SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

PH domain-like alignments in Heterocephalus glaber v1.7-2

These alignments are sequences aligned to the 0048159 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1mi1a2               gp............................................................................
HGL_H00000278412-1  atgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffvisldppikqgqtryh
HGL_H00000278412-2  daicifqelqcltprgrydiriyptflhlhgktfdykipyctmlhlfllprkdqrqmffvisldppikqgqtcyhfli
HGL_H00000286827    efgavfdqliaeqtgekkevadlsmgdlllhttvmwlnppaslgkwkkepelaafvfktavvlvckdgskqkkk....
HGL_H00000407746    dygtvfdqlvaeqsgtekevcgdldlgascvvelsmgellmhstvswlnpflslgkarkdleltvfvfkravilvyke
HGL_H00000401303-1  qlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcvevlqsmraldfntrtqvtreaislvceavpgakga
HGL_H00000265381    edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevdlfistqrikvln
HGL_H00000413502    nhdpqfepivslpeqeiktleedeeelfkmraklfrfasendspewkergtgdvkllkhkdkgtirllmrrdkt....
HGL_H00000401303-3  qlggeewthqgsfvnkpmrgwlhpnnkvtgpevsylvrymgcvevlqsaraldfntwtqvtreaislvceavsgakgv
HGL_H00000219865    edlidgiifaanylgstqllsernpsknirmmqaqeavsrvkrmqkaakikkkansegdtqtltevdlfistqrikvl
HGL_H00000391942    esdyesvlcvkpeihvyrippratnrgyrasewqldqpswsgrlritakgkvayikledktsgelfaqapvdqfp...
HGL_H00000341737    eleyesvlcvkpdvsvyripprasnrgyrasdwkldqpdwtgrlritskgkiayikledkvsgelfaqapve......
HGL_H00000364995    rpgdeplprpprgaphasdqvlgagvtyvvkylgcievlrsmrsldfstrtqitreaisrvceavpgakgalkkrkpp
HGL_H00000308176    vilesiflkrsqqkkktsplnfkkrlflltmhklsyyeydfergrrgskkgsidvekitcvetvvpeknppperqipr
HGL_H00000381854    nsaaellkqgaacnvwylnsvemesltghqavqkalsltllqeppplstvvhfkvsahgitltdnqrklff.......
HGL_H00000280665    islaalqrhdpyihrivdvasqvalytfghranewektdvegtlfvytrsaspehgftimnrlsmenrtep.......
HGL_H00000171887    nsttdllkqgaacnvlfvnsvdmesltgpqaiskaisetltadptpaativhfkvsaqgitltdnqrklf........
HGL_H00000320828    hetsqyhvqhlatfimdkseaitsvddairklvqlsskekvwaqemllqvsdqsvrlldietqee.............
HGL_H00000319756    taadllrqgaacsvlyltsvetesltgpqavakassaalscsprptpamvhfkvsaqgitltdnqrklffr.......
HGL_H00000005587    dvetfvadilrgenlskkakekreylikkikdvkasylqefqdkgdveegeeyndpfagtpdtvslaserydkdddap
HGL_H00000334382    eqpifstrahvfqidpntkknwvptskhavtvsyfydstrnvyrii................................
HGL_H00000329668    mgcievlqsmrsldfgmrtqvtreaisrlceavpgasgaikkrkapvkflsavlgksnlqfsgmdikltistgsltlm
HGL_H00000305632-2  reqpifttrahvfqidpstkknwvpaskqavtvsyfydvtrnsyriisvdg...........................
HGL_H00000398560-2  nidkiaqwqssiedwegedllvrsseliysgeltrvtqpqaksqqrmfflfdh.........................
HGL_H00000364004-2  nidkiaqwqasvldwegedildrsseliytgemawiyqpygrnqqr................................
HGL_H00000331381    dwgepsitlrppneatastpvqywqhhpeklifqscdykafylgsmlikelrgtestqdacakmrksteqmkkvptii
HGL_H00000283195    hfepvvplpdkievktgeedeeeffcnraklfrfdgeckewkergignvkilrhktsgk...................
HGL_H00000370912-2  tileeilikrsqqkkktsplnyk.......................................................
HGL_H00000245932    sesvvcssratvmlyddsnkrwlpagtgpqafsrvqiyhnptansfrvvgrkmqpdqqvv..................
HGL_H00000344220    lkahpffesitwknlhqqtppkltaylpamseddedcygnydnllsqfgcmqvsssssshslsvvdaslphrsdsnie
HGL_H00000315136    edlldgvifgakylgstqllsernpppstrmaqaqeamarvkapdgetqpmtgvdlfvstrrikvltadsqeammdha
HGL_H00000264554    kymgcievlrsmrsldfstrtqvtreainrlheavpgvrgswkkkapnkalasilgksnlrfagmsisvnisidglnl
HGL_H00000398655    lleeqlikksqqkrrtspsnfkvrffvltktslayfedrhgkkrtlkgsiel..........................
HGL_H00000348150    reqpifstrahvfqidpatkrnwipagkhaltvsyfydatrnvyriisiggakaii......................
HGL_H00000338934-1  emyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfpwseirnis...........................
HGL_H00000353518    eepreakltlrppslaapcapvqswqhqpeklifescgyaanylgsmlikdlrgtestqdacakmrkstehmkktpti
HGL_H00000345752-1  eppllpgenikdmakdvtyicpf.......................................................
HGL_H00000386867-1  dktwvhtpeallkhyipyntkflcsteveqakgtevvrdavrklkfarhikkpegqkipkvelqisiygvkilepktk
HGL_H00000283195    edihfepivslpevevksgeedeeilfkeraklyrwdrdvsqwkergvgdikilwhtmknyyrilmrrdqvfkvcanh
HGL_H00000374195    fmikraqgrkrfgmknfkkrwfrltnheftyqkskgdqplcyipienil.............................
HGL_H00000420773    mslaalkqhdpyitsiadltgqvalytfcpkanqwektdiegtlfvyrrsaspyhgftivnrlnmhnl..........
HGL_H00000398560-1  inkiaqwqvsiigweglnildrsselihsgeltrltkqgksqqrtfflfdhqlvsckkdllrrdm.............
HGL_H00000347169-1  lrqsfrrkkdvyvpeasrphqwqtdeegvrtgkcsfpvkylghvevdesrgmhiceeavkrlkaerkffkgffgktgk
HGL_H00000384136-2  emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigf....................................
HGL_H00000353408    emygvnyfsiknkkgselwlgvdalglniyeqndrltpkigf....................................
HGL_H00000254051    srasspkksagchtlylssvsvetlsgalavqkaisatleqdvlptptvvhfrvteqgitltdvqrkvffr.......
HGL_H00000363458    klpenwtdtretllegmlftlkylgmtlverpkgeelsaaavkrivatakasgkklqkvtlkvsprgiiltdhltnql
HGL_H00000283195    hfepvvqmpekvelvtgeedekvlysqrvklfrfdaeisqwkerglgnlkilknevngk...................
HGL_H00000252891    peasrphqwqadedavrkgtcsfpvrylghveveesrgmhvcedavkklkamgrksvksilwvsadglrvvd......
HGL_H00000308774    sileelllkrsqqkkkmspnnykerl....................................................
HGL_H00000318965-3  lqvdfptpktelvqkfhvqylgmlpvdrpvgmetlnsaieslttvsnkedwpsvnmnvadatvtvisekne.......
HGL_H00000264042    emygirfhtasdregtkinlavshmgvlvfqgttkintfnwskvrklsfk............................
HGL_H00000391677    hlkegemfkraqgrtrigkknfkkrwfcltsreltyhkqpgkdaiytipvknilave.....................
HGL_H00000344666    emygvnyfairnkkgtelllgvdalglhiydpenrltpki......................................
HGL_H00000319831    hfrddddgpvssqgympylnkyildkveegafvkenfdelcwtltakknyradsngnsmlsnqdafrlwclfnflsed
HGL_H00000359423-2  vprlpgetlitdkeviyicpfng.......................................................
HGL_H00000322926    emygirlhpakdregtkinlavantgilvfqgftkinafnwakvrklsfkrkr.........................
HGL_H00000305632-1  mgeppiftirahvfqidyrtktiwvplsqqavavsyfydvtrntyriisvdg..........................
HGL_H00000355133    lriplhnedafqhgicfeakyvgsldvprpnsrveivaamrriryefkaknikkkkvsimvsvdgvkvilkkkkkkke
HGL_H00000381083    dkdtvpdnhrnkfkvinvdddgnelgs...................................................
HGL_H00000304701    rlrlsrtlaakvelvdiqregalrfmvaddaatgpggsaqwqkcrlllrravagerfrleffvppkasrpkv......
HGL_H00000334105    evpsflqegavfdryeeesyvfepnclfkvdefgffltwksegkegqvlecslin.......................
HGL_H00000315630    dafkiwvifnflsedkypliivpeeieyllkklteamgggwqqeqfedykvnfddgkeglsawelieligngqfskgm
HGL_H00000360275    atlikrfkgegvrykakligidevsaargdklcqdsmmklkgvvagarskgehkqkifltisfggikifdektgalqh
HGL_H00000357110    mygvdlhhakdsegvdiklgvcanglliykdrlrinrfawpkilkisyk.............................
HGL_H00000341138    mygvdlhhakdsegveimlgvcasglliyrdrlrinrfawpkvlkisyk.............................
HGL_H00000339184    mygvdlhhakdsegidimlgvcanglliyrdrlrinrfawpkilkisykrsnfy........................
HGL_H00000283195    fepvvplpdlvevssgeeneqvvfshraklyrydkdvgqwkergigdikilqnydnkqvrivmrrdqvlklcanhrit
HGL_H00000359417    aplflgesikaivkdvmyicp.........................................................
HGL_H00000387784    aikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekff
HGL_H00000263713    emygvdmhvvkardgndyslgltptgvlvfegetkiglffwpkitrldfkknkltlvvvedddqgkeqeht.......
HGL_H00000362904    mygvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisyk.............................
HGL_H00000201647    lrhlvtfclgeedgvhtvedasrklavmdsqgrvwtqemllrvspghvtlldpaskeelesyp...............
HGL_H00000364754    tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkreengegyekapsysykqsln
HGL_H00000357177    ldrasnplaaefksldltsrkmihegpltwriskdktldlhvllledllvllqrqderlllkchsktamgsadskqtf
HGL_H00000367394    shlrqsndpmlsefknlditkkklvhegpltwrvtkd.........................................
HGL_H00000358820    llqhrvehlmtcklgtqriqepkdvlqklqemdaqgrvwsqdlilqvkdgwlqlldietkeelds.............
HGL_H00000241014    edywyeaynmrtgargvfpayyaievtkepehvaalaknidwvdqfrvkflgsvqvpyhkgndvlcaamqkiattrrl
HGL_H00000313391    ektdeyllarfkgdgvkykgkligiddvpdargdkmsqdsmmklkgmaaagrsqgqhkqkiwvnislsgikiide...
