SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

PH domain-like alignments in Aquilegia coerulea v195

These alignments are sequences aligned to the 0045807 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1aqca_                             m...............................................................
Aquca_002_00505.1|PACid:22051945  eeavatfdgiavltprgrysvelhisffrlqgqandfkiqyssvvrlfllpksnqphtfvvvtl
Aquca_002_00505.2|PACid:22051946  eeavatfdgiavltprgrysvelhisffrlqgqandfkiqyssvvrlfllpksnqphtfvvvtl
Aquca_017_00750.2|PACid:22031339  eeesfehtllvvrevsvfkipprstsegykcgewlqsdkiwsgrlrvvsckerceirledpnsg
Aquca_017_00750.1|PACid:22031338  eesfehtllvvrevsvfkipprstsegykcgewlqsdkiwsgrlrvvsckerceirledpnsge
Aquca_072_00073.1|PACid:22041324  lnltvlqridpfieeilitaahvtlydfsiersewsrkdvegslfvvkrntqprfqf.......
Aquca_004_00240.1|PACid:22029886  lnltvlqridpfveeilitaahvtfyefnielnqwsrkdvegslfvvkrntqprfqfivmnrrn
Aquca_081_00021.1|PACid:22040129  eavelilfqvpecyvymipprisaasyradewnvnkwa..........................
Aquca_072_00073.2|PACid:22041325  lnltvlqridpfieeilitaahvtlydfsiersewsrkdvegslfvvkrntqprfq........
Aquca_004_00409.1|PACid:22029680  pivrleevavstgeenelvlldlksklyrfdkegnqwkergagtvkilkhktngkirlvmrqsk
Aquca_020_00435.2|PACid:22025377  pivkleevavttgeesedvlldlkaklyrfdkegnqwkergvgtvkllkhkesgkvrlvmrqsk
Aquca_020_00435.1|PACid:22025376  pivkleevavttgeesedvlldlkaklyrfdkegnqwkergvgtvkllkhkesgkvrlvmrqsk
Aquca_002_00517.1|PACid:22053797  nedllnnkykeklrasykglihevftlilrglsgakvtrpgqfrsyengygvisslgdddgvly
Aquca_001_00573.1|PACid:22043479  psmqevsvetgeenekavftadaalfeyldgawkergkgelkvnvattgvekarlvmrargnyr
Aquca_004_00321.1|PACid:22029546  vefwtnpertgwltkqgeyiktwrrrwfvlkqgklfwfkesqvnrsskprgvipvgtcltvkg.
Aquca_014_00615.1|PACid:22028061  dieqaitalkkgayllkygrrgkpkfcpfrlandesvliwfsgkeekhlklshvsrilpgqrtp
Aquca_022_00350.1|PACid:22054603  idqalialkkgsqllkygrkgkpkfypfrlsndessliwfssggertlklaavsklipgqrtsv
Aquca_042_00118.3|PACid:22033050  dieqalialkkgtqllkysrkgkpkfrpfrissdetaliwyshgeeknlkiasvskiipgqrta
Aquca_042_00118.1|PACid:22033048  dieqalialkkgtqllkysrkgkpkfrpfrissdetaliwyshgeeknlkiasvskiipgqrta
Aquca_042_00118.2|PACid:22033049  dieqalialkkgtqllkysrkgkpkfrpfrissdetaliwyshgeeknlkiasvskiipgqrta
Aquca_002_01439.4|PACid:22053791  tikqgyllkwssslrgdwkrrffvldsqgtlyyyrdkgtklggfqshqstgtservfgrfrprh
Aquca_022_00350.2|PACid:22054604  lialkkgsqllkygrkgkpkfypfrlsndessliwfssggertlklaavsklipgqrtsvfrry
Aquca_002_01439.1|PACid:22053788  tikqgyllkwssslrgdwkrrffvldsqgtlyyyrdkgtklggfqshqstgtservfgrfrprh
Aquca_002_01439.2|PACid:22053789  tikqgyllkwssslrgdwkrrffvldsqgtlyyyrdkgtklggfqshqstgtservfgrfrprh
Aquca_002_01439.3|PACid:22053790  tikqgyllkwssslrgdwkrrffvldsqgtlyyyrdkgtklggfqshqstgtservfgrfrprh
Aquca_043_00004.5|PACid:22045070  idresrwssngshgspngdgiqaigrsshkmieavmqsaakgkvqtirqgylskrssnlrgdwk
Aquca_043_00004.4|PACid:22045069  idresrwssngshgspngdgiqaigrsshkmieavmqsaakgkvqtirqgylskrssnlrgdwk
Aquca_019_00085.1|PACid:22055465  lkkhpffehidwdrlrmisppklvldpnateaddvqnsgwnlshvgdgsgrytdassgatsssd
Aquca_043_00004.3|PACid:22045068  idresrwssngshgspngdgiqaigrsshkmieavmqsaakgkvqtirqgylskrssnlrgdwk
Aquca_043_00004.1|PACid:22045066  idresrwssngshgspngdgiqaigrsshkmieavmqsaakgkvqtirqgylskrssnlrgdwk
Aquca_043_00004.2|PACid:22045067  idresrwssngshgspngdgiqaigrsshkmieavmqsaakgkvqtirqgylskrssnlrgdwk
Aquca_013_00510.1|PACid:22059559  eriilelsssmvrplkiirg............................................
Aquca_013_00510.3|PACid:22059561  eriilelsssmvrplkiirg............................................
Aquca_002_01359.1|PACid:22052490  veqailalkkgaqllkyrprgkpkfcpfrlstderhliwysgtdekqlrlds............
Aquca_014_00060.1|PACid:22027782  itagfllkksaktngwsrrwfvlneksgklgytkkqeernfrgvitleecivdevvdeeeppt.
Aquca_082_00003.1|PACid:22026086  igicgilhkwvnygkgwrprwfvlqdgvlsyykihgpdrielnqdfhkgskvigee........
Aquca_004_00805.3|PACid:22030343  plegprngvsgsntvyksgpllisskgigwkswkkrwfil........................
Aquca_007_00761.1|PACid:22048687  pivkleevavttgeegedvlldlkaefyrfykegnqwkergvgtvkllkaqrkwkns.......
Aquca_014_00159.2|PACid:22028352  isgildkwvnygkgwrprwfvlqdgvlsyykihgpdkiqidqdsdkrskiigeesfrfisrhkn
Aquca_014_00159.1|PACid:22028351  isgildkwvnygkgwrprwfvlqdgvlsyykihgpdkiqidqdsdkrskiigeesfrfisrhkn
Aquca_004_00805.2|PACid:22030342  plegprngvsgsntvyksgpllisskgigwkswkkrwfil........................
Aquca_004_00805.1|PACid:22030341  plegprngvsgsntvyksgpllisskgigwkswkkrwfil........................
Aquca_031_00080.6|PACid:22050752  ssapppapsldqprsragntvfksgp......................................
Aquca_011_00388.1|PACid:22038252  svegilykwvnygkgwrsrwfvledgvlsyykihgpdkitmspar...................
Aquca_031_00080.5|PACid:22050751  ssapppapsldqprsragntvfksgp......................................
Aquca_031_00080.3|PACid:22050749  ssapppapsldqprsragntvfksgp......................................
Aquca_031_00080.4|PACid:22050750  ssapppapsldqprsragntvfksgp......................................
Aquca_031_00080.1|PACid:22050747  ssapppapsldqprsragntvfksgp......................................
Aquca_031_00080.2|PACid:22050748  ssapppapsldqprsragntvfksgp......................................
Aquca_010_00264.1|PACid:22047425  evllsvpcvlvtpkrkvaghlavmkhvlhffgeflvegtggssvfsnfnlpcnsestklekveg
Aquca_010_00264.2|PACid:22047422  evllsvpcvlvtpkrkvaghlavmkhvlhffgeflvegtggssvfsnfnlpcnsestklekveg
Aquca_010_00264.3|PACid:22047423  evllsvpcvlvtpkrkvaghlavmkhvlhffgeflvegtggssvfsnfnlpcnsestklekveg
Aquca_010_00264.4|PACid:22047424  evllsvpcvlvtpkrkvaghlavmkhvlhffgeflvegtggssvfsnfnlpcnsestklekveg
Aquca_017_00553.1|PACid:22031729  ekirfryncervvgldkhdgifligelslyvienfyiddtgcicekqfedelsvidqalgvkk.
Aquca_009_01002.1|PACid:22035007  lleaeevivpgygvvlvntdeagtllvtnfrllfvsegtrkiialgt.................
Aquca_009_00392.1|PACid:22033700  igvmntvfksgp....................................................
Aquca_002_00561.1|PACid:22052141  destliwysgkdekqlklshvsriipgqrtaifqryprpekeyqsfsli...............
Aquca_057_00151.2|PACid:22057633  rnllqgpllkrsetlrkwnerwmildpttgkmeyklrrteavvkgtiifdansnitispvnf..
Aquca_057_00151.1|PACid:22057632  rnllqgpllkrsetlrkwnerwmildpttgkmeyklrrteavvkgtiifdansnitispvnf..
Aquca_013_00711.2|PACid:22060113  vnvagvlykwtnygkgwrsrwfllrngvvsyskirrsenfddvkvigdvssgrlsrldsrgrrk
Aquca_013_00444.4|PACid:22059982  kseekgvvmvhevkcklyvkstdptdkdvwkdrgmgqlsikckegvska...............
Aquca_013_00711.1|PACid:22060112  vnvagvlykwtnygkgwrsrwfllrngvvsyskirrsenfddvkvigdvssgrlsrldsrgrrk
Aquca_013_00510.2|PACid:22059560  eriilelsssmvrplkiirg............................................
Aquca_013_00444.3|PACid:22059981  kseekgvvmvhevkcklyvkstdptdkdvwkdrgmgqlsikckegvska...............
