207  .........WVKARNk.........VGQ..VGYVPEKYLQFPT-----------------------------------
ENSMLUP00000014421  .........WWKVRNa.........NGE..SGFVPNNILDIVRSTESG------------------------------
ENSMLUP00000013929  .........RWKGHIhesqrg....TDR..VGYFPPGIVEVV------------------------------------
ENSMLUP00000003615  sercpqnvgWIPGLNer........TRQ..RGDFPGTYVEFLGP----------------------------------
ENSMLUP00000019445  .........TWMGLL..........NNK..VGTFKFIYVDVLNEEEEKPKRPTRRKRKGRPPQPKSVEDLLDRIN---
ENSMLUP00000003921  .........RWKGCIhdnrtg....NDR..VGYFPSSLGE--------------------------------------
ENSMLUP00000002679  .........KWLGRTt.........RGS..YGYIKTTAVQ--------------------------------------
ENSMLUP00000001797  .........TWLGLL..........NGR..LGSFKFIYVDVLP-----------------------------------
ENSMLUP00000007922  .........WLRCSR..........GPD..TGLVPLAYVTLTP-----------------------------------
ENSMLUP00000016884  .........FYRGEC..........NGQ..VGNIPGHLVAEVED----------------------------------
ENSMLUP00000021898  .........WLLASLd.........GQT..TGLIPANYVKILG-----------------------------------
ENSMLUP00000018532  .........EMLCRDt.........KGK..YGYVPRT-----------------------------------------
ENSMLUP00000006141  .........EMLCRDt.........KGK..YGYVPRT-----------------------------------------
ENSMLUP00000012243  .........WLRCGR..........DGM..EGLVP-------------------------------------------
ENSMLUP00000007949  .........WVKARNq.........HSE..VGFVPERYLN--------------------------------------
ENSMLUP00000010409  .........WWQVKPde........NSK..AFYVPAQYVKEVTRKALMPPVKQAAGLPN-------------------
ENSMLUP00000000120  .........WAIGISqr........TGC..RGFLPENYTERAS-----------------------------------
ENSMLUP00000002448  .........WVYGTSlt........TGG..SGLLPENYITKAD-----------------------------------
ENSMLUP00000006631  .........WLKATY..........EGK..TGLVPENYV---------------------------------------
ENSMLUP00000013267  .........YIFARRlsg.......QPS..VGLVPLAYVAKATAEMFA------------------------------
ENSMLUP00000002140  .........MCLVYQpasdhs....PAA..EGWVPGSILAPL------------------------------------
ENSMLUP00000009401  .........TWMGLL..........NNK..VGTFKFIYVDVLNEEEEKPKRPTRRKRKGRPPQPKSVEDLLDRIN---
ENSMLUP00000011645  .........RWLVDT..........GGH..RGYVPAGKLEPY------------------------------------
ENSMLUP00000000142  .........WWEGRNta........TNE..VGWFPCNRVKPY------------------------------------
ENSMLUP00000013622  .........QWEGEV..........NGR..KGLFPFTHVKIFDPQ---------------------------------
ENSMLUP00000002497  .........FWQGRNla........SGE..VGFFPSDAVKPCPCVPKP------------------------------
ENSMLUP00000013669  .........WWFCQVlsga......PSW..EGWIPSNYLR--------------------------------------
ENSMLUP00000008144  .........WTRVRRk.........QGG..EGYVPTSYLR--------------------------------------
ENSMLUP00000004680  .........WLYGEHdt........SKA..RGWFPSSYTRLLE-----------------------------------
ENSMLUP00000010492  .........WMWVTNlr........TDE..QGLIVEDLVEEVGRE---------------------------------
ENSMLUP00000011542  .........WLQGRSc.........WGA..RGFFPSSCVREL------------------------------------
ENSMLUP00000000726  .........MFLVFRaatdqc....PAA..EGWIPG------------------------------------------
ENSMLUP00000016884  .........FYYGES..........GGH..RGLVPAHLLDY-------------------------------------
ENSMLUP00000002474  .........QWEGEC..........NGK..RGHFPFTHVRLLDQQ---------------------------------
ENSMLUP00000013417  .........WYEAYNmr........TGA..RGIFPAYYAIE-------------------------------------
ENSMLUP00000012000  .........WWYCQIldgv......KPF..KGWVPSNYLE--------------------------------------
ENSMLUP00000001859  .........WYRGYTlrk.......KSK..KGIFPASYIHL-------------------------------------
ENSMLUP00000016646  .........WMYGTVer........TGD..TGMLPANYVE--------------------------------------
ENSMLUP00000009616  .........LWYVRNlt........SSK..EGWVPASSLS--------------------------------------
ENSMLUP00000010476  .........SWMAWQldenaq....KIQ..RGQIPSKYV---------------------------------------
ENSMLUP00000003844  .........MWTGML..........NNK..VGNFKFIYVDVISEEESAP-----------------------------
ENSMLUP00000012979  .........LVICRNs.........KGK..YGYV--------------------------------------------
ENSMLUP00000010870  .........----ENep........DGH..FGMFPANYVELI------------------------------------