HGL_H00000217381    evvlevkymkevspyfknsasgtavgwdspptsplqrqpsspgpqprhlkeakhvplkmayvsrrctpsdpepry...
HGL_H00000278412-3  agdticvflelqcltlkgpvpdvllisldlpikqgqtryhflillfskdedislplnmndeevekhferwltknmsss
HGL_H00000368824    qqsslqhkskkkskgpiagkskrrisckdlgrgdcegwlwkkkdaksyfsqkwkkyw.....................
HGL_H00000363694    emygvdmhvvrgrdgceyslgltptgilifegankiglffwpkitkmdfkksklt.......................
HGL_H00000338191    evllevkfirevtpyikkpslvsdlpwegaapqspsfsgsedsgspkhqnstkdrkviplkmcfaarnlsmpdle...
HGL_H00000390595    yivrvkavvmtrddssggwfpqegggisrvgvckvmhpegngrsgflihgerqkdklvvlecy...............
HGL_H00000349259    qetplaqmegflnrkheweahnkkassrswhnvycvinnqemgfykdaktaasgipyhsevpvslkeavcevaldykk
HGL_H00000352995-2  dlksssklkngltfrkedmlqrqlhlegtlcwkttsgrlkdvlavlltdvllllqekdq...................
HGL_H00000299084    yarvravvmtrddssggwlplggsglssvtvfkappqeengcadffirgerlrdkmvvlecm................
HGL_H00000216373    aikkmneiqknidgwegkdigqccnefimegsltrigakherhiflfdglmisckpnhgqtrlpgyssaeyrlkekfv
HGL_H00000378649    dkecfkcalgsswiisvelaigpeegisyltdkgcnpthladfnqvqtiqyshsed......................
HGL_H00000362109    rdsvpdnhptkfkvtnvddegvelgvgvmeltqselvlhlqrreavrwpylclrrygy....................
HGL_H00000303508-1  etyavdphpckdstgtttflgftaagfvvfqgnkrihlikwpdvcklkfegktfyvigtqkekka.............
HGL_H00000365891    lfemlgrkcltlatavvqlylalprgaqhwtmehcgalcfvkdnpqksyfirl.........................
HGL_H00000265963    matsseevllvvkkvrqkkqdgalylmaeriawapegkdrftishmyadikc..........................
HGL_N10018877       knkkgtdlwlgvdalglnihekddkltskigfpwseirnisfnnkkfvlkp...........................
HGL_H00000338171    aqdldsilkqgylekrskdhsffgpewqkrwcvltrglffyyanekskqpkgtfvmegysirlapy............
HGL_H00000341483    kcllekvevitgeeaesnvlqiqcklfvfdktsqswver.......................................
HGL_H00000403067    etygvdphpckdvsgnaaflaftpfgfvvlqgnkrvhfikwnevtklkfegktf........................
HGL_H00000330572    eddfwfrgfnmrtgergvfpafyahavpgpakdllgskrspcwverfdvqflgsvevpchqgngilcaamqkiatark
HGL_H00000394751    prkktqglfrmsrrrisckdlghadcqgwlfkkkekgtflsnkwkkfw..............................
HGL_H00000402046    attnsdtanhnmvsevpperpnvratrasrkaiafgkrahsmkrnpsapvtkagw.......................
HGL_H00000374557    galpfptqslspeplpqeeeklpprnanpgikcfavrslgwvemteeelapgrssvavnncirqlsyhknnlhdpmsg
HGL_H00000261486    emygvdlhpvygenkseyflgltpvgivvyknkkqvgkyfwpritkvhfketqfelrvlgkdc...............
HGL_H00000363371-2  qvvvgwshknvvrellqepagasivlkkipvpetppqtpldslhlrsqslavaplsprvsseevfafnltsdsypgpg
HGL_H00000376247    npdregwllklggrvktwkrr.........................................................
HGL_H00000318965-3  gatlryaslklrnaphaddddscsinsdpeakcfavrslgwvemaeedlapgkssvavnncirqlsyckndirdtvgi
HGL_H00000384136-1  emygvnyfeinntkgtelwlgidalglniyehddkltakigfsws.................................
HGL_H00000372160    vqreqnerfnvylmptpnldiyg.......................................................
HGL_H00000352995-1  ienktytklknghvfrkqaliskertllheglvywktatgrfkdilallltdlllflqekdqk...............
HGL_H00000359610    gnlselgkmimqggfsvwighrkgatkmkdfarfkpmqrhlflyekaivfckrrtetgegsdrypsysfkhc......
HGL_H00000374557    fqvefpapknelvqkfqvyylgnvrvakpvgvdvingalesvlssrsreqwtpshvsvapatlt..............
HGL_H00000234179    vkegwmvhytsrdnlrkrhywrldskcltl................................................
HGL_H00000262539    dfygvelhggrdlhnlelmigiasagiavyrkyictsfypwvnilkisfkrkkffihqrqkqpesre...........
HGL_H00000364893    rkelelqiltesirswegddiktlgsviymsqvmiqcagseeknerylllfpnlllmlsasprmsgfiyqgklpttgm
HGL_H00000391648-1  npdregwllklggrvktwkrr.........................................................
HGL_H00000379967-1  npdregwllklggrvktwkrr.........................................................
HGL_H00000353646    dvnlkeqgqlvrqdefmvragrhkslrrvflfeelllfskprrgssgldtftykrsfkmadlgltescgdnklrf...
HGL_H00000279230    qetssrnlvtlrvdpngfflywtgpnmevdtldissirdtrtgryarlpkdpkirevlgfggpdtrleekl.......
HGL_H00000304895    fkevwqvilkpkglgqtknligiyrlc...................................................
HGL_H00000330276    dgygeesypakdsqgsdisigaclegifvkhkngrppvifrwhdianmshnksffalelankeetiq...........
HGL_H00000233668    enslyspmwegsqfwvtiqkteasercglhgpyvlrveaerltlltlgaqgqilepllswpytll.............
HGL_H00000416895    nqrpssmvsesstagttstleakpgpkiikssnkvhsfgkrdqairrnpnvpvvvrgwlhkqdssgmrlwkrrwfvla
HGL_H00000394487    airkmenlkklleiyemlgeeedivnpsnelikegqilklaarntsaqerylflfnnmllycvprfslvgskftvr..
HGL_H00000345405    mvrvravvmarddssggwlpvgggglsqvsvcrvrgarpeggarqghyvihgerlrdqkttlectlrpglvynkvnpi
HGL_H00000386800-1  yrtdiiggvpiitptqkeeinecgestdknnlkrsqsylpyftpkpppdsavikagycvkqgavmknw..........
HGL_H00000408285-1  lregwvvhysnkdtlrkrhywrld......................................................
HGL_H00000393860    kkpqvaykteiiggvvvhtpisqnggdgqegsepgshailrrsqsyiptsgcrastgppliksgycvkqgnvrkswkr
HGL_H00000260402    pevkaylsqgerfikwddetaiaspvilrvdpkgyylywtyqskevefldi...........................
HGL_H00000311489    rgpelsaqeqmegmlcrkqemetslkkaanrswqnvycvlrngtlgfykdvkaasagvpyhgelpvrltraqgtvafd
HGL_H00000263265    lslassastlsslstlsakkparavnkvhtfgkrsnalrrdpnlpvhirgwlhkqvgsglrl................
HGL_H00000353109    denldvq.......................................................................
HGL_H00000288368    levleewqshiegwegsnitdtctemlmcgvllkissgniqervfflfdnllvyck......................
HGL_H00000344277    vqceqtdrfnvfllpcpnldvyg.......................................................
HGL_H00000262593    ereqserfnvylmpspnldvhgecalq...................................................
HGL_H00000401303-2  qlggeewthqgsfvnkpmrgwlhpnnkvtgpevsylvrymgcvevlqsaraldfntwtqvtreais............
HGL_H00000322926    nkspdeataadqeseddlsasrtslerqaphrgntmvhvcwhrstsvsmvdfsvavenqlsgnllrkfknsngwqklw
HGL_H00000339299    dgkiv.........................................................................
HGL_H00000378183    havrlqeiqsllinwkgpdltiygelvlegtfrvhrvrnertfflfdktllitkkrgdhfvykghipc..........
HGL_H00000381549    ptygvhyyavkdkqglpwwlgisykgigqydlqdkvkprklfqwkqlenlyfrekk......................
HGL_H00000376652-2  mvyddtskkwvpikpgqqgfiniyhntaassirvvgvklqdqqvvinysivkglkynqatptfh..............
HGL_H00000276420    ckefvvtmrpteasercqlrgiytlragvstlelwdgpepgtqlydwpyrflrrfgrdkvtfsfeagrrcvsgegn..
HGL_H00000302269    lrqitnfqlsienldrslanygrpkidgelkitsverrskmdryaflldkallickrrgdsydlkdfvslhnfqvrdd
HGL_H00000296604    cllektdvitgeeaehnvlkincklfifnkatqswiergrgtlrlndtassdcgtlqsrlimrn..............
HGL_H00000248901    npdregwllklggrvktwkrr.........................................................
HGL_H00000370719    vqceglseqlvfnsvtnclgprkflhsgklykaksnkelygflfndfllltqitkplgssgtdkvfspksnlqykmy.
HGL_H00000359073    lreikqfqlsienlnqpvllfgrpqgdgeirittldkhtkqerhiflfdlavivckrkgdnyemkeiidlqqykiann
HGL_H00000298694    idlkeqgqllhrdpftvicgrkkclrhvflfehlllfsklkgsewgaesfvhkqafktadmgltenigdsglcfelwf
HGL_H00000360916    lkkisefqssienlqvkleefgrpkidgelkvrsivnhtkqdrylflfdkvvivckrkgysyelkeviellfhkm...
HGL_H00000263373    apppppthtlqhegflmrkreldanrkssnrswvslycvlskgelgfykdakgpasggthggepllslhkatsevasd
HGL_H00000374373    hsvqmegylgrkhdlegpnkkasnrswnnlycvlrnseltfykdtknlalgvpyhgeeplalrhai............
HGL_H00000264042    gdptqgpggsleglgqhranttihvcwyrntsvsradhsaavenqlsgyllrkfkntngwqklwvvftnfclffykth
HGL_H00000335560    egkltaqgkllgqdtfwvtepeaggllssrgrerrvflfeqiiifseplgggarggtqpgy.................
HGL_H00000352232    grgggqsqwqkcrlllrsegeggggsrleffvppkasrprlsipcsaimdvrtttalempdren..............
HGL_H00000261439-2  elrcpsefddtfakkfevlfcgrvtvahkkappalideciekfnhvscslrvdgepplkgpvppaegvpspgaprhrp
HGL_H00000282406    tpvyttlkgkatqissspfqddssgsededssrcssrtsesdprsrsgpgspralkrgvsltsvasesdyaippdays
HGL_H00000379709    kegwlqlrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqstp.............................
HGL_H00000364631    airkmekmhkllevyeqlggeedivnpanelikeghiqklsakngtaqdrhlflfnsmvlycvpklrlmgqkfsvr..