Aquca_013_00444.1|PACid:22059979  kseekgvvmvhevkcklyvkstdptdkdvwkdrgmgqlsikckegvska...............
Aquca_003_00565.2|PACid:22050448  mqrvkvyrlnddgkwddrgtghvtvdylersedl..............................
Aquca_003_00565.1|PACid:22050447  mqrvkvyrlnddgkwddrgtghvtvdylersedl..............................
Aquca_030_00251.2|PACid:22036125  wfpaaqltssgrpvfvtgevestllssvdleceenshvpllksgvliltthrllwinetntsss
Aquca_030_00251.1|PACid:22036124  wfpaaqltssgrpvfvtgevestllssvdleceenshvpllksgvliltthrllwinetntsss
Aquca_021_00082.1|PACid:22039565  akgtiylsnirmvfvankpvgsfvafdmpllyvhgek...........................
Aquca_062_00006.1|PACid:22033292  kdwkmegwlylirsnriglqysrkryfilqdhclkhfksiplsnkqdparsaii..........
Aquca_095_00055.1|PACid:22042414  ffsvrkiddpigllpg................................................
Aquca_095_00055.2|PACid:22042415  ffsvrkiddpigllpg................................................
Aquca_013_00095.4|PACid:22059220  rsarlagylhirtrwtalpgeppiddtdvddwlprfvvlqgsciffyllstdlspqdstllsdv
Aquca_013_00095.5|PACid:22059221  rsarlagylhirtrwtalpgeppiddtdvddwlprfvvlqgsciffyllstdlspqdstllsdv
Aquca_013_00095.1|PACid:22059218  rsarlagylhirtrwtalpgeppiddtdvddwlprfvvlqgsciffyllstdlspqdstllsdv
Aquca_013_00095.2|PACid:22059217  rsarlagylhirtrwtalpgeppiddtdvddwlprfvvlqgsciffyllstdlspqdstllsdv
Aquca_013_00095.3|PACid:22059219  rsarlagylhirtrwtalpgeppiddtdvddwlprfvvlqgsciffyllstdlspqdstllsdv
Aquca_062_00006.4|PACid:22033295  dwkmegwlylirsnriglqysrkryfilqdhclkhfksiplsnkqvlfiftlynts........
Aquca_062_00006.3|PACid:22033294  dwkmegwlylirsnriglqysrkryfilqdhclkhfksiplsnkqvlfiftlynts........
Aquca_013_00444.2|PACid:22059980  kseekgvvmvhevkcklyvkstdptdkdvwkdrgmgq...........................
Aquca_052_00051.1|PACid:22061972  akvvyegwmvrygrrkigrsyihmryf.....................................
Aquca_025_00261.1|PACid:22063132  rakyknsvrdpgiqgvlimmedkisftpddptssvr............................
Aquca_062_00006.2|PACid:22033293  dwkmegwlylirsnriglqysrkryfilqdhclkhfksiplsnkq...................
Aquca_003_00651.4|PACid:22050359  cndnwqkvwgvlkpgflalledpldtklldiivfdvlpasdetgegrvslakemkern......
Aquca_003_00651.3|PACid:22050358  cndnwqkvwgvlkpgflalledpldtklldiivfdvlpasdetgegrvslakemkern......
Aquca_003_00651.2|PACid:22050357  cndnwqkvwgvlkpgflalledpldtklldiivfdvlpasdetgegrvslakemkern......
Aquca_003_00651.1|PACid:22050356  cndnwqkvwgvlkpgflalledpldtklldiivfdvlpasdetgegrvslakemkern......
Aquca_053_00139.2|PACid:22026366  gnreaawrrryiclvgpflyvlespesktykhflslrg..........................
Aquca_053_00139.1|PACid:22026365  gnreaawrrryiclvgpflyvlespesktykhflslrg..........................
Aquca_001_00349.2|PACid:22042989  lyfvlkggellkrtrkgslhwkqvsfhmnshwqvvakmksrhi.....................
Aquca_013_00026.4|PACid:22059852  ylkvgymtappagnpiaphsdwkqsqfvlnhegllqlnkveqkqlsqspsgrmlgav.......
Aquca_001_00349.1|PACid:22042988  lyfvlkggellkrtrkgslhwkqvsfhmnshwqvvakmksrhi.....................
Aquca_013_00026.1|PACid:22059849  ylkvgymtappagnpiaphsdwkqsqfvlnhegllqlnkveqkqlsqspsgrmlgav.......
Aquca_013_00637.1|PACid:22059844  mngedmmrvqtgvtivlgngtpqs........................................
Aquca_013_00026.2|PACid:22059850  sdwkqsqfvlnhegllqlnkveqkqlsqspsgrmlgavnidkpaikv.................
Aquca_035_00006.2|PACid:22061311  sqttinlmgctvlsvsasnlssrkwakrypi.................................
Aquca_035_00006.1|PACid:22061310  sqttinlmgctvlsvsasnlssrkwakrypi.................................
Aquca_035_00160.1|PACid:22061308  ckgdllhlsrkgilhwkrvsvyinkssqviikyksthvggtfskkkkcvv..............


                                                                                                    
                                                                                                    
d1aqca_                             ................................................................
Aquca_002_00505.1|PACid:22051945  dppirkg.........................................................
Aquca_002_00505.2|PACid:22051946  dppirkg.........................................................
Aquca_017_00750.2|PACid:22031339  elf.............................................................
Aquca_017_00750.1|PACid:22031338  lf..............................................................
Aquca_072_00073.1|PACid:22041324  ................................................................
Aquca_004_00240.1|PACid:22029886  t...............................................................
Aquca_081_00021.1|PACid:22040129  ................................................................
Aquca_072_00073.2|PACid:22041325  ................................................................
Aquca_004_00409.1|PACid:22029680  ................................................................
Aquca_020_00435.2|PACid:22025377  tlkicanhfv......................................................
Aquca_020_00435.1|PACid:22025376  tlkicanhfv......................................................
Aquca_002_00517.1|PACid:22053797  plengffflpvpptliimdevnyveiqrrgyggtsmhyfdllvklkseqelvfldirrse....
Aquca_001_00573.1|PACid:22043479  lv..............................................................
Aquca_004_00321.1|PACid:22029546  ................................................................
Aquca_014_00615.1|PACid:22028061  ifqryprpe.......................................................
Aquca_022_00350.1|PACid:22054603  frrylrpekdy.....................................................
Aquca_042_00118.3|PACid:22033050  ................................................................
Aquca_042_00118.1|PACid:22033048  ................................................................
Aquca_042_00118.2|PACid:22033049  ................................................................
Aquca_002_01439.4|PACid:22053791  hrasslgeenlgchtvnl..............................................
Aquca_022_00350.2|PACid:22054604  lrpekdyl........................................................
Aquca_002_01439.1|PACid:22053788  hrasslgeenlgchtvnl..............................................
Aquca_002_01439.2|PACid:22053789  hrasslgeenlgchtvnl..............................................
Aquca_002_01439.3|PACid:22053790  hrasslgeenlgchtvnl..............................................
Aquca_043_00004.5|PACid:22045070  rrffvldsrgmlyyyrkqwtkpsgsgaqlsnhrshsselgsgllsrwlsshhrsgggvhdeksv
Aquca_043_00004.4|PACid:22045069  rrffvldsrgmlyyyrkqwtkpsgsgaqlsnhrshsselgsgllsrwlsshhrsgggvhdeksv
Aquca_019_00085.1|PACid:22055465  syahvtrlasidsfdsrwqkfldpgeaivmistlkkvnklsskkvq..................
Aquca_043_00004.3|PACid:22045068  rrffvldsrgmlyyyrkqwtkpsgsgaqlsnhrshsselgsgllsrwlsshhrsgggvhdeksv
Aquca_043_00004.1|PACid:22045066  rrffvldsrgmlyyyrkqwtkpsgsgaqlsnhrshsselgsgllsrwlsshhrsgggvhdeksv
Aquca_043_00004.2|PACid:22045067  rrffvldsrgmlyyyrkqwtkpsgsgaqlsnhrshsselgsgllsrwlsshhrsgggvhdeksv
Aquca_013_00510.1|PACid:22059559  ................................................................
Aquca_013_00510.3|PACid:22059561  ................................................................
Aquca_002_01359.1|PACid:22052490  ................................................................
Aquca_014_00060.1|PACid:22027782  ................................................................
Aquca_082_00003.1|PACid:22026086  ................................................................
Aquca_004_00805.3|PACid:22030343  ................................................................
Aquca_007_00761.1|PACid:22048687  ................................................................
Aquca_014_00159.2|PACid:22028352  psiprknpv.......................................................
Aquca_014_00159.1|PACid:22028351  psiprknpv.......................................................
Aquca_004_00805.2|PACid:22030342  ................................................................
Aquca_004_00805.1|PACid:22030341  ................................................................
Aquca_031_00080.6|PACid:22050752  ................................................................
Aquca_011_00388.1|PACid:22038252  ................................................................
Aquca_031_00080.5|PACid:22050751  ................................................................
Aquca_031_00080.3|PACid:22050749  ................................................................
Aquca_031_00080.4|PACid:22050750  ................................................................
Aquca_031_00080.1|PACid:22050747  ................................................................
Aquca_031_00080.2|PACid:22050748  ................................................................
Aquca_010_00264.1|PACid:22047425  ahkhtllqsptnlcvdyeksrtsgnpitdh..................................
Aquca_010_00264.2|PACid:22047422  ahkhtllqsptnlcvdyeksrtsgnpitdh..................................
Aquca_010_00264.3|PACid:22047423  ahkhtllqsptnlcvdyeksrtsgnpitdh..................................
Aquca_010_00264.4|PACid:22047424  ahkhtllqsptnlcvdyeksrtsgnpitdh..................................