ENSMLUP00000004205  .........WYRAKHha........SGQ..EGLLAAGALREREALSADPKLSLMPWFHGKIS----------------
ENSMLUP00000000726  .........WCLVRTtdrs......PAA..EGLVPCG-----------------------------------------
ENSMLUP00000008845  .........WWTVLSeg........SGR..EYSVPSIHVAKI------------------------------------
ENSMLUP00000012305  .........------..........---..------------------------------------------------
ENSMLUP00000000937  .........WWLARRlgaps.....TSR..PIFVPAAYMTEE------------------------------------
ENSMLUP00000002140  .........WCLVRTters......PPQ..EGLVPSSAL---------------------------------------
ENSMLUP00000016537  .........WWRGQNtr........TLC..VGPFPRNVVT--------------------------------------
ENSMLUP00000015982  .........WWRGQNtr........TLC..VGPFPRNVVT--------------------------------------
ENSMLUP00000009378  .........WFIGKSac........SGE..VGFVPTRN----------------------------------------
ENSMLUP00000001358  .........WAGGEP..........RGR..TRISPLNLVELVEDHPTS------------------------------
ENSMLUP00000010676  .........WWLVANe.........DQQ..TAWFPAPYLEEV------------------------------------
ENSMLUP00000011918  .........WYRGFAlkn.......PNI..KGIFPSSYVH--------------------------------------
ENSMLUP00000006188  .........WWKGRL..........HGQ..EGLFPGNYVEKI------------------------------------
ENSMLUP00000004439  .........WLAIRI..........---..------------------------------------------------
ENSMLUP00000004210  .........YSKGVNrk........LGR..TGLYPSYKVRE-------------------------------------
ENSMLUP00000015169  .........WANGINer........TKQ..RGDFPTDCVYVMPT----------------------------------
ENSMLUP00000013320  .........WYKAE-..........---..------------------------------------------------
ENSMLUP00000000142  .........WWRGE-..........---..------------------------------------------------
ENSMLUP00000006936  .........WYRGVStkk.......PNV..KGIFPANYIH--------------------------------------
ENSMLUP00000010147  .........WLAVRIgn........ELE..KGLIP-------------------------------------------
ENSMLUP00000009801  .........WLAVRMgrdlr.....EQE..RGIIP-------------------------------------------
ENSMLUP00000018134  .........RWKCKNa.........WGQ..AGL-PPNYV---------------------------------------
ENSMLUP00000016407  .........WWLA--..........---..------------------------------------------------
ENSMLUP00000010152  .........WWKAISls........TGR..ENYIPGICVA--------------------------------------
ENSMLUP00000009378  .........ECEGMSlv........TGQ..RGLVPVSALEPLPLPFHQWF----------------------------
ENSMLUP00000020593  .........WITGTLcf........PSR..SGWFPEAYVKPLEEVPVNPMNPMNPLNP--------------------
ENSMLUP00000019238  .........RWKCKNa.........WGQ..AGLV--------------------------------------------
ENSMLUP00000001358  .........YLECQK..........GKV..TGRVHLSQMKIITPLD--------------------------------
ENSMLUP00000000215  .........------..........---..------------------------------------------------
ENSMLUP00000004531  .........YVKVYT..........GRK..VGLFPTDFLEEI------------------------------------
ENSMLUP00000001760  .........WLYGDKilddsfiegvSRI..RGWFPRNCVEKCPC----------------------------------


                        110                                                                         
                          |                                                                         
d1ng2a2               SQDAYRRNSVRF-l................................................................
ENSMLUP00000003159  -------------lrleniriqqeqkrgrfhggkssgnsssslgemvsgtfratptsaakqkqkvtehippydvv...
ENSMLUP00000006192  -------------rrdwdnsgpfcgtlsskkkkkmmylttrnaefdrhe.............................
ENSMLUP00000001660  -------------vklenmrlqheqrakqgkfyssklggnsssslgdivpssrkstppssaididatgldaeendipa
ENSMLUP00000010880  -------------kykdkylakhsaifdqldvv.............................................
ENSMLUP00000010026  -------------qrlesirlkqeqkarrsgnpsslsdignrrspppslakqkqkqaehvppydvv............
ENSMLUP00000016306  -------------rrdwdnsgpfcgtlsskkkkkmmylttrnaefdrhe.............................
ENSMLUP00000002731  -------------vaciamektkqeqqasctwfgkkkkqykdkylakhnavfdqldl.....................
ENSMLUP00000012398  -------------fvkrdleltpnsgtlcgslsgkkkkrmmylttknaefdrhe........................