HGL_H00000353109    gtltaqgkllqqdtfyvieldagmqsrtkerrvflfeqivifsellrkgsltpgymfkrsikmn..............
HGL_H00000356297    havrlqeiqslltnwkgpdltsygelvlegtfrlqraknertlflldklllitkkrddmftykahilcgn........
HGL_H00000410689    flelldheyltstvrekkavltnillriqssrgfdvkdhaqkpetnslpappqmplpeipqpwlppdsgppplptssl
HGL_H00000391995    dqetfrceliqgwnitvdlvigp.......................................................
HGL_H00000412461    lglrrpgpvlkagwlrkqrgimknwqqrwfvlcgdqlfyykdkdetkpq.............................
HGL_H00000357298    raqapvpgkgpfgreellrrklihdgcllwktatgrfkdvlmllmtdvlvllqekdqkyifp................
HGL_H00000256190    fneieklehklnqtpekwqqlwekvtmdlkeeqradhvqrhpsgspgivstnlpsyqkrptlhlpdssmseeqnasis
HGL_H00000354718    dsksimrmksgqmfakedlkrkklvrdgsvflksaagrlkevqavlltdilvflqekdqk..................
HGL_H00000349727    ensiysswqevsefpvvvqkteaatrcqlkgsyllalgqdaiqlrensssqvlyswp.....................
HGL_H00000379527    erlkmtalplyfegfllvkrseyheykhywtelrgt..........................................
HGL_H00000264042    enlqrlmelqrdlvgvenliapgrefiregclhkltkkglqqrmfflfsdmllytskgi...................
HGL_H00000346378    prqvelldavsqaaqkyealymgilpvtkamgmdvlneaigtltargdqntwvp........................
HGL_H00000367299-1  kfd...........................................................................
HGL_H00000330278    vpvpvytalkgkatqissvpfldessgsdddcssqasfrmsvpcsecrktsglgspraikrgvsmsslssegdyaipp
HGL_H00000361202    ykdvwqvvikprglghrkelsgvfrlcltdeevvfvrlnteva...................................
HGL_H00000262940    plvkegplfihrtkgkgplasfsfkklhfslttealsfaktpsskksifiklanvc......................
HGL_H00000409493    gtlealgepirqghfivwegapgarmpwkghkrhiflfrhylvickprrdwrtdtfsyvfrtmmklssidlndqvegd
HGL_H00000389787    qriasvehcfgasgqplalpgrvllgegvltkecrkkakprifflfndilvygsivlsk...................
HGL_H00000285094    sdcinsmvegselkkvrsnsriyhryflldadmqslrwepskkdsek...............................
HGL_H00000296414    apslgtkegyltkqgglvktwkmrwftlhrnelkyfkdqmspepirtld.............................
HGL_H00000409572    qddedlqallkgsqllkvkssswrrerfyklqedcktiwqesrkvmrspesqlf........................
HGL_H00000377233    hayegvpnggwhtsglssprpslvpelllhpmdelpggstpitpvikagwlyknppqgsyiyqkrwvrldvdhlryfd
HGL_H00000364277    irkmermhkllkvyellggeedivsptkelikeghilklsakngttqdrylilfndrll...................
HGL_H00000234313    gviikqgcllkqghrrknwkvrkfilredpaylhyydpaggedplgavhlrgcvvtsvesnpegkksdeenl......
HGL_H00000395986    dnedafynsqkfevlycgkvtvahkvaqssliddciekfslheqqrlrlqgeraadpgeelvlegealgsprdslpee
HGL_H00000324287    nvdaangivmegylfkrasnafktwnrrwfsiqnnqlvyqkkfkdnptvvvedlrlctvkhced..............
HGL_H00000264057    lyfqtiikegmltkqnnsfqrskrryfklrgrtlyyaktaksii..................................
HGL_H00000396185-1  ttdqdllmmqegilmrkvrskswkklryfrl...............................................
HGL_H00000346378    slepgakcfavrslgwvevpeedlapgkssiavnnciqqlaqtrnrsqppdgawgegqnmlmilkkdamslvnpldh.
HGL_H00000391106    ealkqgwlhkkgggsstlsrrnwrrrwfvlrqaklmyfendseeklk...............................
HGL_H00000366977    egsndevdkllkeflhldltapipgaspeetrqlllegslrmkegkdskmdvycflftdlllvtkavkkaertkvirp
HGL_H00000304895    dvrkvgylrkpksm................................................................
HGL_H00000399903    ..............................................................................
HGL_H00000346733    vdapsgvvmegylfkrasnafktwnrrwfsiqnsqlvyqkklkdsltvvvddlrlcsvkpcedte.............
HGL_H00000386911    gwlkkqrsivknwqqryfvlkaqqlyyykdeedskpqgcmylpgstikeia...........................
HGL_H00000322926    ncqklhelkkdligidnlvtpgrefirlgslsklsgkglqqrmfflfndvl...........................
HGL_H00000377233    etqallgcgagvncfsgdpeaptplalaeqagqtlqmeflrnnqttdvprldsmkpfekhysvvqptvshsgflykta
HGL_H00000336522    erwkdtwdrvkaaqrlevrpdgrgtpssllvssvphhrrslgvylqegpmgstlslsldsdqssgsatsxarqaarrs
HGL_H00000402861    hdcisfmqagcelkkvrpnsriynrfftldtdlqalrwepskkdqekakld...........................
HGL_H00000312262    algkdcimhgymskmgnpfltqwqrryfylfpn.............................................
HGL_H00000367747    vercmsamqegtqmvklrgsskglvrfyyld...............................................
HGL_H00000250617    rkqlelqilsepiqawegediktlgnvifmsqvmvqygtceekeerylllfsnvlim.....................
HGL_H00000288266    npfgesggstksetedsilhqlfivrflgsmevksddhpdvvyetmrqi.............................
HGL_H00000352721    qvirrgwltinnislmkggskeywfvltaeslswykdeeekekkymlpldnlkir.......................
HGL_H00000351969    virkgwltisnigimkggskgywfvltaeslswykddeekekkymlpldnlkvrdveksf..................
HGL_H00000020673    tpepgaavykhgslvrkvhadpdcrktprgkrgwksfhgilkgmilylqkeeyqpgkalseaelknaisihhalatra
HGL_H00000366843    cdapvdhagflhkkggrhtas.........................................................
HGL_H00000158762    pgglvmeghlfkrasnafktwsrrwftiqsnqlvyqkkykdpvtvvvddlrlctv.......................
HGL_H00000274710    khgvltrkthadmdgkrtprgkrgwkkfyavlkgtilylqkdeyrpdralsegdlknairvhhalatkasdy......
HGL_H00000362751    dsevsspftpvadedsvvfskltylgcasvnaprsevealrmmsilrsqcqisldvtlsvpnvsegtvrlldpqtnte
HGL_H00000276185    lfntvgldekqsattllvgprhgishvidlktnlttvlsefskiskiqlf............................
HGL_H00000407267    dwfnalraarfhylqvafpgasdvdlvpklsrnylkegymektgpkqtegfrkrwftmddrrlmyfkdpldafarge.
HGL_H00000251507    prpsspsgipeedsvlfnkltylgcmkvssprnevealramaamrsssqnpfpvtlyvpnvpegsvriidqsrnmeia
HGL_H00000245796    ykqgilarkmhhdadgkktpwgkrgwkmfhtllrgmvlyflkgedpslegeslvgqmvdepvgvhha...........
HGL_H00000316029    gvsfflvkekmkgknklvprllgit.....................................................
HGL_H00000216446    slstmelsgevvkqgylskqghkrknwkvrrfvlrkepaflhyydpskeenrpvggfslrgslvsaledngvpmgvkg
HGL_H00000276204    tslcsqkggvikqgwlhkanvnstitvtmkvfkrryfyltqlpdgsyilnsykdeknskeskgciyldacidvvqcpk
HGL_H00000371397    klhitsedptytvlylgnattiqargdgctdlavgkiwskseagrqgtkmkltvsaqgirmvhaeeralrr.......
HGL_H00000366284    sqvhssisdcklsdispmgrdpsvssfssatltpsstcpslvdsrsnsvdqktpeansrasspctefeqfqiipavet
HGL_H00000285046    lrrhhchacgkivcrncsrnkyplkylkdrmakvcdgcfgelrkrggaapgplrerpvtmsfplssplfssgsalssv
HGL_H00000343899    dvavhyyrlykdkreieaslslgltmrgiqifqnhheekqllydfpwthvgklvfvgkkfeilpdglpsarkliy...
HGL_H00000362014    virkgwltinnigimkggskeywfvltaenlswykddeekekkymlsvdnlklr........................
HGL_H00000328118    dmeklgrllmhgpfsvwtihkdrhkvkdfirfkpsqrqiylfergivfckirmepgdqglsphysfkkslklvtlsir
HGL_H00000405405    ktcrgflikmggkiktwkkrwfvfdrnkrtfsyyadkhea......................................
HGL_H00000303476    gvsfflvkekmkgknklvprllgvtkdsvmrvde............................................
HGL_H00000384312    kkgwmsildepgewkkhw............................................................
HGL_H00000274376    dafyknivkkgyllkkgkgkrwknlyfilegsdaqliyfesekratkp..............................
HGL_H00000328800    mavnqshtenrrgaaipygesllkqcsdvelsfpqqpegsnlfvg.................................
HGL_H00000339299    denies........................................................................
HGL_H00000354611    kvcrgylvkmggkikswkkrwfvfdrlkrtlsyyvdkhetklkgviyfq.............................
HGL_H00000349298    enygiewhavrdsegqklligvgpegisicrddfspinriaypvvqmatqsgknvyltvtkesgn.............
HGL_H00000317786    kkgwltkqyedgqwkkhwfvlsdqtlryyrdsvaeeaadldgeidls...............................
HGL_H00000394225    grvfkatlvqaekrsevtllvgprygishvintktnlvalladfshvnr.............................
HGL_H00000292140    gvccrgplvkmggriktwrkrwfcfdrqarrla.............................................
HGL_H00000345988    svmqsgtqmiklkrgtkglvrlfyldehrtrlrwrpsrkseka...................................
HGL_H00000386733    evqrqlggwtgpelsafgelvlegafrggggggprlrggerllflfsrmllvakrrgpeymykghifccnlsvsespr
HGL_H00000234313    pkriregylvkkgnvfntwkpmwmvlledgiefykkksdnnpkgmiplkgsivtspcqdfskr...............
HGL_H00000362405    psstcpslvegrygspdvrtpqpcsrpsspepelvpethskkppspvqaaesekepqrllvpdiqeirvspivskkgy
HGL_H00000417003    rmvdtvlcdntqlqlkaespwealdwgqklwevvhtavpgyvgrqdelanspglshhvdctqnhclqkkangllppsp
HGL_H00000379967-2  lggrvktwkrh...................................................................
HGL_H00000317912    qpshyhesflekkgpsdqdyrkfwtglrgltiyfynsnrdvqplekldlrtfvkltdeapqgslwdpgihfslvlrdq
HGL_M00000071081-2  kkgwltkqyedgqwkkhwfvlsdqslryhrdsvaeeaadldgeidlstcyd...........................