Aquca_017_00553.1|PACid:22031729  ................................................................
Aquca_009_01002.1|PACid:22035007  ................................................................
Aquca_009_00392.1|PACid:22033700  ................................................................
Aquca_002_00561.1|PACid:22052141  ................................................................
Aquca_057_00151.2|PACid:22057633  ................................................................
Aquca_057_00151.1|PACid:22057632  ................................................................
Aquca_013_00711.2|PACid:22060113  hq..............................................................
Aquca_013_00444.4|PACid:22059982  ................................................................
Aquca_013_00711.1|PACid:22060112  hq..............................................................
Aquca_013_00510.2|PACid:22059560  ................................................................
Aquca_013_00444.3|PACid:22059981  ................................................................
Aquca_013_00444.1|PACid:22059979  ................................................................
Aquca_003_00565.2|PACid:22050448  ................................................................
Aquca_003_00565.1|PACid:22050447  ................................................................
Aquca_030_00251.2|PACid:22036125  aaavaiplgtvthifp................................................
Aquca_030_00251.1|PACid:22036124  aaavaiplgtvthifp................................................
Aquca_021_00082.1|PACid:22039565  ................................................................
Aquca_062_00006.1|PACid:22033292  ................................................................
Aquca_095_00055.1|PACid:22042414  ................................................................
Aquca_095_00055.2|PACid:22042415  ................................................................
Aquca_013_00095.4|PACid:22059220  veviplss........................................................
Aquca_013_00095.5|PACid:22059221  veviplss........................................................
Aquca_013_00095.1|PACid:22059218  veviplss........................................................
Aquca_013_00095.2|PACid:22059217  veviplss........................................................
Aquca_013_00095.3|PACid:22059219  veviplss........................................................
Aquca_062_00006.4|PACid:22033295  ................................................................
Aquca_062_00006.3|PACid:22033294  ................................................................
Aquca_013_00444.2|PACid:22059980  ................................................................
Aquca_052_00051.1|PACid:22061972  ................................................................
Aquca_025_00261.1|PACid:22063132  ................................................................
Aquca_062_00006.2|PACid:22033293  ................................................................
Aquca_003_00651.4|PACid:22050359  ................................................................
Aquca_003_00651.3|PACid:22050358  ................................................................
Aquca_003_00651.2|PACid:22050357  ................................................................
Aquca_003_00651.1|PACid:22050356  ................................................................
Aquca_053_00139.2|PACid:22026366  ................................................................
Aquca_053_00139.1|PACid:22026365  ................................................................
Aquca_001_00349.2|PACid:22042989  ................................................................
Aquca_013_00026.4|PACid:22059852  ................................................................
Aquca_001_00349.1|PACid:22042988  ................................................................
Aquca_013_00026.1|PACid:22059849  ................................................................
Aquca_013_00637.1|PACid:22059844  ................................................................
Aquca_013_00026.2|PACid:22059850  ................................................................
Aquca_035_00006.2|PACid:22061311  ................................................................
Aquca_035_00006.1|PACid:22061310  ................................................................
Aquca_035_00160.1|PACid:22061308  ................................................................


                                                      10        20        30        40        50    
                                                       |         |         |         |         |    
d1aqca_                             ..........-EDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLAKSRKK
Aquca_002_00505.1|PACid:22051945  ..........------------------------------------------------------
Aquca_002_00505.2|PACid:22051946  ..........------------------------------------------------------
Aquca_017_00750.2|PACid:22031339  ..........------------------------------------------------------
Aquca_017_00750.1|PACid:22031338  ..........------------------------------------------------------
Aquca_072_00073.1|PACid:22041324  ..........------------------------------------------------------
Aquca_004_00240.1|PACid:22029886  ..........------------------------------------------------------
Aquca_081_00021.1|PACid:22040129  ..........------------------------------------------------------
Aquca_072_00073.2|PACid:22041325  ..........------------------------------------------------------
Aquca_004_00409.1|PACid:22029680  ..........------------------------------------------------------
Aquca_020_00435.2|PACid:22025377  ..........------------------------------------------------------
Aquca_020_00435.1|PACid:22025376  ..........------------------------------------------------------
Aquca_002_00517.1|PACid:22053797  ..........------------------------------------------------------
Aquca_001_00573.1|PACid:22043479  ..........------------------------------------------------------
Aquca_004_00321.1|PACid:22029546  ..........------------------------------------------------------
Aquca_014_00615.1|PACid:22028061  ..........------------------------------------------------------
Aquca_022_00350.1|PACid:22054603  ..........------------------------------------------------------
Aquca_042_00118.3|PACid:22033050  ..........------------------------------------------------------
Aquca_042_00118.1|PACid:22033048  ..........------------------------------------------------------
Aquca_042_00118.2|PACid:22033049  ..........------------------------------------------------------
Aquca_002_01439.4|PACid:22053791  ..........------------------------------------------------------
Aquca_022_00350.2|PACid:22054604  ..........------------------------------------------------------
Aquca_002_01439.1|PACid:22053788  ..........------------------------------------------------------
Aquca_002_01439.2|PACid:22053789  ..........------------------------------------------------------
Aquca_002_01439.3|PACid:22053790  ..........------------------------------------------------------
Aquca_043_00004.5|PACid:22045070  ahhtvnllts------------------------------------------------------
Aquca_043_00004.4|PACid:22045069  ahhtvnllts------------------------------------------------------
Aquca_019_00085.1|PACid:22055465  ..........------------------------------------------------------
Aquca_043_00004.3|PACid:22045068  ahhtvnllts------------------------------------------------------
Aquca_043_00004.1|PACid:22045066  ahhtvnllts------------------------------------------------------
Aquca_043_00004.2|PACid:22045067  ahhtvnllts------------------------------------------------------
Aquca_013_00510.1|PACid:22059559  ..........------------------------------------------------------
Aquca_013_00510.3|PACid:22059561  ..........------------------------------------------------------
Aquca_002_01359.1|PACid:22052490  ..........--------------------------------------I---------------
Aquca_014_00060.1|PACid:22027782  ..........------------------------------------------------K-----
Aquca_082_00003.1|PACid:22026086  ..........------------------------------------------------------
Aquca_004_00805.3|PACid:22030343  ..........------------------------------------------------------
Aquca_007_00761.1|PACid:22048687  ..........------------------------------------------------------
Aquca_014_00159.2|PACid:22028352  ..........------------------------------------------------------
Aquca_014_00159.1|PACid:22028351  ..........------------------------------------------------------
Aquca_004_00805.2|PACid:22030342  ..........------------------------------------------------------
Aquca_004_00805.1|PACid:22030341  ..........------------------------------------------------------
Aquca_031_00080.6|PACid:22050752  ..........------------------------------------------------------
Aquca_011_00388.1|PACid:22038252  ..........---------------------------EKSATVIGEESLRYIRKASWGNGF--S
Aquca_031_00080.5|PACid:22050751  ..........------------------------------------------------------
Aquca_031_00080.3|PACid:22050749  ..........------------------------------------------------------
Aquca_031_00080.4|PACid:22050750  ..........------------------------------------------------------
Aquca_031_00080.1|PACid:22050747  ..........------------------------------------------------------
Aquca_031_00080.2|PACid:22050748  ..........------------------------------------------------------
Aquca_010_00264.1|PACid:22047425  ..........------------------------------------------------------
Aquca_010_00264.2|PACid:22047422  ..........------------------------------------------------------
Aquca_010_00264.3|PACid:22047423  ..........------------------------------------------------------
Aquca_010_00264.4|PACid:22047424  ..........------------------------------------------------------
Aquca_017_00553.1|PACid:22031729  ..........------------------------------------------------------
Aquca_009_01002.1|PACid:22035007  ..........-----------------------------------------------I------
Aquca_009_00392.1|PACid:22033700  ..........------------------------------------------------------
Aquca_002_00561.1|PACid:22052141  ..........------------------------------------------------------
Aquca_057_00151.2|PACid:22057633  ..........------------------------------------------------------
Aquca_057_00151.1|PACid:22057632  ..........------------------------------------------------------
Aquca_013_00711.2|PACid:22060113  ..........------------------------------------------------------
Aquca_013_00444.4|PACid:22059982  ..........------------------------------------------T-----------
Aquca_013_00711.1|PACid:22060112  ..........------------------------------------------------------
Aquca_013_00510.2|PACid:22059560  ..........------------------------------------------------------
Aquca_013_00444.3|PACid:22059981  ..........------------------------------------------T-----------
Aquca_013_00444.1|PACid:22059979  ..........------------------------------------------T-----------
Aquca_003_00565.2|PACid:22050448  ..........------------------------------------------------------
Aquca_003_00565.1|PACid:22050447  ..........------------------------------------------------------
Aquca_030_00251.2|PACid:22036125  ..........----------------------------------------------------PK
Aquca_030_00251.1|PACid:22036124  ..........----------------------------------------------------PK
Aquca_021_00082.1|PACid:22039565  ..........------------------------------------------------------
Aquca_062_00006.1|PACid:22033292  ..........------------------------------------------------------
Aquca_095_00055.1|PACid:22042414  ..........------------------------------------------------------
Aquca_095_00055.2|PACid:22042415  ..........------------------------------------------------------
Aquca_013_00095.4|PACid:22059220  ..........------------------------------------------------------
Aquca_013_00095.5|PACid:22059221  ..........------------------------------------------------------
Aquca_013_00095.1|PACid:22059218  ..........------------------------------------------------------
Aquca_013_00095.2|PACid:22059217  ..........------------------------------------------------------
Aquca_013_00095.3|PACid:22059219  ..........------------------------------------------------------