ENSMLUP00000007590  -------------krrvekkerarlktvkfnsktrgdkgeipddmgskglkhvtsnasdsessylilitdeygcskgg
ENSMLUP00000001366  -------------vqplkisnrkssgfrrsfrlsrkdkktnktmyeckksdqydtadv....................
ENSMLUP00000005694  -------------gksfqqqreamkqtieedkepeksgklwcakknkkkrkkvlynanknddydnee...........
ENSMLUP00000016016  -------------lkspmsismeee.....................................................
ENSMLUP00000013902  -------------.................................................................
ENSMLUP00000006692  -------------aeewyfgklgrkdaerqllsfgnprgtfliresettkgayslsirdwddm...............
ENSMLUP00000018425  -------------krrverkerarlktvkfnakpgvidskgsfndkrkksfifsrkfpfyknkeqseqetsdpeqhas
ENSMLUP00000002338  -------------krrverrewsrlkakdwgsssgsqgredsvlsyetvtqmevhyarpiiilgptkdranddllsef
ENSMLUP00000010190  -------------kkrvekkerarlktvkfhartgmiesn......................................
ENSMLUP00000002296  -------------dsd..............................................................
ENSMLUP00000013892  -------------tlks.............................................................
ENSMLUP00000016474  -------------qq...............................................................
ENSMLUP00000004080  -------------qaeewyfgki.......................................................
ENSMLUP00000013902  -------------.................................................................
ENSMLUP00000013066  -------------qp...............................................................
ENSMLUP00000002474  -------------iggnqegshpqplggpepgpyaqpsvn......................................
ENSMLUP00000010063  -------------qaepwffgaikradaenqllysgnqtgafliresesekggfalsv....................
ENSMLUP00000007412  -------------s................................................................
ENSMLUP00000011783  -------------kq...............................................................
ENSMLUP00000007133  -------------ikgf.............................................................
ENSMLUP00000005117  -------------nqeelsenssstqgeeqqedagttrhkhseskqqmrtnviqeimntervy...............
ENSMLUP00000005919  -------------wffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdq...................
ENSMLUP00000011432  -------------genvwrccqpfsgnkeqgylslkenqicvgvgrskd.............................
ENSMLUP00000001119  -------------l................................................................
ENSMLUP00000010330  -------------vp...............................................................
ENSMLUP00000002843  -------------l................................................................
ENSMLUP00000011946  -------------d................................................................
ENSMLUP00000002942  -------------lrlhqpplr........................................................
ENSMLUP00000008920  -------------ap...............................................................
ENSMLUP00000000496  -------------.................................................................
ENSMLUP00000013320  -------------.................................................................
ENSMLUP00000017214  -------------qaeewyfgki.......................................................
ENSMLUP00000021229  -------------s................................................................
ENSMLUP00000008092  -------------s................................................................
ENSMLUP00000001413  -------------pqcdyirpsltgkfagnpwyygkvtrh......................................
ENSMLUP00000013669  -------------ekepls...........................................................
ENSMLUP00000002497  -------------.................................................................
ENSMLUP00000015970  -------------ad...............................................................
ENSMLUP00000001413  -------------spl..............................................................
ENSMLUP00000015518  -------------m................................................................
ENSMLUP00000013530  -------------teewffkditrkdaerqllapgng.........................................
ENSMLUP00000001958  -------------.................................................................
ENSMLUP00000011783  -------------sddl.............................................................
ENSMLUP00000000207  -------------gslp.............................................................
ENSMLUP00000007093  -------------l................................................................
ENSMLUP00000013066  -------------snkp.............................................................
ENSMLUP00000003166  -------------tnlnmese.........................................................
ENSMLUP00000007433  -------------vyqeatkevpttdidff................................................
ENSMLUP00000007981  -------------eevd.............................................................
ENSMLUP00000005897  -------------pp...............................................................
ENSMLUP00000005860  -------------p................................................................
ENSMLUP00000009512  -------------k................................................................
ENSMLUP00000002296  -------------vsp..............................................................
ENSMLUP00000007216  -------------pt...............................................................
ENSMLUP00000001866  -------------edgveegpsdvqnghldpnsdclclgrplqnrdqmranvinei......................
ENSMLUP00000003210  -------------q................................................................
ENSMLUP00000008920  -------------it...............................................................
ENSMLUP00000013622  -------------ahaya............................................................
ENSMLUP00000007577  -------------aesi.............................................................
ENSMLUP00000007981  -------------agsgr............................................................
ENSMLUP00000015831  -------------scypp............................................................
ENSMLUP00000009890  -------------a................................................................
ENSMLUP00000001358  -------------ksm..............................................................
ENSMLUP00000004195  -------------i................................................................
ENSMLUP00000007864  -------------ppce.............................................................
ENSMLUP00000010897  -------------v................................................................
ENSMLUP00000006579  -------------wyhgpvsrsaaeyllssling............................................