HGL_M00000071081-1  kkgwltkqyeddqwkkhwfvlsdqslryyrdsvae...........................................
HGL_H00000388152    cdhrtlrtdfmaaeemhwpvpmkaigaqnlltmpggvakagylhkkggtqlqllkwplrfviihkrciyyfksstsas
HGL_H00000285046    nlqklvhiehsihgqgdllqpgreflkegtlmkvrgkdrhprhlflmsdvllyt........................
HGL_H00000318965-1  mylvlendmlslvdpmdctmlhsqpivsirvwg.............................................
HGL_H00000258390    sskggggaggsgvfksgwlykgnfnstvnntvtvrsfkkryfqltqlpdnsyimnfykdekiskepkgcifldsctgv
HGL_H00000258530    iqkagylnlrnktglvstswerlyfftqggnllcqprga.......................................
HGL_H00000394487    rrrhhcracghvvcwkcsdykaqleydggkwskvckdcyqiisgftdseekkrkgileiesaevsgnsv.........
HGL_H00000354919-1  saqravsislseidplshgsdklplktdthgsqlknssashpsivhlesenfeetikenvqgetpeittnpieyqdkl
HGL_H00000366995    gkifnatlmlqdresciallvgakygi...................................................
HGL_H00000344961    rdkrffipeylkhifkehmaenilsptnrcllydgkltlaestrfldvylflfdd.......................
HGL_H00000388152    eemhwpvpmkaigaqnlltmpggvakagylhkkggtqlqllkwplrfviihkrciyyfksstsaspqgafslngynrv
HGL_N10025555       mkpwkarwfvldktkhqlryydhrvdteckgvidl...........................................
HGL_H00000288266    trkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmavdced..................
HGL_H00000373214    mdkpqnmkhsgylwaigknvwkrwkkrffvlvqvsqytfam.....................................
HGL_H00000295888    ..............................................................................
HGL_H00000385609    fvksgwllrqstilkrwkknwfdlwsd...................................................
HGL_H00000386800-1  pyvdrqnricgfldieenensgkflrryfildtredsfvwymdnpqnlpsgssrvgaikltyiskvsdatklrpkaef
HGL_H00000345895    deppkvvvtevkeedafyskkcklfykkdnefkekgvgtlhlkptanqktqllvradtnlgeylslrnvlippnmpct
HGL_H00000399588    qgawrkrwfvlrrgrmsgnpdvleyyrnkhsskpiraidlsecavwkhagpgfvrkefqnnfvfivk...........
HGL_H00000364277    iicsflhymekggkgwhkawfvvpeneplvlyiygapqdvkaqrslpligfevgppeagerpdrrhv...........
HGL_H00000391106    qefivrgwlhkevknspkmsslklkkrwfvlthnsldyykssek..................................
HGL_H00000262995    wkrrwfvlrsgrltgdpdvleyykndhakkpiriidlnlcqqvdagltfnkkefensyifd.................
HGL_H00000398481    mdkpphmkhsgylyavgqkvwkrwkkryfvlvqvsqytfamcsyre................................
HGL_H00000317786    kpiyggwlllapdgtdfdnpvhrsrkwqrrffilyehgllryal..................................
HGL_H00000376700    faedgeavsssyesydeeesskgksapyqwpspeasielmrdaricaflwrkkwlgqwakq.................
HGL_H00000216446    enacqghvvhnwkvrwfilqqntllyykleggrkvtppkgrilldgctiicpcleyenrpllik..............
HGL_H00000281419    nkehgmerngnlykksdgirkvwqkrkcsvkngfltishgtanrppakl.............................
HGL_H00000339381    lnvamvvgylgsielpstssnlesdslqairgcmrrlraeqkihslvtmkvmhdrvllcsdkacvvaeypaeklafsa
HGL_H00000263650    dpsvvimadslkirgtlkswtklwcvlkpgvlliyktpkvgq....................................
HGL_H00000393860    drqnricgfldieenehggkflrryfildtqancllwymdnpqnlavgagavgslqltyiskvsiatpkqkpktpfcf
HGL_H00000302895    rekgikegvlkikeepskilsgnkfqdryfvlrdgclflykdpksskhdk............................
HGL_H00000296721    dldkrlsqekqasdsdslgmgdngsslsrreacehgkgkksslaelkgsmsraagrkitriisfskkkalaedlqmss
HGL_H00000318965-1  vqkfyvhemnvadatvmvisekneeevlvecrvrflsfmgvrkdi.................................
HGL_H00000347244    vqceglaeqlifnsltnclgprkllhsgklyktksnkelhgflfndfllltymvkqfavssgseklfssksna.....
HGL_H00000296721    aespplrtvanpppplpnkpppedyyeealplgpgkspeyisshngsspahsivdgyyedadssypttrmngelkhsy
HGL_H00000313731    ededvhamlrgsqlckirshtwqker....................................................
HGL_H00000302895    etnkkwcileggflsyyendksttpngtiniseviclaihkedfylntgpvfif........................
HGL_H00000261729    vshicavervdegafqlphvmqvvtrgsagtlhtty..........................................
HGL_H00000410689    tcgylnvlsnnrwrerwcrvkdnklifhkdradlkth.........................................
HGL_H00000348828    emmytinsqlefkikpfplvsssrwlvkrgeltayvedtvlfsrrtskqqvyffl.......................
HGL_H00000347134    askvllchgelknknghklyiflfqdilvltrp.............................................
HGL_H00000415034    ..............................................................................
HGL_H00000386331    gsaffevkqttepnfpeilliainkygvslidprtkdiltthpftkisn.............................
HGL_H00000330278    alsqggtkpavkgwltkvkhghsklvwcaligktfyyyrshedkrplgclpvrdarieevdrscdsdedyeaagtrr.
HGL_H00000350297    smhqlqgnkeygsekkgyllkksdgirkv.................................................
HGL_H00000265748    qvnssveekgfltifedvsgfgawhrrwcvlagncisywtypdderrknpigrmnlanctsqqiepan..........
HGL_H00000376700    gylnvlvnsqwksrwcs.............................................................
HGL_H00000011684    leppseevekslrpfstldlmspmlgvspehtrqlllegpvrmkegrdgkldvylflfsdvll...............
HGL_H00000338769    eehlrrknsgagysihqhqgnkqfgtekvgflykksdgirrvwqkrkcgvk...........................
HGL_H00000279227    gisyfmvrfkgskkdeilgiannrlir...................................................
HGL_H00000407746    vrkagwlffkplvtlqkerklelvarrkwkqywvtlkgctllfyetygknsmdqssapr...................
HGL_H00000303909    trqlvkdgflvemsessrklrhvflftdvllcaklkktsagkhqqydckwyipladlvfpspeeseaspqvhlfpdhe
HGL_H00000326706    adksgwikkssggllghwkdrylllrqaqllvyenedeqkcve...................................
HGL_H00000405963    gtrkgylskrsadntkwqtkwfallqnllfyfesdsssrpsglyllegcvcdrapspkpapsakepl...........
HGL_H00000395182    nhqsappekvgwvrkfcgkgifreiwknryvvlkgdqlyisekevk................................
HGL_H00000217289    gltyylvrfkgakkddilgvsynrliridaatgipittwrftnmkqwnv.............................
HGL_H00000341071    qkdslidssrvlcchgelknnrgvklhvflfqevlvitraithneqlcyqlyrqpipvkdllledlqdge........
HGL_H00000368719    leqpflsvfkkgrrrvpvrnlgkvmhyakvqlrfqhsq........................................
HGL_H00000298542    dmygirphpasdgegmqihlavahmgvlvlrvlckdtleftmasrdack.............................
HGL_H00000264051    eqmisiqkk.....................................................................
HGL_H00000364207    klcgylskfggkgpirgwktrwffyderkchlyysrtaqdanpldsidlssaifdskadaeegtfei...........
HGL_H00000279227    lalrprkltlkgyrqhwvvfkettlsyyksqdeapgdpiqqlnlkgcevvpdv.........................
HGL_H00000286827    rrkwkhywvslkgctlffyesdgrsgidhnsipkhavwvensivqav...............................
HGL_H00000396519    ikqqrlnrlcegssfrkignrrrqerfwycrlalnhkvlhygdlddnpqgevtfe.......................
HGL_H00000345808-3  kygllivtkitengkkvqkswlsswavlqgssllftktqgtstswfgsnqskpeftvdlkgavikmaskgksskkni.
HGL_H00000367764    ptygvhyyavkdkqgipwwlglsykgifqydyhdkvkprkvraassvglaalllrkeqtgrgccspeaarasvtrrtf
HGL_M00000082342    sdaldistkvqlygvlwkrpfgrpsakwsrrffi............................................
HGL_H00000378262    gnregilwkrgrdngqylrrrfvllaregllkyytkeqgkgpkavisikdlnatfqt.....................
HGL_H00000261439-1  vpspraprhramrkslshpglcslayrrefqdgnlrscsffssfkengienhlisghytmqptdteenrtalftsgqs
HGL_H00000056217    eeliylsqkiefeckifplisqsrwlvksgeltalefsvspglrrklntrpvhlhlfndclllsrpregsrflvf...
HGL_H00000221086    eliktprvdnvvlhrpfyp...........................................................
HGL_H00000274498    pytmegylyvqekrhfgtswvkhyct....................................................
HGL_H00000342858-1  githfiarfqggkkedligiaynrlirmdantgdaiktwrfsnmkqw...............................
HGL_H00000320563    ..............................................................................
HGL_H00000311837    evtitveylreapsflklpigspgpssshssrassplfdsglhlnghcshtalsspssptadepkyekrwldtlcipl
HGL_H00000346127    vrggwlwrq.....................................................................
HGL_H00000272666    gsaffevkqasepsypdivlvain......................................................
HGL_H00000363371-1  cwfmlkghmlywyrqprdekaqglisvs..................................................
HGL_H00000315410    qeppvqkgfllkkrkwplkgwh........................................................
HGL_H00000282406    lflqpegkptvkglltkvkhgyskrvwctli...............................................
HGL_H00000281172    disqyrvehlttfvldrkdamitvddgirklk..............................................
HGL_H00000265080    gtkrgflsrraaeasrwhekwfalyqnvlfyfe.............................................
HGL_H00000412733-1  ivegplskwtnvmkgwqyrwfvldynagllsyytgavigiddeddstf..............................
HGL_H00000262593    divkqgyvrirsrrlgiyqrcwlvfkkasskgpkrlekfsd.....................................
HGL_H00000386800-2  nricdfldikenensgkflrwyfildtrgdsfvwyvdnpqnlpskssrvgaikltyiskvsdaaklr...........
HGL_H00000356655    rccdeeisfslrvyeqirdltlflfndallvssrgtshtpferiskttyq............................
HGL_H00000407267    agyregllwkrgrdngqflsrkfvlteregalkyfnkndakepkaimkiehlnatfqpakighphglqvt........