Aquca_062_00006.4|PACid:22033295  ..........------------------------------------------------------
Aquca_062_00006.3|PACid:22033294  ..........------------------------------------------------------
Aquca_013_00444.2|PACid:22059980  ..........------------------------------------------------------
Aquca_052_00051.1|PACid:22061972  ..........------------------------------------------VLESRLLAYYKK
Aquca_025_00261.1|PACid:22063132  ..........------------------------------------------------------
Aquca_062_00006.2|PACid:22033293  ..........------------------------------------------------------
Aquca_003_00651.4|PACid:22050359  ..........------------------------------------------------------
Aquca_003_00651.3|PACid:22050358  ..........------------------------------------------------------
Aquca_003_00651.2|PACid:22050357  ..........------------------------------------------------------
Aquca_003_00651.1|PACid:22050356  ..........------------------------------------------------------
Aquca_053_00139.2|PACid:22026366  ..........------------------------------------------------------
Aquca_053_00139.1|PACid:22026365  ..........------------------------------------------------------
Aquca_001_00349.2|PACid:22042989  ..........-----------------------------------------------V------
Aquca_013_00026.4|PACid:22059852  ..........------------------N-----------------------------------
Aquca_001_00349.1|PACid:22042988  ..........-----------------------------------------------V------
Aquca_013_00026.1|PACid:22059849  ..........------------------N-----------------------------------
Aquca_013_00637.1|PACid:22059844  ..........------------------------------------------------------
Aquca_013_00026.2|PACid:22059850  ..........------------------------------------------------------
Aquca_035_00006.2|PACid:22061311  ..........------------------------------------------------------
Aquca_035_00006.1|PACid:22061310  ..........------------------------------------------------------
Aquca_035_00160.1|PACid:22061308  ..........------------------------------------------------------


                                        60        70         80        90       100       110       
                                         |         |          |         |         |         |       
d1aqca_                             APEGESQPMTEVDLFI.LTQRIKVLNADTQETMMDHPLRTISYIADIGNIVVLMARRRIPRSNS
Aquca_002_00505.1|PACid:22051945  ----------------.-----------------------------------------------
Aquca_002_00505.2|PACid:22051946  ----------------.-----------------------------------------------
Aquca_017_00750.2|PACid:22031339  ----------------.-----------------------------------------------
Aquca_017_00750.1|PACid:22031338  ----------------.-----------------------------------------------
Aquca_072_00073.1|PACid:22041324  ----------------.-----I-----------------------------------------
Aquca_004_00240.1|PACid:22029886  ----------------.-------------D---------------------------------
Aquca_081_00021.1|PACid:22040129  ----------------.-------------------------------------W---------
Aquca_072_00073.2|PACid:22041325  ----------------.-----------------------------------------------
Aquca_004_00409.1|PACid:22029680  ------------TLKI.CANHLILPGMAVQE----HSGNEKSCVW-------------------
Aquca_020_00435.2|PACid:22025377  ----------------.------I----------------------------------------
Aquca_020_00435.1|PACid:22025376  ----------------.------I----------------------------------------
Aquca_002_00517.1|PACid:22053797  --------YDNLIMFI.SEKGLKIH---------------------------------------
Aquca_001_00573.1|PACid:22043479  ---------L------.-----------------------------------------------
Aquca_004_00321.1|PACid:22029546  ----------------.-----------------------------------------------
Aquca_014_00615.1|PACid:22028061  ------K---------.-----------------------------------------------
Aquca_022_00350.1|PACid:22054603  ----------------.-----------------------L-----------------------
Aquca_042_00118.3|PACid:22033050  ----------------.--------------V--------------------------------
Aquca_042_00118.1|PACid:22033048  ----------------.--------------V--------------------------------
Aquca_042_00118.2|PACid:22033049  ----------------.--------------V--------------------------------
Aquca_002_01439.4|PACid:22053791  --------------R-.-----------------------------------------------
Aquca_022_00350.2|PACid:22054604  ----------------.------------------------S----------------------
Aquca_002_01439.1|PACid:22053788  --------------R-.-----------------------------------------------
Aquca_002_01439.2|PACid:22053789  --------------R-.-----------------------------------------------
Aquca_002_01439.3|PACid:22053790  --------------R-.-----------------------------------------------
Aquca_043_00004.5|PACid:22045070  ----------------.-------------T---------------------------------
Aquca_043_00004.4|PACid:22045069  ----------------.-------------T---------------------------------
Aquca_019_00085.1|PACid:22055465  ----------------.------L----------------------------------------
Aquca_043_00004.3|PACid:22045068  ----------------.-------------T---------------------------------
Aquca_043_00004.1|PACid:22045066  ----------------.-------------T---------------------------------
Aquca_043_00004.2|PACid:22045067  ----------------.-------------T---------------------------------
Aquca_013_00510.1|PACid:22059559  ------------TFQI.TTRRINFIVNDHDDNVME-----------------------------
Aquca_013_00510.3|PACid:22059561  ------------TFQI.TTRRINFIVNDHDDNVME-----------------------------
Aquca_002_01359.1|PACid:22052490  ----------------.-----------------------------------------------
Aquca_014_00060.1|PACid:22027782  ----------------.-----------------------------------------------
Aquca_082_00003.1|PACid:22026086  ----------------.---SLRRITRKRNHHSHHHHTHSHNY---------------------
Aquca_004_00805.3|PACid:22030343  ----------------.-----------------T-----------------------------
Aquca_007_00761.1|PACid:22048687  ----SFLPMTSV----.-----------------------------------------------
Aquca_014_00159.2|PACid:22028352  ---------GEVHLKV.S----------------------------------------------
Aquca_014_00159.1|PACid:22028351  ---------GEVHLKV.S----------------------------------------------
Aquca_004_00805.2|PACid:22030342  ----------------.-----------------T-----------------------------
Aquca_004_00805.1|PACid:22030341  ----------------.-----------------T-----------------------------
Aquca_031_00080.6|PACid:22050752  -------------LLI.SSKGIGWTSWKKRW---------------------------------
Aquca_011_00388.1|PACid:22038252  VSGKRWKPFGEIHLKV.SS--IRA----------------------------------------
Aquca_031_00080.5|PACid:22050751  -------------LLI.SSKGIGWTSWKKRW---------------------------------
Aquca_031_00080.3|PACid:22050749  -------------LLI.SSKGIGWTSWKKRW---------------------------------
Aquca_031_00080.4|PACid:22050750  -------------LLI.SSKGIGWTSWKKRW---------------------------------
Aquca_031_00080.1|PACid:22050747  -------------LLI.SSKGIGWTSWKKRW---------------------------------
Aquca_031_00080.2|PACid:22050748  -------------LLI.SSKGIGWTSWKKRW---------------------------------
Aquca_010_00264.1|PACid:22047425  ----------------.------------------------------E----------------
Aquca_010_00264.2|PACid:22047422  ----------------.------------------------------E----------------
Aquca_010_00264.3|PACid:22047423  ----------------.------------------------------E----------------
Aquca_010_00264.4|PACid:22047424  ----------------.------------------------------E----------------
Aquca_017_00553.1|PACid:22031729  ----------------.---------------------------------------------D-
Aquca_009_01002.1|PACid:22035007  ----------------.-----------------------------------------------
Aquca_009_00392.1|PACid:22033700  -------------LFI.SSRGIGWKSWKK-----------------------------------
Aquca_002_00561.1|PACid:22052141  ----------------.-----------------------------------------------
Aquca_057_00151.2|PACid:22057633  ----------------.---------------------H-------------------------
Aquca_057_00151.1|PACid:22057632  ----------------.---------------------H-------------------------
Aquca_013_00711.2|PACid:22060113  ----------------.-------------K---------------------------------
Aquca_013_00444.4|PACid:22059982  ----------------.-----------------------------------------------
Aquca_013_00711.1|PACid:22060112  ----------------.-------------K---------------------------------
Aquca_013_00510.2|PACid:22059560  ------------TFQI.TTRRINFIVNDHDDNVME-----------------------------
Aquca_013_00444.3|PACid:22059981  ----------------.-----------------------------------------------
Aquca_013_00444.1|PACid:22059979  ----------------.-----------------------------------------------
Aquca_003_00565.2|PACid:22050448  ----------------.---GLFVTDEEDNETLLAHRIRSD-----------------------
Aquca_003_00565.1|PACid:22050447  ----------------.---GLFVTDEEDNETLLAHRIRSD-----------------------
Aquca_030_00251.2|PACid:22036125  KSMKHMFASPRVRFQV.ST---------------------------------------------
Aquca_030_00251.1|PACid:22036124  KSMKHMFASPRVRFQV.ST---------------------------------------------
Aquca_021_00082.1|PACid:22039565  ----------------.-----------------------------------------------
Aquca_062_00006.1|PACid:22033292  ----------------.-D---------------------------------------------
Aquca_095_00055.1|PACid:22042414  ----------RIVLGI.NKRGVHFFRPVPKEYLHSAELRDIMQFGSSNTAVFFKMRVAGV----
Aquca_095_00055.2|PACid:22042415  ----------RIVLGI.NKRGVHFFRPVPKEYLHSAELRDIMQFGSSNTAVFFKMRVAGV----
Aquca_013_00095.4|PACid:22059220  ----------------.-----------------------------------------S-----
Aquca_013_00095.5|PACid:22059221  ----------------.-----------------------------------------S-----
Aquca_013_00095.1|PACid:22059218  ----------------.-----------------------------------------S-----
Aquca_013_00095.2|PACid:22059217  ----------------.-----------------------------------------S-----
Aquca_013_00095.3|PACid:22059219  ----------------.-----------------------------------------S-----
Aquca_062_00006.4|PACid:22033295  ----------------.--------------------------------------------N--
Aquca_062_00006.3|PACid:22033294  ----------------.--------------------------------------------N--
Aquca_013_00444.2|PACid:22059980  ----------------.-----------------------L-----------------------
Aquca_052_00051.1|PACid:22061972  KPQDNVVP--------.-----------------------------------------------
Aquca_025_00261.1|PACid:22063132  -----------VNIEVkSIKSLKFSKEGS-----------------------------------
Aquca_062_00006.2|PACid:22033293  ----------------.---------------------------------------------D-
Aquca_003_00651.4|PACid:22050359  -P--------------.-----------------------------------------------
Aquca_003_00651.3|PACid:22050358  -P--------------.-----------------------------------------------
Aquca_003_00651.2|PACid:22050357  -P--------------.-----------------------------------------------
Aquca_003_00651.1|PACid:22050356  -P--------------.-----------------------------------------------
Aquca_053_00139.2|PACid:22026366  ----------------.-----------------------K-----------------------
Aquca_053_00139.1|PACid:22026365  ----------------.-----------------------K-----------------------
Aquca_001_00349.2|PACid:22042989  ----------------.-----------------------------------------------
Aquca_013_00026.4|PACid:22059852  ----------------.-----------------------------------------------
Aquca_001_00349.1|PACid:22042988  ----------------.-----------------------------------------------
Aquca_013_00026.1|PACid:22059849  ----------------.-----------------------------------------------
Aquca_013_00637.1|PACid:22059844  ----------PGTLYI.TTKRVIWLNDVDKEIGYVVDFLSISLHA-------------------
Aquca_013_00026.2|PACid:22059850  ----D-----------.-----------------------------------------------
Aquca_035_00006.2|PACid:22061311  ------------K---.-----------------------------------------------
Aquca_035_00006.1|PACid:22061310  ------------K---.-----------------------------------------------
Aquca_035_00160.1|PACid:22061308  ----------------.-----------------------Y-----------------------


                                    120       130       140       150       160                     
                                      |         |         |         |         |                     
d1aqca_                             QENVEASHPSQDGKRQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR...............