ENSMLUP00000019391  -------------s................................................................
ENSMLUP00000001358  -------------.................................................................
ENSMLUP00000005860  -------------fgramtnas........................................................
ENSMLUP00000010009  -------------pkkl.............................................................
ENSMLUP00000016474  -------------vtdl.............................................................
ENSMLUP00000008018  -------------wyhgpvsrnaaeyllssging............................................
ENSMLUP00000014609  -------------rqq..............................................................
ENSMLUP00000009299  -------------vs...............................................................
ENSMLUP00000006831  -------------aq...............................................................
ENSMLUP00000003954  -------------ae...............................................................
ENSMLUP00000011645  -------------apwgwsl..........................................................
ENSMLUP00000012000  -------------qng..............................................................
ENSMLUP00000013586  -------------vdv..............................................................
ENSMLUP00000002296  -------------qes..............................................................
ENSMLUP00000010009  -------------.................................................................
ENSMLUP00000007216  -------------spsmt............................................................
ENSMLUP00000016474  -------------aplkrvaspaa......................................................
ENSMLUP00000001012  -------------p................................................................
ENSMLUP00000017975  -------------alltpp...........................................................
ENSMLUP00000018941  -------------gtwsv............................................................
ENSMLUP00000005582  -------------dllt.............................................................
ENSMLUP00000017787  -------------.................................................................
ENSMLUP00000015689  -------------epgspypape.......................................................
ENSMLUP00000002296  -------------se...............................................................
ENSMLUP00000008920  -------------et...............................................................
ENSMLUP00000012000  -------------gpve.............................................................
ENSMLUP00000004960  -------------skey.............................................................
ENSMLUP00000016474  -------------kd...............................................................
ENSMLUP00000007216  -------------.................................................................
ENSMLUP00000018941  -------------pp...............................................................
ENSMLUP00000007615  -------------iq...............................................................
ENSMLUP00000017501  -------------gqdagq...........................................................
ENSMLUP00000005582  -------------g................................................................
ENSMLUP00000013066  -------------r................................................................
ENSMLUP00000004531  -------------rvrs.............................................................
ENSMLUP00000014222  -------------hk...............................................................
ENSMLUP00000001012  -------------frt..............................................................
ENSMLUP00000011016  -------------l................................................................
ENSMLUP00000014075  -------------tdpd.............................................................
ENSMLUP00000016089  -------------c................................................................
ENSMLUP00000014075  -------------asp..............................................................
ENSMLUP00000010551  -------------tsa..............................................................
ENSMLUP00000011784  -------------.................................................................
ENSMLUP00000016474  -------------skv..............................................................
ENSMLUP00000014409  -------------nnletyewynksisrdkaekllldt........................................
ENSMLUP00000013262  -------------wffgcisrlealhrlq.................................................
ENSMLUP00000014923  -------------rpag.............................................................
ENSMLUP00000004002  -------------ssrp.............................................................
ENSMLUP00000020771  -------------rpag.............................................................
ENSMLUP00000007028  -------------nkl..............................................................
ENSMLUP00000010009  -------------sata.............................................................
ENSMLUP00000018941  -------------s................................................................
ENSMLUP00000010822  -------------n................................................................
ENSMLUP00000015288  -------------r................................................................
ENSMLUP00000013669  -------------gq...............................................................
ENSMLUP00000022476  -------------gkksnn...........................................................
ENSMLUP00000011542  -------------a................................................................
ENSMLUP00000011542  -------------kveetvvl.........................................................
ENSMLUP00000016384  -------------l................................................................
ENSMLUP00000005860  -------------n................................................................
ENSMLUP00000003137  -------------a................................................................
ENSMLUP00000016884  -------------ndil.............................................................
ENSMLUP00000015858  -------------lnp..............................................................
ENSMLUP00000012406  -------------eqaerllcpp.......................................................
ENSMLUP00000009292  -------------flrp.............................................................
ENSMLUP00000001413  -------------kns..............................................................
ENSMLUP00000012000  Q------------alnt.............................................................
ENSMLUP00000007949  -------------spp..............................................................
ENSMLUP00000001358  -------------.................................................................
ENSMLUP00000005582  -------------dtp..............................................................
ENSMLUP00000012019  -------------vqetsssqdqptsglmh................................................
ENSMLUP00000007621  -------------r................................................................
ENSMLUP00000000109  -------------.................................................................
ENSMLUP00000012976  -------------peg..............................................................
ENSMLUP00000010504  -------------ev...............................................................
ENSMLUP00000007384  -------------l................................................................
ENSMLUP00000002099  -------------q................................................................
ENSMLUP00000010226  -------------l................................................................
ENSMLUP00000001012  -------------.................................................................
ENSMLUP00000012000  -------------p................................................................
ENSMLUP00000014043  -------------kkis.............................................................