HGL_H00000403323    dkagvlhctrtadkgkrlrkkhwstswtvleggvltffkdsktsatgglrqqpsklstpeytvelkgaslswapkdks
HGL_H00000362369    tkvqksqrperktfqvkletrqitwsrgadkiegaidireikeirpgktsrdfdryqedpa.................
HGL_H00000217289    rpkklvlkgfkqywfvfkdts.........................................................
HGL_H00000336923    sqftvegylyvqekrpapfgsswvkhycmyrkgakkfniipfehrsggklgdg.........................
HGL_H00000411012-3  kc............................................................................
HGL_H00000180173-2  qvenvrlv......................................................................
HGL_H00000342858-1  kpkkltlkgykqywctfkdtsiscykskeessgtpahqmnlrgcevtpd.............................
HGL_H00000386897    raipikqgmllkrsgkslnkewkkkyvtlcdngvltyhpslhdymqnvhgkeidllrttvkvpgkrppratsacapis
HGL_H00000407163    legaitkegvlhykagtsylgkehwktcfvv...............................................
HGL_H00000256190    rpallpgeeivceglrvlldpdgreeatggllggpql.........................................
HGL_H00000303507    hrqllkdsfmvelvegarklrhvflftdlllctklkkqsggktqqydckwyipltdlsfqmvdeseaapniplvpdee
HGL_H00000354952    pdvleyykndhskkplriinlnfceqvdagltfnkkelqdsfvfdikt..............................
HGL_H00000411012-2  ..............................................................................
HGL_H00000312753    sdspadhmgflrtwggpgapptpsgtgrrcwfvlkgnllfsfesregqaplslv........................
HGL_H00000339769-3  rqrvkvyalnedrqwddrgtgrvssayveelkgmsllvraesdgsllleskinphtayqkqqdtlivw..........
HGL_H00000344277    divkqgyvkmksrklgiyrrcwlvfrkssskgpqrlekypdeksvclrgcp...........................
HGL_H00000371221    qvklldrfstsnk.................................................................
HGL_H00000362894    agflnqqqmiegltvwrrlycvlrggklycfyspeeieakveptlivpihketriramekda................
HGL_H00000376293    khegfmlkkrkwplkgw.............................................................
HGL_H00000406026    eqdcprrravilkfnlqglkiysgegevllmahalrrilyst....................................
HGL_H00000259351    gssaavptmegplrrktllkegrkpalsswtrywvilsgstllyygakslrgtdrkhykstpgkkv............
HGL_H00000302895    vapekcgylelrgykakiftvlkgsslwlckneqdfksglgitiipmnvanvkqv.......................
HGL_H00000380413    ckvdsigsgraipikqgillkrsgkslnkewkkkyvtlcdnglltyhpslhdymqnihgkeidllrttvkvpgkrlpr
HGL_H00000364631    vlcsplrlsedgvawmevwaaiptsdsqvlqlqgsgqdgqllntiplpscmvcvpdpkevqgaehtwk..........
HGL_H00000378262    egvlqrepfkkrwfaldpqerrllyyknpldafeqgqvflgskeqgyevleelpkgvrgsrwkagl............
HGL_H00000363617    peiegvlwlkddgkkswkk...........................................................
HGL_H00000378965    evkymreatpyvkkgspvseigwetpppesprlgggssdpqssqafc...............................
HGL_H00000263826-1  eyiknwrpryfllktdgsfigykekpqdvdlpypln..........................................
HGL_H00000298815    psqwtmegylyvqekrplgftwikhyctydkgsktft.........................................
HGL_H00000365411    pelegalylkedgkka..............................................................
HGL_H00000407834    rgevytlnedrqwddrgtghvssgyverlkgmsllvraesdgsllleskinpntayqkqqdtlivws...........
HGL_H00000368719    greplggaicasrvklqhlpskeqwdrllvlypeslaifseepsglsfkgelplsaih....................
HGL_H00000361009    singslyifrgrintevmevenvedgta..................................................
HGL_H00000402299    vlslphrrlvcycwlfevpdpnkpqklglhqreiflfndllvvtkifqkkknsvtysfrqsfslyglqvllfenqyyp
HGL_H00000367638    kndqhlrrvqallsgrqakgltsgrwflrqgwllvvpptgeprprmfflfsdvllmakprp.................
HGL_H00000411012-1  ..............................................................................
HGL_H00000371067    psgeeifatiiitgnggiqwsrgkhkesetlteqdlqlycdfldiidvsikqanqegs....................
HGL_H00000356607    vtiqgvlrrktllkegkkptvaswtkywaalcgtqlfyyaakslkaterkhf..........................
HGL_H00000339769-2  rrvkvytlnedrqwddrgtghvsstyveelkgmsllvraesdgsllleskinpntayqkqqaka..............
HGL_H00000342858-2  githfiarfqrdkkedligiaynrlirmdantgdaiktwrfsnm..................................
HGL_H00000254806    alnknhsegggvivnntesilmsydhvela................................................
HGL_H00000389913-1  lsnpfrgllklgtvsrrgamgiwkelfcelsplelrlylsaeeracves.............................
HGL_H00000367629    eqmymlqtqldfskvksfplisasrwllkrgelflveeaglfrkiasrptcylflfndv...................
HGL_H00000364550    mivgkkpvlslphrrlvcccqlyevpdpnrpqrlglhqrevflfndllvvtkifqkkkilvtysfrqs..........
HGL_H00000333568    vmkegwmvhytskdtliplseilsleaaktsalipnga........................................
HGL_H00000328160    raipikqsfllkrsgnslnkewkkkyvtlssngfllyhpsindyihsthgkemdllrttvkvpgkrppraisafgpsa
HGL_H00000391668    gcfpgeqilawapglrkgldpe........................................................
HGL_N10005278       hnsslpplaiknpkclgllhqldrgpdvwvqhycvl..........................................
HGL_H00000403459    lnagsfpeiqgflhlrgsgrklwkrcfcflrrsglyfstkgtskdprhlq............................
HGL_H00000260283    ssrtllidgrvelkrglqrqerhlflfndlllvvkikynnnfkiknki..............................
HGL_H00000258530    tnpfgeseddsfpevedsllqqmfivrflgsmavktdstaeviyeamrqvlaaraihn....................
HGL_H00000381793    nflnssscpeiqgflhvkdlgrkswkrlyvclrrsglyfstkgtskep..............................
HGL_H00000372160    frrcwlvfkkasskgprrlekfpd......................................................
HGL_H00000377233    khgmmkfredrsllglglpsggfhdryfi.................................................
HGL_H00000377566    irqqrllrlcegalfhkissrrrqdklwfcclspnhkvlqygdveegtgpptpeslpeqlpvadirvllmgkdcphvr
HGL_H00000302895    gnadssavssnaispyacfygsstvkvksgwldklspqgyemyskgiiplsavstvrvqgdnkfevvt..........
HGL_H00000405963    nirknlaiermiiegceilldtsqtfvrqgsliqvpmsekgkitrgrlgslslkkegerqcflf..............
HGL_H00000325285    daliaisnyrlhikfkdsvinvplrmidsvesrdmf..........................................
HGL_H00000315662    tyvtkveksivgmktvlsvpyrrlvccsrlfevtdvnklqkqaahqr...............................
HGL_H00000338185    dpklrelldvgnighlehrmitvvygpdlvnishln..........................................
HGL_H00000283937    lmktrthssckvtylgkv............................................................
HGL_H00000201647    dvsqyqvnhlvtfclgeedg..........................................................
HGL_H00000265080    nirknlaiermivegcdilldtsqtfirqgsliqvpsvergklskvrlgslslk........................
HGL_H00000371577    pgeqllceastvlkyvqedscqhg......................................................
HGL_H00000342804    ntdtlscsswptspglrwekrwcdlrlipllhsrfsqylagt....................................
HGL_H00000417003    tfpnilkkgyleirkdhdsywqscyael..................................................
HGL_H00000385326    yiktwrpryfllkndgtf............................................................
HGL_H00000264276    hagrfsvnwfilfndalvhaqfsthh....................................................
HGL_H00000384651    iialsnyrlhikfkeslvnvplqliesvecrdifql..........................................
HGL_H00000276420    vkrgflhlqqqqtfgkkwrrfsavlygesgcalarlelhegpeklrrgeaarkviclsdcrrva..............
HGL_H00000352336    pvdimeikeirpgknskdferakavrqkedccftily.........................................
HGL_H00000231487-8  islaalqrhdpyinyimyv...........................................................
HGL_H00000272430    sgtlrvqqagqlqngarvhgvlkgtnlfcyrrredtdtgeeplltiainkatrvrageldqapgrpft..........
HGL_H00000356278    atvlkegvlekrsggllqlwkrkrcvlterglqlfeakgtggrpkelsfarik.........................
HGL_H00000399532-2  lksdgsfigykerpeapdqtlpplnnfsvaecqlmkterprpntfvirclqwt.........................
HGL_H00000263847    slytqrskaem...................................................................
HGL_H00000362409    riifsgnlfqyqednkkwrnrfslvphnyglvlyenkvayerqvppraiins..........................
HGL_H00000337572-2  ahfetidlsqvilaetscanlchsfclitpqrkvt...........................................
HGL_H00000355026    eelirltqrlrfhkvkalplvswsrrlelqgeltelgcrrggvlftsrprftpl........................
HGL_H00000363317    ygllvhrvspekkrlevevglrvcakgvivyeiknhsr........................................
HGL_H00000378965    qfeihspdtkhtval...............................................................
HGL_H00000382697    pesriegwlsvpnrgnikrygwkkqyv...................................................
HGL_N10007969       vlslphrrlvcycrlfevpdpnkpqklglhqreiflfndllvvtkilqkkknsvtysfrqsfsltwhlavakghkara
HGL_H00000320291    ryegplwkssrffgwslfwvvlehgvlswyrkqpdaahniyrqgckhltqavctvkssdscl................
HGL_H00000342793    egmimkrsgghripglnccgqgracyrwskrwlvvkdsfllymkpdsgaia...........................
HGL_H00000317985    esrlegwlslpvrnntkkfgwvkky.....................................................
HGL_H00000317578    algkdcimhghmlklgnpfltqwq......................................................
HGL_H00000391648-2  gsktiiplenlrirevddprkpdcfelyipnnkgqlikackre...................................
HGL_H00000407802    fsgwqprwfllcggi...............................................................
HGL_H00000369121    svwvktgslqwwcdskphkwvdvrvaleqftghdgthds.......................................
HGL_H00000233668    gavmegplflqsqrfgtkkwkktwavlypasphgvarleffdhkgsssgggrgssrrldc..................
HGL_H00000386183    si............................................................................
HGL_H00000401910    qkqifdvvyevdgcpanllsshrslvqrvetvslgehpcdkgeqvtlflfsdcleiarkrhkvigtfrsppghtrppa
HGL_H00000259406    fpvfvqpldlcnpartlllteelllyegrnkaaqvtlfaysdlll.................................
HGL_H00000377386    veksgllnmtkiaqggrklsfspngqapagsrpessvdlrgaalshgrhlssrrnvlh....................