Aquca_002_00505.1|PACid:22051945  -------------Q-----------------------------------tlyphivlqfetdfv
Aquca_002_00505.2|PACid:22051946  -------------Q-----------------------------------tlyphivlqfetdfv
Aquca_017_00750.2|PACid:22031339  ------------------A------------------------------acfvlpgqrensvet
Aquca_017_00750.1|PACid:22031338  ------------------A------------------------------acfvlpgqrensvet
Aquca_072_00073.1|PACid:22041324  -------------------------------------------------vmnrrntdnlvenll
Aquca_004_00240.1|PACid:22029886  -------------------------------------------------nlvenllgdfeyevq
Aquca_081_00021.1|PACid:22040129  -------------------------------------------------egtlkviskgeecii
Aquca_072_00073.2|PACid:22041325  -------F-----------------------------------------ivmnrrntenllgdf
Aquca_004_00409.1|PACid:22029680  -------------------------------------------------hatdfsdeelkqeff
Aquca_020_00435.2|PACid:22025377  -------------------------------------------------pttsvqehagneksc
Aquca_020_00435.1|PACid:22025376  -------------------------------------------------pttsvqehagneksc
Aquca_002_00517.1|PACid:22053797  -------------------------------------------------n..............
Aquca_001_00573.1|PACid:22043479  -------------------------------------------------naalfpdmkltsmek
Aquca_004_00321.1|PACid:22029546  ----------------------------A--------------------edvlnkqfafelstn
Aquca_014_00615.1|PACid:22028061  -------------------------------------------------eyqsfsliysdrsld
Aquca_022_00350.1|PACid:22054603  -------------------------------------------------sfsliynngkrsldl
Aquca_042_00118.3|PACid:22033050  -------------------------------------------------frrfprpekdylsfs
Aquca_042_00118.1|PACid:22033048  -------------------------------------------------frrfprpekdylsfs
Aquca_042_00118.2|PACid:22033049  -------------------------------------------------frrfprpekdylsfs
Aquca_002_01439.4|PACid:22053791  -------------------------------------------------mstikidaehsdlrl
Aquca_022_00350.2|PACid:22054604  -------------------------------------------------fsliynngkrsldli
Aquca_002_01439.1|PACid:22053788  -------------------------------------------------mstikidaehsdlrl
Aquca_002_01439.2|PACid:22053789  -------------------------------------------------mstikidaehsdlrl
Aquca_002_01439.3|PACid:22053790  -------------------------------------------------mstikidaehsdlrl
Aquca_043_00004.5|PACid:22045070  -------------------------------------------------ikvdadqsdlrfcfr
Aquca_043_00004.4|PACid:22045069  -------------------------------------------------ikvdadqsdlrfcfr
Aquca_019_00085.1|PACid:22055465  -------------------------------------------------iltdkpklicidpak
Aquca_043_00004.3|PACid:22045068  -------------------------------------------------ikvdadqsdlrfcfr
Aquca_043_00004.1|PACid:22045066  -------------------------------------------------ikvdadqsdlrfcfr
Aquca_043_00004.2|PACid:22045067  -------------------------------------------------ikvdadqsdlrfcfr
Aquca_013_00510.1|PACid:22059559  -------------------------------------------------dgndtssrnrdrerd
Aquca_013_00510.3|PACid:22059561  -------------------------------------------------dgndtssrnrdrerd
Aquca_002_01359.1|PACid:22052490  -------------------------------------------------tkiipgtvnfqrqpe
Aquca_014_00060.1|PACid:22027782  -------------------------------------------------sskdkkangpdgkgp
Aquca_082_00003.1|PACid:22026086  -------------------------------------------------nnnnslgqnqfnpnp
Aquca_004_00805.3|PACid:22030343  -------------------------------------------------rtslvffkndpselp
Aquca_007_00761.1|PACid:22048687  -------------------------------------------------qehagnekscvwhat
Aquca_014_00159.2|PACid:22028352  -------------------------------------------------siresrsddkrfsif
Aquca_014_00159.1|PACid:22028351  -------------------------------------------------siresrsddkrfsif
Aquca_004_00805.2|PACid:22030342  -------------------------------------------------rtslvffkndpselp
Aquca_004_00805.1|PACid:22030341  -------------------------------------------------rtslvffkndpselp
Aquca_031_00080.6|PACid:22050752  -------------------------------------------------filtrtslvffrsdp
Aquca_011_00388.1|PACid:22038252  -------------------------------------------------sksddkrlsiftgtk
Aquca_031_00080.5|PACid:22050751  -------------------------------------------------filtrtslvffrsdp
Aquca_031_00080.3|PACid:22050749  -------------------------------------------------filtrtslvffrsdp
Aquca_031_00080.4|PACid:22050750  -------------------------------------------------filtrtslvffrsdp
Aquca_031_00080.1|PACid:22050747  -------------------------------------------------filtrtslvffrsdp
Aquca_031_00080.2|PACid:22050748  -------------------------------------------------filtrtslvffrsdp
Aquca_010_00264.1|PACid:22047425  -------------------------------------------------pllsklpkikrhrrw
Aquca_010_00264.2|PACid:22047422  -------------------------------------------------pllsklpkikrhrrw
Aquca_010_00264.3|PACid:22047423  -------------------------------------------------pllsklpkikrhrrw
Aquca_010_00264.4|PACid:22047424  -------------------------------------------------pllsklpkikrhrrw
Aquca_017_00553.1|PACid:22031729  -------------------------------------------------sgsmdfqsksssswg
Aquca_009_01002.1|PACid:22035007  -------------------------------------------------platiekfsklvmkp
Aquca_009_00392.1|PACid:22033700  -------------------------------------------------rwfiltrtslvffkn
Aquca_002_00561.1|PACid:22052141  S------------------------------------------------ndrsldlickdkdea
Aquca_057_00151.2|PACid:22057633  -------------------------------------------------glpkydgccfyigtp
Aquca_057_00151.1|PACid:22057632  -------------------------------------------------glpkydgccfyigtp
Aquca_013_00711.2|PACid:22060113  -------------------------------------------------svgfvhlkvssfres
Aquca_013_00444.4|PACid:22059982  -------------------------------------------------keskptivvrndvgk
Aquca_013_00711.1|PACid:22060112  -------------------------------------------------svgfvhlkvssfres
Aquca_013_00510.2|PACid:22059560  -------------------------------------------------dgndtssrnrdrerd
Aquca_013_00444.3|PACid:22059981  -------------------------------------------------keskptivvrndvgk
Aquca_013_00444.1|PACid:22059979  -------------------------------------------------keskptivvrndvgk
Aquca_003_00565.2|PACid:22050448  -------------------------------------------------eiyrrqedtiiswrd
Aquca_003_00565.1|PACid:22050447  -------------------------------------------------eiyrrqedtiiswrd
Aquca_030_00251.2|PACid:22036125  -------------------------------------------------svdgmviengqksmv
Aquca_030_00251.1|PACid:22036124  -------------------------------------------------svdgmviengqksmv
Aquca_021_00082.1|PACid:22039565  -------------F-----------------------------------nqpifhcnnisglve
Aquca_062_00006.1|PACid:22033292  -------------------------------------------------scirvtdngresihr
Aquca_095_00055.1|PACid:22042414  --LHIFQFETK--------------------------------------qgeeicvalqthind
Aquca_095_00055.2|PACid:22042415  --LHIFQFETK--------------------------------------qgeeicvalqthind
Aquca_013_00095.4|PACid:22059220  -------------------------------------------------ihedgqrfifhvltr
Aquca_013_00095.5|PACid:22059221  -------------------------------------------------ihedgqrfifhvltr
Aquca_013_00095.1|PACid:22059218  -------------------------------------------------ihedgqrfifhvltr
Aquca_013_00095.2|PACid:22059217  -------------------------------------------------ihedgqrfifhvltr
Aquca_013_00095.3|PACid:22059219  -------------------------------------------------ihedgqrfifhvltr
Aquca_062_00006.4|PACid:22033295  -------------------------------------------------hndqlklgasspeea
Aquca_062_00006.3|PACid:22033294  -------------------------------------------------hndqlklgasspeea
Aquca_013_00444.2|PACid:22059980  -------------------------------------------------sikckegvskatkes
Aquca_052_00051.1|PACid:22061972  -------------------------------------------------iktllidgncrvedr
Aquca_025_00261.1|PACid:22063132  -------------------------------------------------qrallnlildpdike
Aquca_062_00006.2|PACid:22033293  -------------------------------------------------parsaiidscirvtd
Aquca_003_00651.4|PACid:22050359  -------------------------------------------------lryafkiscgnqnvk
Aquca_003_00651.3|PACid:22050358  -------------------------------------------------lryafkiscgnqnvk
Aquca_003_00651.2|PACid:22050357  -------------------------------------------------lryafkiscgnqnvk
Aquca_003_00651.1|PACid:22050356  -------------------------------------------------lryafkiscgnqnvk
Aquca_053_00139.2|PACid:22026366  -------------------------------------------------qvyqvpteftgnveh
Aquca_053_00139.1|PACid:22026365  -------------------------------------------------qvyqvpteftgnveh
Aquca_001_00349.2|PACid:22042989  -------------------------------------------------gtftkkkkclvlgvs
Aquca_013_00026.4|PACid:22059852  -------------------------------------------------idkpaikvdipdiis
Aquca_001_00349.1|PACid:22042988  -------------------------------------------------gtftkkkkclvlgvs
Aquca_013_00026.1|PACid:22059849  -------------------------------------------------idkpaikvdipdiis
Aquca_013_00637.1|PACid:22059844  -------------------------------------------------isrdpdsypspciya
Aquca_013_00026.2|PACid:22059850  -------------------------------------------------ipdiisvsacadltl
Aquca_035_00006.2|PACid:22061311  -------------------------------------------------vesgssviykgskic
Aquca_035_00006.1|PACid:22061310  -------------------------------------------------vesgssviykgskic
Aquca_035_00160.1|PACid:22061308  -------------------------------------------------sfcdgiftwqmsdni


                                                                                                    
                                                                                                    
d1aqca_                             ................................................................