ENSMLUP00000017916  -------------f................................................................
ENSMLUP00000002503  -------------qd...............................................................
ENSMLUP00000009446  -------------mdd..............................................................
ENSMLUP00000013179  -------------my...............................................................
ENSMLUP00000006973  -------------.................................................................
ENSMLUP00000013630  -------------lsa..............................................................
ENSMLUP00000012141  -------------fscgns...........................................................
ENSMLUP00000013669  -------------nema.............................................................
ENSMLUP00000006358  -------------y................................................................
ENSMLUP00000002296  -------------sse..............................................................
ENSMLUP00000006507  -------------kpv..............................................................
ENSMLUP00000011422  -------------vkldslrllqeqklrqnrlsssksgdnsssslgdvvtgtrrptppasafeldpleledeeaelge
ENSMLUP00000008265  -------------s................................................................
ENSMLUP00000011428  -------------mdd..............................................................
ENSMLUP00000002679  -------------.................................................................
ENSMLUP00000018941  -------------ds...............................................................
ENSMLUP00000005860  -------------saa..............................................................
ENSMLUP00000011542  -------------p................................................................
ENSMLUP00000020371  -------------.................................................................
ENSMLUP00000011542  -------------rrshsd...........................................................
ENSMLUP00000000496  -------------q................................................................
ENSMLUP00000010676  -------------.................................................................
ENSMLUP00000011698  -------------qiptkesdflc......................................................
ENSMLUP00000009701  -------------gts..............................................................
ENSMLUP00000004596  -------------.................................................................
ENSMLUP00000020371  -------------akaqkkv..........................................................
ENSMLUP00000000207  -------------snsllsmlq........................................................
ENSMLUP00000014421  -------------lgradppythti.....................................................
ENSMLUP00000013929  -------------s................................................................
ENSMLUP00000003615  -------------vt...............................................................
ENSMLUP00000019445  -------------lk...............................................................
ENSMLUP00000003921  -------------aivkragsragaeqsspq...............................................
ENSMLUP00000002679  -------------.................................................................
ENSMLUP00000001797  -------------e................................................................
ENSMLUP00000007922  -------------t................................................................
ENSMLUP00000016884  -------------gl...............................................................
ENSMLUP00000021898  -------------krrg.............................................................
ENSMLUP00000018532  -------------al...............................................................
ENSMLUP00000006141  -------------al...............................................................
ENSMLUP00000012243  -------------.................................................................
ENSMLUP00000007949  -------------fpd..............................................................
ENSMLUP00000010409  -------------nsm..............................................................
ENSMLUP00000000120  -------------ecd..............................................................
ENSMLUP00000002448  -------------ecs..............................................................
ENSMLUP00000006631  -------------vf...............................................................
ENSMLUP00000013267  -------------dqpwyfsgisrtqaqqlllspanvpgaflirpsessqgdyslsvraq..................
ENSMLUP00000002140  -------------t................................................................
ENSMLUP00000009401  -------------lk...............................................................
ENSMLUP00000011645  -------------q................................................................
ENSMLUP00000000142  -------------vh...............................................................
ENSMLUP00000013622  -------------npd..............................................................
ENSMLUP00000002497  -------------v................................................................
ENSMLUP00000013669  -------------k................................................................
ENSMLUP00000008144  -------------v................................................................
ENSMLUP00000004680  -------------e................................................................
ENSMLUP00000010492  -------------edp..............................................................
ENSMLUP00000011542  -------------clssq............................................................
ENSMLUP00000000726  -------------fvlg.............................................................
ENSMLUP00000016884  -------------ms...............................................................
ENSMLUP00000002474  -------------npd..............................................................
ENSMLUP00000013417  -------------vt...............................................................
ENSMLUP00000012000  -------------k................................................................
ENSMLUP00000001859  -------------keaivegrgqdetvipg................................................
ENSMLUP00000016646  -------------a................................................................
ENSMLUP00000009616  -------------ml...............................................................
ENSMLUP00000010476  -------------mdqefsrrlsmsevkdds...............................................
ENSMLUP00000003844  -------------rkiktrrrsgre.....................................................
ENSMLUP00000012979  -------------liehl............................................................
ENSMLUP00000010870  -------------.................................................................
ENSMLUP00000004205  -------------gqeavqllqppe.....................................................
ENSMLUP00000000726  -------------slciahs..........................................................
ENSMLUP00000008845  -------------s................................................................
ENSMLUP00000012305  -------------vfswpldivlgftgigpnclvek..........................................
ENSMLUP00000000937  -------------sicsqs...........................................................
ENSMLUP00000002140  -------------cish.............................................................
ENSMLUP00000016537  -------------.................................................................
ENSMLUP00000015982  -------------.................................................................
ENSMLUP00000009378  -------------idp..............................................................
ENSMLUP00000001358  -------------gtnvfst..........................................................