HGL_H00000377233    eqpdrtgnlelrgfknklyvavvgdkvqlyknveeyhlgigitfidmsvgnv..........................
HGL_H00000361202    evckrgylrkqkhghrryfvlkl.......................................................
HGL_H00000345492    mpdnlytfvlkv..................................................................
HGL_H00000376306    pglqskepssslhlegwmkvprnnkrgqqgwdrkyivlegskvliydseareagqrpveefelclpdgdvsihgavga
HGL_H00000349727    etpikdgilyqqhikfgkkswrkvwallyagspsgvarleswdvrdgtlgpagdrsagpgrrgerrgvirladcvs..
HGL_H00000345133    etgtgtayegflsvprpsgvrrgwqrvyaalsdsrlllfdapdp..................................
HGL_H00000377233    ferlgrlpykaglslqraq...........................................................
HGL_H00000270747    ihfegkifplisqarwlvrhgelvelaplptappaklklsskavylh...............................
HGL_H00000391106    navgtldvglidsvcasdnpdrpnsfviita...............................................
HGL_H00000355060    gqrqlllcetltetvygdrgqlikskerrvfllndmlvcaninfkgqleisslvplgpkyvvkwntelpqvqvvevgq
HGL_H00000412733-6  sprgcvrlrgdvigiddeddstftitvdqktfhfra..........................................
HGL_H00000302895    dligqlfykdchaldq..............................................................
HGL_H00000264818    epswtyfcdfqdithvvlkecrisihrqdnkclel...........................................
HGL_H00000300584    rrchlyyfkspqdalplgrldiadacfcypgadesaepgaelpahfqvhsagavavlkap..................
HGL_H00000295095-2  vekegylqkakiadggkklrknwsts....................................................
HGL_H00000335341-1  aykgyvkvpkptgvkkgwqrayavvcdcklflydlpegkstqpgvvasqvldlrdeefsvssvlasdvihatr.....
HGL_H00000318075    qpaemaaelsmrgpkkgsvakrrlvklvvnflfyfrtdeaenlfdgpraaqgfiedpe....................
HGL_H00000262719    kphstgsseriqlsgmynvrkgrmqlpvnrwtrrhvilcgtclivssvkdsltgkmhvlpl.................
HGL_H00000335341-2  gtayeghvripkpagvkkgwqralavvcdfklflyditegkasqpsvv..............................
HGL_H00000263674    harvlqeieahiegmedlqa..........................................................
HGL_H00000356621    csavecldlgrgepvsvkplhssvl.....................................................
HGL_H00000345808-1  kygllnvtkitengkkvrkswlsswavlqgssllftktqgsstsw.................................
HGL_H00000397663-5  ahtcrgtinlatvqigtedsc.........................................................
HGL_H00000379804    yfvldfeagilqyfvneqskhqkprgalslsgaivslsdeaphmlvvysasgemyklrvpeplapwcr..........
HGL_H00000336522    rprllpgeecvldglrvyllpdgregatggsgggpallpaegavflatyrvvftgmptdplvgeqvvvrsfpl.....
HGL_H00000358316    nevykqdyfikspppqlffstaswkrrffilsksgekrlsl.....................................
HGL_H00000391106    cnssgaygfssegaqssfedseedfdsrfdtddelsyrrds.....................................
HGL_H00000216446    liklkt........................................................................
HGL_H00000234453-1  mavceikvhsadntrme.............................................................
HGL_H00000258530    tnpfgeseddsfpevedsllqqmfivrflgsmavktdstaeviyeamrqvlaa.........................
HGL_H00000378965    gheirhlgwlaekvpgdsgrqwkpal....................................................
HGL_H00000263088    vcyrwskrwlvvkdsfllymcletgvisfvqlfdsg..........................................
HGL_H00000343204    snfsyfpeithivikeslvsinkqdnknm.................................................
HGL_H00000315334    a.............................................................................
HGL_H00000339769-4  hvevyimngderwdcigmgqvstiydeqlqgvcllvqsesgdssilqskiqpntpywkkrstlivwsede........
HGL_H00000348611    mdhldrillsgiynvrkgktqlhkwaerlvvlcgtcliv.......................................
HGL_H00000389913-1  paqvpepdaikesllylyadgtwvpcifslsveslk..........................................
HGL_H00000264554    mgcievlrsmrsldfstrtq..........................................................
HGL_H00000311837    spgnqvvhmgwvnerlqgtnspqtfgskflalkgssvyifcsppvstvdwvraesiynlce.................
HGL_H00000342858-4  githfivrfqggkkedligsphnrli....................................................
HGL_H00000007414    qeghllkkrkwplkgwhkiakgklhgsidvrlsvmsink.......................................
HGL_H00000381571    rrlirsddvietvyndkgeitktkerrllmlndvlmcatvsfrpsqeshvgasqryllkwsvplghvevmeysngpgi
HGL_H00000293349    gsgkgarrlgslvltslcsvtgperkpke.................................................
HGL_H00000342804    traektfsvyeimckilkdsdlldrrkhc.................................................


                                                                                                    
                                                                                                    
d1mi1a2               ..............................................................................
HGL_H00000278412-1  flillfskdedisltlnmneeevekrfegrltknmsgslyemvs..................................
HGL_H00000278412-2  llfskdedisltlnmneelekrfegqltkdmsgllyevfsqimkal................................
HGL_H00000286827    ..............................................................................
HGL_H00000407746    ncklkkklpsnsrp................................................................
HGL_H00000401303-1  trrrkpcsrplssvlgrsnlkfagm.....................................................
HGL_H00000265381    adtqetmmdhplrti...............................................................
HGL_H00000413502    ..............................................................................
HGL_H00000401303-3  trrrkpcsrplssvlgrsn...........................................................
HGL_H00000219865    nadtqet.......................................................................
HGL_H00000391942    ..............................................................................
HGL_H00000341737    ..............................................................................
HGL_H00000364995    skmlssksnlql..................................................................
HGL_H00000308176    rgeessemeqisiierfpypfqvvydegp.................................................
HGL_H00000381854    ..............................................................................
HGL_H00000280665    ..............................................................................
HGL_H00000171887    ..............................................................................
HGL_H00000320828    ..............................................................................
HGL_H00000319756    ..............................................................................
HGL_H00000005587    tdgnqfppiaaqdlpsvlkagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgynvrmnstlr
HGL_H00000334382    ..............................................................................
HGL_H00000329668    kldn..........................................................................
HGL_H00000305632-2  ..............................................................................
HGL_H00000398560-2  ..............................................................................
HGL_H00000364004-2  ..............................................................................
HGL_H00000331381    ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000370912-2  ..............................................................................
HGL_H00000245932    ..............................................................................
HGL_H00000344220    qyihdldtnsfeldlqfsedekrlllekqaggnpwhqfvennlilkmgpvdkrkglfarrrqllltegphlyyvdpvn
HGL_H00000315136    lqti..........................................................................
HGL_H00000264554    lv............................................................................
HGL_H00000398655    ..............................................................................
HGL_H00000348150    ..............................................................................
HGL_H00000338934-1  ..............................................................................
HGL_H00000353518    ilsitykgvkfid.................................................................
HGL_H00000345752-1  ..............................................................................
HGL_H00000386867-1  evqhncqfhrisfcaddktdkrifsfickdses.............................................
HGL_H00000283195    vitktmelk.....................................................................
HGL_H00000374195    ..............................................................................
HGL_H00000420773    ..............................................................................
HGL_H00000398560-1  ..............................................................................
HGL_H00000347169-1  ka............................................................................
HGL_H00000384136-2  ..............................................................................
HGL_H00000353408    ..............................................................................
HGL_H00000254051    ..............................................................................
HGL_H00000363458    ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000252891    ..............................................................................
HGL_H00000308774    ..............................................................................
HGL_H00000318965-3  ..............................................................................
HGL_H00000264042    ..............................................................................
HGL_H00000391677    ..............................................................................
HGL_H00000344666    ..............................................................................
HGL_H00000319831    kyplimvpdeveylvkkvlssmslelglgeleellaqegqvaqaagglsvwqflelfnsgrclrgvgqdtlsmaihev
HGL_H00000359423-2  ..............................................................................
HGL_H00000322926    ..............................................................................
HGL_H00000305632-1  ..............................................................................
HGL_H00000355133    wtwdes........................................................................
HGL_H00000381083    ..............................................................................
HGL_H00000304701    ..............................................................................
HGL_H00000334105    ..............................................................................
HGL_H00000315630    drqtvsmainevfnelildvlkqgymmkkghrr.............................................
HGL_H00000360275    ..............................................................................
HGL_H00000357110    ..............................................................................
HGL_H00000341138    ..............................................................................
HGL_H00000339184    ..............................................................................
HGL_H00000283195    pdmtlqtmkgtexxxxxxxxxxxxxxxxxxxrv.............................................
HGL_H00000359417    ..............................................................................
HGL_H00000387784    mrkvqindkddtneyk..............................................................
HGL_H00000263713    ..............................................................................
HGL_H00000362904    ..............................................................................
HGL_H00000201647    ..............................................................................
HGL_H00000364754    mtavgitenvkgdakkf.............................................................
HGL_H00000357177    spvlk.........................................................................
HGL_H00000367394    ..............................................................................
HGL_H00000358820    ..............................................................................
HGL_H00000241014    tvhfnppsscvleisvrglkigvkaddsqeakg.............................................
HGL_H00000313391    ..............................................................................
HGL_H00000217381    ..............................................................................
HGL_H00000278412-3  lyemvs........................................................................
HGL_H00000368824    ..............................................................................
HGL_H00000363694    ..............................................................................
HGL_H00000338191    ..............................................................................
HGL_H00000390595    ..............................................................................
HGL_H00000349259    kkhvfkl.......................................................................
HGL_H00000352995-2  ..............................................................................
HGL_H00000299084    ..............................................................................
HGL_H00000216373    mrkiqicdkedtcec...............................................................
HGL_H00000378649    ..............................................................................
HGL_H00000362109    ..............................................................................
HGL_H00000303508-1  ..............................................................................
HGL_H00000365891    ..............................................................................
HGL_H00000265963    ..............................................................................
HGL_N10018877       ..............................................................................
HGL_H00000338171    ..............................................................................
HGL_H00000341483    ..............................................................................
HGL_H00000403067    ..............................................................................
HGL_H00000330572    ltvhlrppascdleislrgvklslsgggpefqrcshffqmk.....................................
HGL_H00000394751    ..............................................................................
HGL_H00000402046    ..............................................................................
HGL_H00000374557    gwgegkdll.....................................................................
HGL_H00000261486    ..............................................................................
HGL_H00000363371-2  pawtdpeplpitpaspaspvlgrkkskgmatklsrrrvscrelgrpdcdgwlllrktpggfmgpr.............
HGL_H00000376247    ..............................................................................
HGL_H00000318965-3  wgegkdmylil...................................................................
HGL_H00000384136-1  ..............................................................................
HGL_H00000372160    ..............................................................................
HGL_H00000352995-1  ..............................................................................