Aquca_002_00505.1|PACid:22051945  vestlsmsedllnnkykeklqlsykglihevfttilrglsgakvtrpgkfrsrqngyavksslk
Aquca_002_00505.2|PACid:22051946  vestlsmsedllnnkykeklqlsykglihevfttilrglsgakvtrpgkfrsrqngyavksslk
Aquca_017_00750.2|PACid:22031339  vldssryfvlkiedgrgkhafiglgfaerneafdfnvalsdhekyvkr................
Aquca_017_00750.1|PACid:22031338  vldssryfvlkiedgrgkhafiglgfaerneafdfnvalsdhekyvkr................
Aquca_072_00073.1|PACid:22041324  gdfeyeiqtpyllyrnasqdvngiwfyntsdcedvanlfsrilnaysk................
Aquca_004_00240.1|PACid:22029886  vpyllyrnaaqevngiwfynsrecedvanlfsrilnaysk........................
Aquca_081_00021.1|PACid:22040129  kledkttgelyaraflrngephpvepvidssryfvlrveenidgrlrhafigigfrerpqaydf
Aquca_072_00073.2|PACid:22041325  eyeiqtpyllyrnasqdvngiwfyntsdcedvanlfsrilnaysk...................
Aquca_004_00409.1|PACid:22029680  cirfgsvenckafmrkfeeva...........................................
Aquca_020_00435.2|PACid:22025377  vwhatdysdgelkeelfcirfasienckafkemvqeva..........................
Aquca_020_00435.1|PACid:22025376  vwhatdysdgelkeelfcirfasienckafkemvqeva..........................
Aquca_002_00517.1|PACid:22053797  ................................................................
Aquca_001_00573.1|PACid:22043479  rgitfacmnstgegkdglttfalkfkdisvveefrtavt.........................
Aquca_004_00321.1|PACid:22029546  setmyfiadsdkekeewinsigrsiv......................................
Aquca_014_00615.1|PACid:22028061  lickdkdeaevwfvglkali............................................
Aquca_022_00350.1|PACid:22054603  ickdkveaevwivglkali.............................................
Aquca_042_00118.3|PACid:22033050  llynngersldlickdkvetelwfaglkali.................................
Aquca_042_00118.1|PACid:22033048  llynngersldlickdkvetelwfaglkali.................................
Aquca_042_00118.2|PACid:22033049  llynngersldlickdkvetelwfaglkali.................................
Aquca_002_01439.4|PACid:22053791  cfriispsktytlqaeneaermdwvdkirgviaslltspfldkdvnvns...............
Aquca_022_00350.2|PACid:22054604  ckdkveaevwivglkali..............................................
Aquca_002_01439.1|PACid:22053788  cfriispsktytlqaeneaermdwvdkirgviaslltspfldkdvnvns...............
Aquca_002_01439.2|PACid:22053789  cfriispsktytlqaeneaermdwvdkirgviaslltspfldkdvnvns...............
Aquca_002_01439.3|PACid:22053790  cfriispsktytlqaeneaermdwvdkirgviaslltspfldkdvnvns...............
Aquca_043_00004.5|PACid:22045070  iispsknytlqaesamdqmdwiekitgvi...................................
Aquca_043_00004.4|PACid:22045069  iispsknytlqaesamdqmdwiekitgvi...................................
Aquca_019_00085.1|PACid:22055465  lmlkgniiwsdnpndlsiqvissshfklctpkkvrsfedakqrawqwkkaieglqn........
Aquca_043_00004.3|PACid:22045068  iispsknytlqaesamdqmdwiekitgvi...................................
Aquca_043_00004.1|PACid:22045066  iispsknytlqaesamdqmdwiekitgvi...................................
Aquca_043_00004.2|PACid:22045067  iispsknytlqaesamdqmdwiekitgvi...................................
Aquca_013_00510.1|PACid:22059559  rswlmsslhqmfsrryllrrsalelfmvdrsnfffdfgsiegrknayraivqar..........
Aquca_013_00510.3|PACid:22059561  rswlmsslhqmfsrryllrrsalelfmvdrsnfffdfgsiegrknayraivqar..........
Aquca_002_01359.1|PACid:22052490  pgkecqsfsiiyaygersldlvckdkvqaeswlvglralv........................
Aquca_014_00060.1|PACid:22027782  slvfkitskvpyktvlkahsavvlkaesmadkvewmnkirkvis....................
Aquca_082_00003.1|PACid:22026086  vgevhlkvssiresksddkrfsiftgtkrvhlraetqddratwmetlqamkdmfprmsn.....
Aquca_004_00805.3|PACid:22030343  qrggevnltlggidlnnsgsvvvredkklltvlfpdgrdgrgftlkaessedlyewktalehal
Aquca_007_00761.1|PACid:22048687  dfskgglfciqfisienckvfke.........................................
Aquca_014_00159.2|PACid:22028352  tgtkrlhlradaredrvawmealqamkdmfprm...............................
Aquca_014_00159.1|PACid:22028351  tgtkrlhlradaredrvawmealqamkdmfprm...............................
Aquca_004_00805.2|PACid:22030342  qrggevnltlggidlnnsgsvvvredkklltvlfpdgrdgrgftlkaessedlyewktalehal
Aquca_004_00805.1|PACid:22030341  qrggevnltlggidlnnsgsvvvredkklltvlfpdgrdgrgftlkaessedlyewktalehal
Aquca_031_00080.6|PACid:22050752  svipqkgsevnltlggidlnnsgsvvvkedkklltvlfpdgrdgraftlkaessedlhdwktal
Aquca_011_00388.1|PACid:22038252  tlhlrcisredraawieallask.........................................
Aquca_031_00080.5|PACid:22050751  svipqkgsevnltlggidlnnsgsvvvkedkklltvlfpdgrdgraftlkaessedlhdwktal
Aquca_031_00080.3|PACid:22050749  svipqkgsevnltlggidlnnsgsvvvkedkklltvlfpdgrdgraftlkaessedlhdwktal
Aquca_031_00080.4|PACid:22050750  svipqkgsevnltlggidlnnsgsvvvkedkklltvlfpdgrdgraftlkaessedlhdwktal
Aquca_031_00080.1|PACid:22050747  svipqkgsevnltlggidlnnsgsvvvkedkklltvlfpdgrdgraftlkaessedlhdwktal
Aquca_031_00080.2|PACid:22050748  svipqkgsevnltlggidlnnsgsvvvkedkklltvlfpdgrdgraftlkaessedlhdwktal
Aquca_010_00264.1|PACid:22047425  svsrvksvhwtryllrytaieiffddsvapvffnfashkaakdvgilivs..............
Aquca_010_00264.2|PACid:22047422  svsrvksvhwtryllrytaieiffddsvapvffnfashkaakdvgilivs..............
Aquca_010_00264.3|PACid:22047423  svsrvksvhwtryllrytaieiffddsvapvffnfashkaakdvgilivs..............
Aquca_010_00264.4|PACid:22047424  svsrvksvhwtryllrytaieiffddsvapvffnfashkaakdvgilivs..............
Aquca_017_00553.1|PACid:22031729  vtvkscvggrawaynggawgkekvssggnlphlwrmwnldsiheilkrdyqlrpvaveifsmdg
Aquca_009_01002.1|PACid:22035007  pstsrppdksrprrllqiigkdmriivfgfrpktkqrrnvfdalwrwtrpaglrdlytft....
Aquca_009_00392.1|PACid:22033700  dpsalpqkggevnltlggidlnnsgsvvvredkklltvlfpdgregrgftlkaetsedlfewkt
Aquca_002_00561.1|PACid:22052141  evwfvglkali.....................................................
Aquca_057_00151.2|PACid:22057633  qkkeyylcaetpgaarawvstlh.........................................