ENSMLUP00000010676  -------------.................................................................
ENSMLUP00000011918  -------------l................................................................
ENSMLUP00000006188  -------------.................................................................
ENSMLUP00000004439  -------------gknhkevergiipnknr................................................
ENSMLUP00000004210  -------------kietvkypt........................................................
ENSMLUP00000015169  -------------vtm..............................................................
ENSMLUP00000013320  -------------l................................................................
ENSMLUP00000000142  -------------i................................................................
ENSMLUP00000006936  -------------lk...............................................................
ENSMLUP00000010147  -------------nksraeqmasvqnaqrdna..............................................
ENSMLUP00000009801  -------------nqkraeqlasleaaqral...............................................
ENSMLUP00000018134  -------------.................................................................
ENSMLUP00000016407  -------------k................................................................
ENSMLUP00000010152  -------------.................................................................
ENSMLUP00000009378  -------------lknyp............................................................
ENSMLUP00000020593  -------------vtsm.............................................................
ENSMLUP00000019238  -------------.................................................................
ENSMLUP00000001358  -------------ehlrsrpndp.......................................................
ENSMLUP00000000215  -------------e................................................................
ENSMLUP00000004531  -------------.................................................................
ENSMLUP00000001760  -------------da...............................................................


                                                                               
                                                                               
d1ng2a2               .........................................................
ENSMLUP00000003159  .........................................................
ENSMLUP00000006192  .........................................................
ENSMLUP00000001660  nhrspkpsansvtsphskekrmpffkktehtppydvv....................
ENSMLUP00000010880  .........................................................
ENSMLUP00000010026  .........................................................
ENSMLUP00000016306  .........................................................
ENSMLUP00000002731  .........................................................
ENSMLUP00000012398  .........................................................
ENSMLUP00000007590  qeeyvlsyepvnqqevnytrpviilgpmkdrinddlisefpdkfg............
ENSMLUP00000001366  .........................................................
ENSMLUP00000005694  .........................................................
ENSMLUP00000016016  .........................................................
ENSMLUP00000013902  .........................................................
ENSMLUP00000006692  .........................................................
ENSMLUP00000018425  snasdsessyrgqedfilsyepvsrqeinytrpviilgpmkdrinddlisefpdkfg
ENSMLUP00000002338  pdkfg....................................................
ENSMLUP00000010190  .........................................................
ENSMLUP00000002296  .........................................................
ENSMLUP00000013892  .........................................................
ENSMLUP00000016474  .........................................................
ENSMLUP00000004080  .........................................................
ENSMLUP00000013902  .........................................................
ENSMLUP00000013066  .........................................................
ENSMLUP00000002474  .........................................................
ENSMLUP00000010063  .........................................................
ENSMLUP00000007412  .........................................................
ENSMLUP00000011783  .........................................................
ENSMLUP00000007133  .........................................................
ENSMLUP00000005117  .........................................................
ENSMLUP00000005919  .........................................................
ENSMLUP00000011432  .........................................................
ENSMLUP00000001119  .........................................................
ENSMLUP00000010330  .........................................................
ENSMLUP00000002843  .........................................................
ENSMLUP00000011946  .........................................................
ENSMLUP00000002942  .........................................................
ENSMLUP00000008920  .........................................................
ENSMLUP00000000496  .........................................................
ENSMLUP00000013320  .........................................................
ENSMLUP00000017214  .........................................................
ENSMLUP00000021229  .........................................................
ENSMLUP00000008092  .........................................................
ENSMLUP00000001413  .........................................................
ENSMLUP00000013669  .........................................................
ENSMLUP00000002497  .........................................................
ENSMLUP00000015970  .........................................................
ENSMLUP00000001413  .........................................................
ENSMLUP00000015518  .........................................................
ENSMLUP00000013530  .........................................................
ENSMLUP00000001958  .........................................................
ENSMLUP00000011783  .........................................................
ENSMLUP00000000207  .........................................................
ENSMLUP00000007093  .........................................................
ENSMLUP00000013066  .........................................................
ENSMLUP00000003166  .........................................................
ENSMLUP00000007433  .........................................................
ENSMLUP00000007981  .........................................................
ENSMLUP00000005897  .........................................................
ENSMLUP00000005860  .........................................................
ENSMLUP00000009512  .........................................................
ENSMLUP00000002296  .........................................................
ENSMLUP00000007216  .........................................................
ENSMLUP00000001866  .........................................................
ENSMLUP00000003210  .........................................................
ENSMLUP00000008920  .........................................................
ENSMLUP00000013622  .........................................................
ENSMLUP00000007577  .........................................................
ENSMLUP00000007981  .........................................................
ENSMLUP00000015831  .........................................................
ENSMLUP00000009890  .........................................................
ENSMLUP00000001358  .........................................................
ENSMLUP00000004195  .........................................................
ENSMLUP00000007864  .........................................................