HGL_H00000359610    ..............................................................................
HGL_H00000374557    ..............................................................................
HGL_H00000234179    ..............................................................................
HGL_H00000262539    ..............................................................................
HGL_H00000364893    titkledsen....................................................................
HGL_H00000391648-1  ..............................................................................
HGL_H00000379967-1  ..............................................................................
HGL_H00000353646    ..............................................................................
HGL_H00000279230    ..............................................................................
HGL_H00000304895    ..............................................................................
HGL_H00000330276    ..............................................................................
HGL_H00000233668    ..............................................................................
HGL_H00000416895    dy............................................................................
HGL_H00000394487    ..............................................................................
HGL_H00000345405    fhh...........................................................................
HGL_H00000386800-1  ..............................................................................
HGL_H00000408285-1  ..............................................................................
HGL_H00000393860    rffvlddfticyfkceqdreplrtiflkdv................................................
HGL_H00000260402    ..............................................................................
HGL_H00000311489    yrkrkhvfkl....................................................................
HGL_H00000263265    ..............................................................................
HGL_H00000353109    ..............................................................................
HGL_H00000288368    ..............................................................................
HGL_H00000344277    ..............................................................................
HGL_H00000262593    ..............................................................................
HGL_H00000401303-2  ..............................................................................
HGL_H00000322926    vvftnfclffykshq...............................................................
HGL_H00000339299    ..............................................................................
HGL_H00000378183    ..............................................................................
HGL_H00000381549    ..............................................................................
HGL_H00000376652-2  ..............................................................................
HGL_H00000276420    ..............................................................................
HGL_H00000302269    ssgerdhkkwshmflliedqg.........................................................
HGL_H00000296604    ..............................................................................
HGL_H00000248901    ..............................................................................
HGL_H00000370719    ..............................................................................
HGL_H00000359073    pttdkenkkw....................................................................
HGL_H00000298694    rrrrarea......................................................................
HGL_H00000360916    ..............................................................................
HGL_H00000263373    ykkkkhvfklq...................................................................
HGL_H00000374373    ..............................................................................
HGL_H00000264042    qddhplaslpllgysvsvpreadgihk...................................................
HGL_H00000335560    ..............................................................................
HGL_H00000352232    ..............................................................................
HGL_H00000261439-2  mrkslsqpglrslayrrefqdgglrsssffssfeendienhlisghhivqptdieenrtmlftigqsev.........
HGL_H00000282406    tdtecsqpeqklpktcssssdngknepleksgyllkmsskvktwkrrwfvlkggellyykspsdvirkpqghielsas
HGL_H00000379709    ..............................................................................
HGL_H00000364631    ..............................................................................
HGL_H00000353109    ..............................................................................
HGL_H00000356297    ..............................................................................
HGL_H00000410689    pegyyeeavplspgkapeyitanydsdamsssyesydeeeedgkgkkarhqwpseeasmdlvkdaki...........
HGL_H00000391995    ..............................................................................
HGL_H00000412461    ..............................................................................
HGL_H00000357298    ..............................................................................
HGL_H00000256190    psngverraatlysqytsrndenrsfegtlykrgallkgwkprwfvldvtkhqlry......................
HGL_H00000354718    ..............................................................................
HGL_H00000349727    ..............................................................................
HGL_H00000379527    ..............................................................................
HGL_H00000264042    ..............................................................................
HGL_H00000346378    ..............................................................................
HGL_H00000367299-1  ..............................................................................
HGL_H00000330278    dacsldsdysepehkmqrtscystegqglgtgteslekssyllkmgsrvktwkrrwfvlrqgqimyykspndvilkpq
HGL_H00000361202    ..............................................................................
HGL_H00000262940    ..............................................................................
HGL_H00000409493    ..............................................................................
HGL_H00000389787    ..............................................................................
HGL_H00000285094    ..............................................................................
HGL_H00000296414    ..............................................................................
HGL_H00000409572    ..............................................................................
HGL_H00000377233    snkdayskrfis..................................................................
HGL_H00000364277    ..............................................................................
HGL_H00000234313    ..............................................................................
HGL_H00000395986    eeeeeaenshpalpalasqpvpssarvcfperiledcgfdeqqefrsrcssvtgvlqrkvhengqkpqprrrhasaps
HGL_H00000324287    ..............................................................................
HGL_H00000264057    ..............................................................................
HGL_H00000396185-1  ..............................................................................
HGL_H00000346378    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000366977    p.............................................................................
HGL_H00000304895    ..............................................................................
HGL_H00000399903    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000386911    ..............................................................................
HGL_H00000322926    ..............................................................................
HGL_H00000377233    saskllqdrrareefsrrwcvlsdgvlsyyenertvtpngeiraneivclavpppdshgfeht...............
HGL_H00000336522    tstlysqfqtaesenrsyegtlykkgafmkpwkarwfv........................................
HGL_H00000402861    ..............................................................................
HGL_H00000312262    ..............................................................................
HGL_H00000367747    ..............................................................................
HGL_H00000250617    ..............................................................................
HGL_H00000288266    ..............................................................................
HGL_H00000352721    ..............................................................................
HGL_H00000351969    ..............................................................................
HGL_H00000020673    sdy...........................................................................
HGL_H00000366843    ..............................................................................
HGL_H00000158762    ..............................................................................
HGL_H00000274710    ..............................................................................
HGL_H00000362751    ianypiykil....................................................................
HGL_H00000276185    ..............................................................................
HGL_H00000407267    ..............................................................................
HGL_H00000251507    sfpiykvlfcarghdg..............................................................
HGL_H00000245796    ..............................................................................
HGL_H00000316029    ..............................................................................
HGL_H00000216446    nvqgnlfkv.....................................................................
HGL_H00000276204    ..............................................................................
HGL_H00000371397    ..............................................................................
HGL_H00000366284    pylaragkheflnlvpdieeirpgsvvskkgylhfkeplssswak.................................
HGL_H00000285046    fhsinpsnfkkqkkvpsalaevaasgeglaisrykrgekrwkrl..................................
HGL_H00000343899    ..............................................................................
HGL_H00000362014    ..............................................................................
HGL_H00000328118    qlgrgsnkk.....................................................................
HGL_H00000405405    ..............................................................................
HGL_H00000303476    ..............................................................................
HGL_H00000384312    ..............................................................................
HGL_H00000274376    ..............................................................................
HGL_H00000328800    ..............................................................................
HGL_H00000339299    ..............................................................................
HGL_H00000354611    ..............................................................................
HGL_H00000349298    ..............................................................................
HGL_H00000317786    ..............................................................................
HGL_H00000394225    ..............................................................................
HGL_H00000292140    ..............................................................................
HGL_H00000345988    ..............................................................................
HGL_H00000386733    d.............................................................................
HGL_H00000234313    ..............................................................................
HGL_H00000362405    lhflep........................................................................
HGL_H00000417003    vldsskqyqnilksgtlyrltvqnnwkaf.................................................
HGL_H00000379967-2  ..............................................................................
HGL_H00000317912    dikfkaeslesremwkgfiltvvel.....................................................
HGL_M00000071081-2  ..............................................................................
HGL_M00000071081-1  ..............................................................................
HGL_H00000388152    pqgafslngynrvmraaeettsnnvfpfkiihisk...........................................
HGL_H00000285046    ..............................................................................
HGL_H00000318965-1  ..............................................................................
HGL_H00000258390    vqnn..........................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000394487    ..............................................................................
HGL_H00000354919-1  ylhlkenlskvksyameimkkipipdqctiedtvrscvaklfftcslkghyclyskssfilisqdpqpwiqimflfqq
HGL_H00000366995    ..............................................................................
HGL_H00000344961    ..............................................................................
HGL_H00000388152    mraaeettsnnvfpfkiihisk........................................................
HGL_N10025555       ..............................................................................
HGL_H00000288266    ..............................................................................
HGL_H00000373214    ..............................................................................
HGL_H00000295888    ..............................................................................
HGL_H00000385609    ..............................................................................
HGL_H00000386800-1  c.............................................................................
HGL_H00000345895    rtgknnvlivcvpnppldeknatapa....................................................
HGL_H00000399588    ..............................................................................
HGL_H00000364277    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000262995    ..............................................................................
HGL_H00000398481    ..............................................................................
HGL_H00000317786    ..............................................................................
HGL_H00000376700    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000339381    vcpddrrffglvtmqmnddgslapgeecalrtschvfmvdpd....................................
HGL_H00000263650    ..............................................................................
HGL_H00000393860    vinals........................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000296721    aeeevpccgylnilvnqgwkerwcr.....................................................
HGL_H00000318965-1  ..............................................................................
HGL_H00000347244    ..............................................................................
HGL_H00000296721    ndsdamsssyesydeeeeegkgpqprhqwpseeasmhlvrdcricsfllrkkrfgqw.....................
HGL_H00000313731    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000261729    ..............................................................................
HGL_H00000410689    ..............................................................................
HGL_H00000348828    ..............................................................................
HGL_H00000347134    ..............................................................................
HGL_H00000415034    ..............................................................................
HGL_H00000386331    ..............................................................................
HGL_H00000330278    ..............................................................................
HGL_H00000350297    ..............................................................................
HGL_H00000265748    ..............................................................................
HGL_H00000376700    ..............................................................................
HGL_H00000011684    ..............................................................................
HGL_H00000338769    ..............................................................................
HGL_H00000279227    ..............................................................................
HGL_H00000407746    ..............................................................................
HGL_H00000303909    ledmkmkisalkseiqkekankgqsraierlkkkmfenefllllnsptipfr..........................
HGL_H00000326706    ..............................................................................
HGL_H00000405963    ..............................................................................
HGL_H00000395182    ..............................................................................
HGL_H00000217289    ..............................................................................
HGL_H00000341071    ..............................................................................
HGL_H00000368719    ..............................................................................
HGL_H00000298542    ..............................................................................
HGL_H00000264051    ..............................................................................
HGL_H00000364207    ..............................................................................
HGL_H00000279227    ..............................................................................
HGL_H00000286827    ..............................................................................
HGL_H00000396519    ..............................................................................
HGL_H00000345808-3  ..............................................................................
HGL_H00000367764    ghsgi.........................................................................
HGL_M00000082342    ..............................................................................
HGL_H00000378262    ..............................................................................
HGL_H00000261439-1  evylispdt.....................................................................
HGL_H00000056217    ..............................................................................
HGL_H00000221086    ..............................................................................
HGL_H00000274498    ..............................................................................
HGL_H00000342858-1  ..............................................................................
HGL_H00000320563    ..............................................................................
HGL_H00000311837    smarisrckastgs................................................................
HGL_H00000346127    ..............................................................................
HGL_H00000272666    ..............................................................................
HGL_H00000363371-1  ..............................................................................
HGL_H00000315410    ..............................................................................
HGL_H00000282406    ..............................................................................
HGL_H00000281172    ..............................................................................
HGL_H00000265080    ..............................................................................
HGL_H00000412733-1  ..............................................................................
HGL_H00000262593    ..............................................................................