Aquca_057_00151.1|PACid:22057632  qkkeyylcaetpgaarawvstlh.........................................
Aquca_013_00711.2|PACid:22060113  raddrrfyiftatktlhlrtdskkdrvawiqalvs.............................
Aquca_013_00444.4|PACid:22059982  illnallypgiktnlvknaiaaifhtsgdangndvatngvvartyliktkteedrnklasaiqe
Aquca_013_00711.1|PACid:22060112  raddrrfyiftatktlhlrtdskkdrvawiqalvs.............................
Aquca_013_00510.2|PACid:22059560  rswlmsslhqmfsrrrsalelfmvdrsnfffdfgsiegrknayraivqar..............
Aquca_013_00444.3|PACid:22059981  illnallypgiktnlvknaiaaifhtsgdangndvatngvvartyliktkteedrnklasaiqe
Aquca_013_00444.1|PACid:22059979  illnallypgiktnlvknaiaaifhtsgdangndvatngvvartyliktkteedrnklasaiqe
Aquca_003_00565.2|PACid:22050448  peystelalsfqeatgcsyiwdnicnvq....................................
Aquca_003_00565.1|PACid:22050447  peystelalsfqeatgcsyiwdnicnvq....................................
Aquca_030_00251.2|PACid:22036125  ltlvlrgsksdldsfysr..............................................
Aquca_030_00251.1|PACid:22036124  ltlvlrgsksdldsfysr..............................................
Aquca_021_00082.1|PACid:22039565  pvvpegqhsalystqsfkilfkeggcgtfvplf...............................
Aquca_062_00006.1|PACid:22033292  kvlfiftlyntsnhndqlklgasspeeaarwirsfqeaas........................
Aquca_095_00055.1|PACid:22042414  ................................................................
Aquca_095_00055.2|PACid:22042415  ................................................................
Aquca_013_00095.4|PACid:22059220  qglrfecwsssksqvdswlkalmedc......................................
Aquca_013_00095.5|PACid:22059221  qglrfecwsssksqvdswlkalmedc......................................
Aquca_013_00095.1|PACid:22059218  qglrfecwsssksqvdswlkalmedc......................................
Aquca_013_00095.2|PACid:22059217  qglrfecwsssksqvdswlkalmedc......................................
Aquca_013_00095.3|PACid:22059219  qglrfecwsssksqvdswlkalmedc......................................
Aquca_062_00006.4|PACid:22033295  arwirsfqeaaskeypnpgenmigctkrkwhrlnrtk...........................
Aquca_062_00006.3|PACid:22033294  arwirsfqeaaskeypnpgenmigctkrkwhrlnrtk...........................
Aquca_013_00444.2|PACid:22059980  kptivvrndvgkillnallypgiktnlvknaiaai.............................
Aquca_052_00051.1|PACid:22061972  glkthhghmvyvlsvy................................................
Aquca_025_00261.1|PACid:22063132  ggcifefekfsdrdvcrdfvsrvlakl.....................................
Aquca_062_00006.2|PACid:22033293  ngresihrklgasspeeaarwirsfqeaask.................................
Aquca_003_00651.4|PACid:22050359  lrvrtsakvkdwvsaind..............................................
Aquca_003_00651.3|PACid:22050358  lrvrtsakvkdwvsaind..............................................
Aquca_003_00651.2|PACid:22050357  lrvrtsakvkdwvsaind..............................................
Aquca_003_00651.1|PACid:22050356  lrvrtsakvkdwvsaind..............................................
Aquca_053_00139.2|PACid:22026366  vlalsdagqpnskvvedvsalilrfdsddsrrtwqgrfqgaiyr....................
Aquca_053_00139.1|PACid:22026365  vlalsdagqpnskvvedvsalilrfdsddsrrtwqgrfqgaiyr....................
Aquca_001_00349.2|PACid:22042989  cdiplwpgrdsegdveqrgyfgiktadrliqfecksklekqmwtdgikqm..............
Aquca_013_00026.4|PACid:22059852  vsacadltlppgaglcidtingpiylvaetwesldgwidairlvyt..................
Aquca_001_00349.1|PACid:22042988  cdiplwpgrdsegdveqrgyfgiktadrliqfecksklekqmwtdgikqm..............
Aquca_013_00026.1|PACid:22059849  vsacadltlppgaglcidtingpiylvaetwesldgwidairlvyt..................
Aquca_013_00637.1|PACid:22059844  qieae...........................................................
Aquca_013_00026.2|PACid:22059850  ppgaglcidtingpiylvaetwesldgwidairlvyt...........................
Aquca_035_00006.2|PACid:22061311  ylyvetswekeswckalrlascvnkkrtn...................................
Aquca_035_00006.1|PACid:22061310  ylyvetswekeswckalrlascvnkkrtn...................................
Aquca_035_00160.1|PACid:22061308  eqscyfalrtaqgilefkcqnkihrqtwvdniahmlrkvg........................


                                                                                                    
                                                                                                    
d1aqca_                             ................................................................
Aquca_002_00505.1|PACid:22051945  aedgvlfplekgffflpkpptlilndeidfveferhgaggtsmhyfdlvvklkndqehvfrniq
Aquca_002_00505.2|PACid:22051946  aedgvlfplekgffflpkpptlilndeidfveferhgaggtsmhyfdlvvklkndqehvfrniq
Aquca_017_00750.2|PACid:22031339  ................................................................
Aquca_017_00750.1|PACid:22031338  ................................................................
Aquca_072_00073.1|PACid:22041324  ................................................................
Aquca_004_00240.1|PACid:22029886  ................................................................
Aquca_081_00021.1|PACid:22040129  qaalhdhmkyldk...................................................
Aquca_072_00073.2|PACid:22041325  ................................................................
Aquca_004_00409.1|PACid:22029680  ................................................................
Aquca_020_00435.2|PACid:22025377  ................................................................
Aquca_020_00435.1|PACid:22025376  ................................................................
Aquca_002_00517.1|PACid:22053797  ................................................................
Aquca_001_00573.1|PACid:22043479  ................................................................
Aquca_004_00321.1|PACid:22029546  ................................................................
Aquca_014_00615.1|PACid:22028061  ................................................................
Aquca_022_00350.1|PACid:22054603  ................................................................
Aquca_042_00118.3|PACid:22033050  ................................................................
Aquca_042_00118.1|PACid:22033048  ................................................................
Aquca_042_00118.2|PACid:22033049  ................................................................
Aquca_002_01439.4|PACid:22053791  ................................................................
Aquca_022_00350.2|PACid:22054604  ................................................................
Aquca_002_01439.1|PACid:22053788  ................................................................
Aquca_002_01439.2|PACid:22053789  ................................................................
Aquca_002_01439.3|PACid:22053790  ................................................................
Aquca_043_00004.5|PACid:22045070  ................................................................
Aquca_043_00004.4|PACid:22045069  ................................................................
Aquca_019_00085.1|PACid:22055465  ................................................................
Aquca_043_00004.3|PACid:22045068  ................................................................
Aquca_043_00004.1|PACid:22045066  ................................................................
Aquca_043_00004.2|PACid:22045067  ................................................................
Aquca_013_00510.1|PACid:22059559  ................................................................
Aquca_013_00510.3|PACid:22059561  ................................................................
Aquca_002_01359.1|PACid:22052490  ................................................................
Aquca_014_00060.1|PACid:22027782  ................................................................
Aquca_082_00003.1|PACid:22026086  ................................................................
Aquca_004_00805.3|PACid:22030343  aqapsaalvm......................................................
Aquca_007_00761.1|PACid:22048687  ................................................................
Aquca_014_00159.2|PACid:22028352  ................................................................
Aquca_014_00159.1|PACid:22028351  ................................................................
Aquca_004_00805.2|PACid:22030342  aqapsaalvm......................................................
Aquca_004_00805.1|PACid:22030341  aqapsaalvm......................................................
Aquca_031_00080.6|PACid:22050752  enala...........................................................
Aquca_011_00388.1|PACid:22038252  ................................................................
Aquca_031_00080.5|PACid:22050751  enala...........................................................
Aquca_031_00080.3|PACid:22050749  enala...........................................................
Aquca_031_00080.4|PACid:22050750  enala...........................................................
Aquca_031_00080.1|PACid:22050747  enala...........................................................
Aquca_031_00080.2|PACid:22050748  enala...........................................................
Aquca_010_00264.1|PACid:22047425  ................................................................
Aquca_010_00264.2|PACid:22047422  ................................................................
Aquca_010_00264.3|PACid:22047423  ................................................................
Aquca_010_00264.4|PACid:22047424  ................................................................
Aquca_017_00553.1|PACid:22031729  cndllvfhkkereevfknlvamn.........................................
Aquca_009_01002.1|PACid:22035007  ................................................................
Aquca_009_00392.1|PACid:22033700  alehala.........................................................
Aquca_002_00561.1|PACid:22052141  ................................................................
Aquca_057_00151.2|PACid:22057633  ................................................................
Aquca_057_00151.1|PACid:22057632  ................................................................
Aquca_013_00711.2|PACid:22060113  ................................................................
Aquca_013_00444.4|PACid:22059982  yap.............................................................
Aquca_013_00711.1|PACid:22060112  ................................................................
Aquca_013_00510.2|PACid:22059560  ................................................................
Aquca_013_00444.3|PACid:22059981  yap.............................................................
Aquca_013_00444.1|PACid:22059979  yap.............................................................
Aquca_003_00565.2|PACid:22050448  ................................................................
Aquca_003_00565.1|PACid:22050447  ................................................................
Aquca_030_00251.2|PACid:22036125  ................................................................
Aquca_030_00251.1|PACid:22036124  ................................................................
Aquca_021_00082.1|PACid:22039565  ................................................................
Aquca_062_00006.1|PACid:22033292  ................................................................