ENSMLUP00000010897  .........................................................
ENSMLUP00000006579  .........................................................
ENSMLUP00000019391  .........................................................
ENSMLUP00000001358  .........................................................
ENSMLUP00000005860  .........................................................
ENSMLUP00000010009  .........................................................
ENSMLUP00000016474  .........................................................
ENSMLUP00000008018  .........................................................
ENSMLUP00000014609  .........................................................
ENSMLUP00000009299  .........................................................
ENSMLUP00000006831  .........................................................
ENSMLUP00000003954  .........................................................
ENSMLUP00000011645  .........................................................
ENSMLUP00000012000  .........................................................
ENSMLUP00000013586  .........................................................
ENSMLUP00000002296  .........................................................
ENSMLUP00000010009  .........................................................
ENSMLUP00000007216  .........................................................
ENSMLUP00000016474  .........................................................
ENSMLUP00000001012  .........................................................
ENSMLUP00000017975  .........................................................
ENSMLUP00000018941  .........................................................
ENSMLUP00000005582  .........................................................
ENSMLUP00000017787  .........................................................
ENSMLUP00000015689  .........................................................
ENSMLUP00000002296  .........................................................
ENSMLUP00000008920  .........................................................
ENSMLUP00000012000  .........................................................
ENSMLUP00000004960  .........................................................
ENSMLUP00000016474  .........................................................
ENSMLUP00000007216  .........................................................
ENSMLUP00000018941  .........................................................
ENSMLUP00000007615  .........................................................
ENSMLUP00000017501  .........................................................
ENSMLUP00000005582  .........................................................
ENSMLUP00000013066  .........................................................
ENSMLUP00000004531  .........................................................
ENSMLUP00000014222  .........................................................
ENSMLUP00000001012  .........................................................
ENSMLUP00000011016  .........................................................
ENSMLUP00000014075  .........................................................
ENSMLUP00000016089  .........................................................
ENSMLUP00000014075  .........................................................
ENSMLUP00000010551  .........................................................
ENSMLUP00000011784  .........................................................
ENSMLUP00000016474  .........................................................
ENSMLUP00000014409  .........................................................
ENSMLUP00000013262  .........................................................
ENSMLUP00000014923  .........................................................
ENSMLUP00000004002  .........................................................
ENSMLUP00000020771  .........................................................
ENSMLUP00000007028  .........................................................
ENSMLUP00000010009  .........................................................
ENSMLUP00000018941  .........................................................
ENSMLUP00000010822  .........................................................
ENSMLUP00000015288  .........................................................
ENSMLUP00000013669  .........................................................
ENSMLUP00000022476  .........................................................
ENSMLUP00000011542  .........................................................
ENSMLUP00000011542  .........................................................
ENSMLUP00000016384  .........................................................
ENSMLUP00000005860  .........................................................
ENSMLUP00000003137  .........................................................
ENSMLUP00000016884  .........................................................
ENSMLUP00000015858  .........................................................
ENSMLUP00000012406  .........................................................
ENSMLUP00000009292  .........................................................
ENSMLUP00000001413  .........................................................
ENSMLUP00000012000  .........................................................
ENSMLUP00000007949  .........................................................
ENSMLUP00000001358  .........................................................
ENSMLUP00000005582  .........................................................
ENSMLUP00000012019  .........................................................
ENSMLUP00000007621  .........................................................
ENSMLUP00000000109  .........................................................
ENSMLUP00000012976  .........................................................
ENSMLUP00000010504  .........................................................
ENSMLUP00000007384  .........................................................
ENSMLUP00000002099  .........................................................
ENSMLUP00000010226  .........................................................
ENSMLUP00000001012  .........................................................
ENSMLUP00000012000  .........................................................
ENSMLUP00000014043  .........................................................
ENSMLUP00000017916  .........................................................
ENSMLUP00000002503  .........................................................
ENSMLUP00000009446  .........................................................
ENSMLUP00000013179  .........................................................
ENSMLUP00000006973  .........................................................
ENSMLUP00000013630  .........................................................
ENSMLUP00000012141  .........................................................
ENSMLUP00000013669  .........................................................
ENSMLUP00000006358  .........................................................
ENSMLUP00000002296  .........................................................
ENSMLUP00000006507  .........................................................
ENSMLUP00000011422  pggsaktsvssvttpsphgkrisffkktehvppydvv....................
ENSMLUP00000008265  .........................................................
ENSMLUP00000011428  .........................................................
ENSMLUP00000002679  .........................................................
ENSMLUP00000018941  .........................................................
ENSMLUP00000005860  .........................................................
ENSMLUP00000011542  .........................................................
ENSMLUP00000020371  .........................................................
ENSMLUP00000011542  .........................................................
ENSMLUP00000000496  .........................................................
ENSMLUP00000010676  .........................................................
ENSMLUP00000011698  .........................................................
ENSMLUP00000009701  .........................................................
ENSMLUP00000004596  .........................................................
ENSMLUP00000020371  .........................................................
ENSMLUP00000000207  .........................................................
ENSMLUP00000014421  .........................................................
ENSMLUP00000013929  .........................................................
ENSMLUP00000003615  .........................................................
ENSMLUP00000019445  .........................................................
ENSMLUP00000003921  .........................................................
ENSMLUP00000002679  .........................................................
ENSMLUP00000001797  .........................................................
ENSMLUP00000007922  .........................................................
ENSMLUP00000016884  .........................................................
ENSMLUP00000021898  .........................................................
ENSMLUP00000018532  .........................................................
ENSMLUP00000006141  .........................................................
ENSMLUP00000012243  .........................................................
ENSMLUP00000007949  .........................................................
ENSMLUP00000010409  .........................................................
ENSMLUP00000000120  .........................................................
ENSMLUP00000002448  .........................................................
ENSMLUP00000006631  .........................................................
ENSMLUP00000013267  .........................................................
ENSMLUP00000002140  .........................................................
ENSMLUP00000009401  .........................................................
ENSMLUP00000011645  .........................................................
ENSMLUP00000000142  .........................................................
ENSMLUP00000013622  .........................................................
ENSMLUP00000002497  .........................................................
ENSMLUP00000013669  .........................................................
ENSMLUP00000008144  .........................................................
ENSMLUP00000004680  .........................................................
ENSMLUP00000010492  .........................................................
ENSMLUP00000011542  .........................................................
ENSMLUP00000000726  .........................................................
ENSMLUP00000016884  .........................................................
ENSMLUP00000002474  .........................................................
ENSMLUP00000013417  .........................................................
ENSMLUP00000012000  .........................................................
ENSMLUP00000001859  .........................................................
ENSMLUP00000016646  .........................................................
ENSMLUP00000009616  .........................................................
ENSMLUP00000010476  .........................................................
ENSMLUP00000003844  .........................................................
ENSMLUP00000012979  .........................................................
ENSMLUP00000010870  .........................................................
ENSMLUP00000004205  .........................................................
ENSMLUP00000000726  .........................................................
ENSMLUP00000008845  .........................................................
ENSMLUP00000012305  .........................................................
ENSMLUP00000000937  .........................................................
ENSMLUP00000002140  .........................................................
ENSMLUP00000016537  .........................................................
ENSMLUP00000015982  .........................................................
ENSMLUP00000009378  .........................................................
ENSMLUP00000001358  .........................................................
ENSMLUP00000010676  .........................................................
ENSMLUP00000011918  .........................................................
ENSMLUP00000006188  .........................................................
ENSMLUP00000004439  .........................................................
ENSMLUP00000004210  .........................................................
ENSMLUP00000015169  .........................................................
ENSMLUP00000013320  .........................................................
ENSMLUP00000000142  .........................................................
ENSMLUP00000006936  .........................................................
ENSMLUP00000010147  .........................................................
ENSMLUP00000009801  .........................................................
ENSMLUP00000018134  .........................................................
ENSMLUP00000016407  .........................................................
ENSMLUP00000010152  .........................................................
ENSMLUP00000009378  .........................................................
ENSMLUP00000020593  .........................................................
ENSMLUP00000019238  .........................................................
ENSMLUP00000001358  .........................................................
ENSMLUP00000000215  .........................................................
ENSMLUP00000004531  .........................................................
ENSMLUP00000001760  .........................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0041374 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Arthrobacter arilaitensis Re117
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus sp.
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Roseburia hominis A2-183
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium perfringens ATCC 13124
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Exiguobacterium sp. AT1b
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Bacillus sp. JS
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Marivirga tractuosa DSM 4126
NoYes   Prevotella intermedia 17
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Sphingobacterium sp. 21
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Cellulophaga algicola DSM 14237
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Methylacidiphilum infernorum V4
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Deferribacter desulfuricans SSM1
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Pelobacter propionicus DSM 2379
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Achromobacter xylosoxidans A8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Magnetococcus marinus MC-1
NoYes   Ruegeria sp. TM1040
NoYes   Rhodospirillum rubrum F11
NoYes   Starkeya novella DSM 506
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium etli CIAT 652
NoYes   Pelagibacterium halotolerans B2
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bartonella tribocorum CIP 105476
NoYes   Haemophilus parasuis SH0165
NoYes   Vibrio anguillarum 775
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Marinomonas mediterranea MMB-1
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Enterobacter sp. R4-368
NoYes   Pseudomonas entomophila L48
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Methanococcus vannielii SB
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Clostridium thermocellum DSM 1313
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium sp. SY8519
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Thermoanaerobacter sp. X513
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Haemophilus parasuis ZJ0906
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Pantoea ananatis PA13
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas mendocina NK-01
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]