Aquca_095_00055.1|PACid:22042414  ................................................................
Aquca_095_00055.2|PACid:22042415  ................................................................
Aquca_013_00095.4|PACid:22059220  ................................................................
Aquca_013_00095.5|PACid:22059221  ................................................................
Aquca_013_00095.1|PACid:22059218  ................................................................
Aquca_013_00095.2|PACid:22059217  ................................................................
Aquca_013_00095.3|PACid:22059219  ................................................................
Aquca_062_00006.4|PACid:22033295  ................................................................
Aquca_062_00006.3|PACid:22033294  ................................................................
Aquca_013_00444.2|PACid:22059980  ................................................................
Aquca_052_00051.1|PACid:22061972  ................................................................
Aquca_025_00261.1|PACid:22063132  ................................................................
Aquca_062_00006.2|PACid:22033293  ................................................................
Aquca_003_00651.4|PACid:22050359  ................................................................
Aquca_003_00651.3|PACid:22050358  ................................................................
Aquca_003_00651.2|PACid:22050357  ................................................................
Aquca_003_00651.1|PACid:22050356  ................................................................
Aquca_053_00139.2|PACid:22026366  ................................................................
Aquca_053_00139.1|PACid:22026365  ................................................................
Aquca_001_00349.2|PACid:22042989  ................................................................
Aquca_013_00026.4|PACid:22059852  ................................................................
Aquca_001_00349.1|PACid:22042988  ................................................................
Aquca_013_00026.1|PACid:22059849  ................................................................
Aquca_013_00637.1|PACid:22059844  ................................................................
Aquca_013_00026.2|PACid:22059850  ................................................................
Aquca_035_00006.2|PACid:22061311  ................................................................
Aquca_035_00006.1|PACid:22061310  ................................................................
Aquca_035_00160.1|PACid:22061308  ................................................................


                                                      
                                                      
d1aqca_                             ..................
Aquca_002_00505.1|PACid:22051945  kneydglfdfiskkelki
Aquca_002_00505.2|PACid:22051946  kneydglfdfiskkelki
Aquca_017_00750.2|PACid:22031339  ..................
Aquca_017_00750.1|PACid:22031338  ..................
Aquca_072_00073.1|PACid:22041324  ..................
Aquca_004_00240.1|PACid:22029886  ..................
Aquca_081_00021.1|PACid:22040129  ..................
Aquca_072_00073.2|PACid:22041325  ..................
Aquca_004_00409.1|PACid:22029680  ..................
Aquca_020_00435.2|PACid:22025377  ..................
Aquca_020_00435.1|PACid:22025376  ..................
Aquca_002_00517.1|PACid:22053797  ..................
Aquca_001_00573.1|PACid:22043479  ..................
Aquca_004_00321.1|PACid:22029546  ..................
Aquca_014_00615.1|PACid:22028061  ..................
Aquca_022_00350.1|PACid:22054603  ..................
Aquca_042_00118.3|PACid:22033050  ..................
Aquca_042_00118.1|PACid:22033048  ..................
Aquca_042_00118.2|PACid:22033049  ..................
Aquca_002_01439.4|PACid:22053791  ..................
Aquca_022_00350.2|PACid:22054604  ..................
Aquca_002_01439.1|PACid:22053788  ..................
Aquca_002_01439.2|PACid:22053789  ..................
Aquca_002_01439.3|PACid:22053790  ..................
Aquca_043_00004.5|PACid:22045070  ..................
Aquca_043_00004.4|PACid:22045069  ..................
Aquca_019_00085.1|PACid:22055465  ..................
Aquca_043_00004.3|PACid:22045068  ..................
Aquca_043_00004.1|PACid:22045066  ..................
Aquca_043_00004.2|PACid:22045067  ..................
Aquca_013_00510.1|PACid:22059559  ..................
Aquca_013_00510.3|PACid:22059561  ..................
Aquca_002_01359.1|PACid:22052490  ..................
Aquca_014_00060.1|PACid:22027782  ..................
Aquca_082_00003.1|PACid:22026086  ..................
Aquca_004_00805.3|PACid:22030343  ..................
Aquca_007_00761.1|PACid:22048687  ..................
Aquca_014_00159.2|PACid:22028352  ..................
Aquca_014_00159.1|PACid:22028351  ..................
Aquca_004_00805.2|PACid:22030342  ..................
Aquca_004_00805.1|PACid:22030341  ..................
Aquca_031_00080.6|PACid:22050752  ..................
Aquca_011_00388.1|PACid:22038252  ..................
Aquca_031_00080.5|PACid:22050751  ..................
Aquca_031_00080.3|PACid:22050749  ..................
Aquca_031_00080.4|PACid:22050750  ..................
Aquca_031_00080.1|PACid:22050747  ..................
Aquca_031_00080.2|PACid:22050748  ..................
Aquca_010_00264.1|PACid:22047425  ..................
Aquca_010_00264.2|PACid:22047422  ..................
Aquca_010_00264.3|PACid:22047423  ..................
Aquca_010_00264.4|PACid:22047424  ..................
Aquca_017_00553.1|PACid:22031729  ..................
Aquca_009_01002.1|PACid:22035007  ..................
Aquca_009_00392.1|PACid:22033700  ..................
Aquca_002_00561.1|PACid:22052141  ..................
Aquca_057_00151.2|PACid:22057633  ..................
Aquca_057_00151.1|PACid:22057632  ..................
Aquca_013_00711.2|PACid:22060113  ..................
Aquca_013_00444.4|PACid:22059982  ..................
Aquca_013_00711.1|PACid:22060112  ..................
Aquca_013_00510.2|PACid:22059560  ..................
Aquca_013_00444.3|PACid:22059981  ..................
Aquca_013_00444.1|PACid:22059979  ..................
Aquca_003_00565.2|PACid:22050448  ..................
Aquca_003_00565.1|PACid:22050447  ..................
Aquca_030_00251.2|PACid:22036125  ..................
Aquca_030_00251.1|PACid:22036124  ..................
Aquca_021_00082.1|PACid:22039565  ..................
Aquca_062_00006.1|PACid:22033292  ..................
Aquca_095_00055.1|PACid:22042414  ..................
Aquca_095_00055.2|PACid:22042415  ..................
Aquca_013_00095.4|PACid:22059220  ..................
Aquca_013_00095.5|PACid:22059221  ..................
Aquca_013_00095.1|PACid:22059218  ..................
Aquca_013_00095.2|PACid:22059217  ..................
Aquca_013_00095.3|PACid:22059219  ..................
Aquca_062_00006.4|PACid:22033295  ..................
Aquca_062_00006.3|PACid:22033294  ..................
Aquca_013_00444.2|PACid:22059980  ..................
Aquca_052_00051.1|PACid:22061972  ..................
Aquca_025_00261.1|PACid:22063132  ..................
Aquca_062_00006.2|PACid:22033293  ..................
Aquca_003_00651.4|PACid:22050359  ..................
Aquca_003_00651.3|PACid:22050358  ..................
Aquca_003_00651.2|PACid:22050357  ..................
Aquca_003_00651.1|PACid:22050356  ..................
Aquca_053_00139.2|PACid:22026366  ..................
Aquca_053_00139.1|PACid:22026365  ..................
Aquca_001_00349.2|PACid:22042989  ..................
Aquca_013_00026.4|PACid:22059852  ..................
Aquca_001_00349.1|PACid:22042988  ..................
Aquca_013_00026.1|PACid:22059849  ..................
Aquca_013_00637.1|PACid:22059844  ..................
Aquca_013_00026.2|PACid:22059850  ..................
Aquca_035_00006.2|PACid:22061311  ..................
Aquca_035_00006.1|PACid:22061310  ..................
Aquca_035_00160.1|PACid:22061308  ..................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045807 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Synechococcus elongatus PCC 7942
NoYes   Rivularia sp. PCC 7116
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces scabiei 87.22
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Faecalibacterium prausnitzii
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Acetobacterium woodii DSM 1030
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Enterococcus sp. 7L76
NoYes   Weissella koreensis KACC 15510
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria innocua Clip11262
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Gramella forsetii KT0803
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Geobacillus sp. JF8
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Pelobacter propionicus DSM 2379
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Mesorhizobium sp. BNC1
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Photobacterium profundum SS9
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Pyrococcus yayanosii CH1
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechococcus elongatus PCC 6301
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Anabaena cylindrica PCC 7122
NoYes   Streptomyces albus J1074
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi DCMB5
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. GT
NoYes   Dehalococcoides sp. CBDB1
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis AC-2713
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus parasanguinis FW213
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus thermophilus MN-ZLW-002
NoYes   Streptococcus thermophilus JIM 8232
NoYes   Streptococcus thermophilus ND03
NoYes   Streptococcus thermophilus CNRZ1066
NoYes   Streptococcus thermophilus LMG 18311
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis TL13
NoYes   Streptococcus suis SC070731
NoYes   Streptococcus suis S735
NoYes   Streptococcus suis ST3
NoYes   Streptococcus suis D9
NoYes   Streptococcus suis SS12
NoYes   Streptococcus suis D12
NoYes   Streptococcus suis ST1
NoYes   Streptococcus suis A7
NoYes   Streptococcus suis JS14
NoYes   Streptococcus suis BM407
NoYes   Streptococcus suis SC84
NoYes   Streptococcus suis GZ1
NoYes   Streptococcus suis 98HAH33
NoYes   Streptococcus suis 05ZYH33
NoYes   Streptococcus salivarius CCHSS3
NoYes   Streptococcus salivarius JIM8777
NoYes   Exiguobacterium antarcticum B7
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y412MC52
NoYes   Geobacillus sp. Y412MC61
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Variovorax paradoxus B4
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Acinetobacter junii SH205
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Pyrococcus sp. NA2
NoYes   Natronobacterium gregoryi SP2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]