HGL_H00000386800-2  ..............................................................................
HGL_H00000356655    ..............................................................................
HGL_H00000407267    ..............................................................................
HGL_H00000403323    sk............................................................................
HGL_H00000362369    ..............................................................................
HGL_H00000217289    ..............................................................................
HGL_H00000336923    ..............................................................................
HGL_H00000411012-3  ..............................................................................
HGL_H00000180173-2  ..............................................................................
HGL_H00000342858-1  ..............................................................................
HGL_H00000386897    spktnglskdvsslhispnsdtglgdsv..................................................
HGL_H00000407163    ..............................................................................
HGL_H00000256190    ..............................................................................
HGL_H00000303507    ld............................................................................
HGL_H00000354952    ..............................................................................
HGL_H00000411012-2  ..............................................................................
HGL_H00000312753    ..............................................................................
HGL_H00000339769-3  ..............................................................................
HGL_H00000344277    ..............................................................................
HGL_H00000371221    ..............................................................................
HGL_H00000362894    ..............................................................................
HGL_H00000376293    ..............................................................................
HGL_H00000406026    ..............................................................................
HGL_H00000259351    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000380413    atpatap.......................................................................
HGL_H00000364631    ..............................................................................
HGL_H00000378262    ..............................................................................
HGL_H00000363617    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000263826-1  ..............................................................................
HGL_H00000298815    ..............................................................................
HGL_H00000365411    ..............................................................................
HGL_H00000407834    ..............................................................................
HGL_H00000368719    ..............................................................................
HGL_H00000361009    ..............................................................................
HGL_H00000402299    ngirltsavpgadtkvlit...........................................................
HGL_H00000367638    ..............................................................................
HGL_H00000411012-1  ..............................................................................
HGL_H00000371067    ..............................................................................
HGL_H00000356607    ..............................................................................
HGL_H00000339769-2  ..............................................................................
HGL_H00000342858-2  ..............................................................................
HGL_H00000254806    ..............................................................................
HGL_H00000389913-1  ..............................................................................
HGL_H00000367629    ..............................................................................
HGL_H00000364550    ..............................................................................
HGL_H00000333568    ..............................................................................
HGL_H00000328160    singlv........................................................................
HGL_H00000391668    ..............................................................................
HGL_N10005278       ..............................................................................
HGL_H00000403459    ..............................................................................
HGL_H00000260283    ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000381793    ..............................................................................
HGL_H00000372160    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000377566    ekgsgkqnkdlyelafsisy..........................................................
HGL_H00000302895    ..............................................................................
HGL_H00000405963    ..............................................................................
HGL_H00000325285    ..............................................................................
HGL_H00000315662    ..............................................................................
HGL_H00000338185    ..............................................................................
HGL_H00000283937    ..............................................................................
HGL_H00000201647    ..............................................................................
HGL_H00000265080    ..............................................................................
HGL_H00000371577    ..............................................................................
HGL_H00000342804    ..............................................................................
HGL_H00000417003    ..............................................................................
HGL_H00000385326    ..............................................................................
HGL_H00000264276    ..............................................................................
HGL_H00000384651    ..............................................................................
HGL_H00000276420    ..............................................................................
HGL_H00000352336    ..............................................................................
HGL_H00000231487-8  ..............................................................................
HGL_H00000272430    ..............................................................................
HGL_H00000356278    ..............................................................................
HGL_H00000399532-2  ..............................................................................
HGL_H00000263847    ..............................................................................
HGL_H00000362409    ..............................................................................
HGL_H00000337572-2  ..............................................................................
HGL_H00000355026    ..............................................................................
HGL_H00000363317    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000382697    ..............................................................................
HGL_N10007969       ifltlrqdthvpspvasmdptesvlsprppfsltdypngirltsavpgadtkvlit......................
HGL_H00000320291    ..............................................................................
HGL_H00000342793    ..............................................................................
HGL_H00000317985    ..............................................................................
HGL_H00000317578    ..............................................................................
HGL_H00000391648-2  ..............................................................................
HGL_H00000407802    ..............................................................................
HGL_H00000369121    ..............................................................................
HGL_H00000233668    ..............................................................................
HGL_H00000386183    ..............................................................................
HGL_H00000401910    slkh..........................................................................
HGL_H00000259406    ..............................................................................
HGL_H00000377386    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000361202    ..............................................................................
HGL_H00000345492    ..............................................................................
HGL_H00000376306    sela..........................................................................
HGL_H00000349727    ..............................................................................
HGL_H00000345133    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000270747    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000355060    dggaydkdnvliqhsgakkasatgqaqnkvclgpprlfqelq....................................
HGL_H00000412733-6  ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000264818    ..............................................................................
HGL_H00000300584    ..............................................................................
HGL_H00000295095-2  ..............................................................................
HGL_H00000335341-1  ..............................................................................
HGL_H00000318075    ..............................................................................
HGL_H00000262719    ..............................................................................
HGL_H00000335341-2  ..............................................................................
HGL_H00000263674    ..............................................................................
HGL_H00000356621    ..............................................................................
HGL_H00000345808-1  ..............................................................................
HGL_H00000397663-5  ..............................................................................
HGL_H00000379804    ..............................................................................
HGL_H00000336522    ..............................................................................
HGL_H00000358316    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000234453-1  ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000263088    ..............................................................................
HGL_H00000343204    ..............................................................................
HGL_H00000315334    ..............................................................................
HGL_H00000339769-4  ..............................................................................
HGL_H00000348611    ..............................................................................
HGL_H00000389913-1  ..............................................................................
HGL_H00000264554    ..............................................................................
HGL_H00000311837    ..............................................................................
HGL_H00000342858-4  ..............................................................................
HGL_H00000007414    ..............................................................................
HGL_H00000381571    gehsrhpavhppeslavsanakpykt....................................................
HGL_H00000293349    ..............................................................................
HGL_H00000342804    ..............................................................................


                                                                                                    
                                                                                                    
d1mi1a2               ..............................................................................
HGL_H00000278412-1  ..............................................................................
HGL_H00000278412-2  ..............................................................................
HGL_H00000286827    ..............................................................................
HGL_H00000407746    ..............................................................................
HGL_H00000401303-1  ..............................................................................
HGL_H00000265381    ..............................................................................
HGL_H00000413502    ..............................................................................
HGL_H00000401303-3  ..............................................................................
HGL_H00000219865    ..............................................................................
HGL_H00000391942    ..............................................................................
HGL_H00000341737    ..............................................................................
HGL_H00000364995    ..............................................................................
HGL_H00000308176    ..............................................................................
HGL_H00000381854    ..............................................................................
HGL_H00000280665    ..............................................................................
HGL_H00000171887    ..............................................................................
HGL_H00000320828    ..............................................................................
HGL_H00000319756    ..............................................................................
HGL_H00000005587    kdg...........................................................................
HGL_H00000334382    ..............................................................................
HGL_H00000329668    ..............................................................................
HGL_H00000305632-2  ..............................................................................
HGL_H00000398560-2  ..............................................................................
HGL_H00000364004-2  ..............................................................................
HGL_H00000331381    ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000370912-2  ..............................................................................
HGL_H00000245932    ..............................................................................
HGL_H00000344220    kvlkgeipwsqelrpeaknfktf.......................................................
HGL_H00000315136    ..............................................................................
HGL_H00000264554    ..............................................................................
HGL_H00000398655    ..............................................................................
HGL_H00000348150    ..............................................................................
HGL_H00000338934-1  ..............................................................................
HGL_H00000353518    ..............................................................................
HGL_H00000345752-1  ..............................................................................
HGL_H00000386867-1  ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000374195    ..............................................................................
HGL_H00000420773    ..............................................................................
HGL_H00000398560-1  ..............................................................................
HGL_H00000347169-1  ..............................................................................
HGL_H00000384136-2  ..............................................................................
HGL_H00000353408    ..............................................................................
HGL_H00000254051    ..............................................................................
HGL_H00000363458    ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000252891    ..............................................................................
HGL_H00000308774    ..............................................................................
HGL_H00000318965-3  ..............................................................................
HGL_H00000264042    ..............................................................................
HGL_H00000391677    ..............................................................................
HGL_H00000344666    ..............................................................................
HGL_H00000319831    yqeliqdvlkqgy.................................................................
HGL_H00000359423-2  ..............................................................................
HGL_H00000322926    ..............................................................................
HGL_H00000305632-1  ..............................................................................
HGL_H00000355133    ..............................................................................
HGL_H00000381083    ..............................................................................
HGL_H00000304701    ..............................................................................
HGL_H00000334105    ..............................................................................
HGL_H00000315630    ..............................................................................
HGL_H00000360275    ..............................................................................
HGL_H00000357110    ..............................................................................
HGL_H00000341138    ..............................................................................
HGL_H00000339184    ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000359417    ..............................................................................
HGL_H00000387784    ..............................................................................
HGL_H00000263713    ..............................................................................
HGL_H00000362904    ..............................................................................
HGL_H00000201647    ..............................................................................
HGL_H00000364754    ..............................................................................
HGL_H00000357177    ..............................................................................
HGL_H00000367394    ..............................................................................
HGL_H00000358820    ..............................................................................
HGL_H00000241014    ..............................................................................
HGL_H00000313391    ..............................................................................
HGL_H00000217381    ..............................................................................
HGL_H00000278412-3  ..............................................................................
HGL_H00000368824    ..............................................................................
HGL_H00000363694    ..............................................................................
HGL_H00000338191    ..............................................................................
HGL_H00000390595    ..............................................................................
HGL_H00000349259    ..............................................................................
HGL_H00000352995-2  ..............................................................................
HGL_H00000299084    ..............................................................................
HGL_H00000216373    ..............................................................................
HGL_H00000378649    ..............................................................................
HGL_H00000362109    ..............................................................................
HGL_H00000303508-1  ..............................................................................
HGL_H00000365891    ..............................................................................
HGL_H00000265963    ..............................................................................
HGL_N10018877       ..............................................................................
HGL_H00000338171    ..............................................................................
HGL_H00000341483    ..............................................................................
HGL_H00000403067    ..............................................................................
HGL_H00000330572    ..............................................................................
HGL_H00000394751    ..............................................................................
HGL_H00000402046    ..............................................................................
HGL_H00000374557    ..............................................................................
HGL_H00000261486    ..............................................................................
HGL_H00000363371-2  ..............................................................................
HGL_H00000376247    ..............................................................................
HGL_H00000318965-3  ..............................................................................
HGL_H00000384136-1  ..............................................................................
HGL_H00000372160    ..............................................................................
HGL_H00000352995-1  ..............................................................................
HGL_H00000359610    ..............................................................................
HGL_H00000374557    ..............................................................................
HGL_H00000234179    ..............................................................................
HGL_H00000262539    ..............................................................................
HGL_H00000364893    ..............................................................................
HGL_H00000391648-1  ..............................................................................
HGL_H00000379967-1  ..............................................................................
HGL_H00000353646    ..............................................................................
HGL_H00000279230    ..............................................................................
HGL_H00000304895    ..............................................................................
HGL_H00000330276    ..............................................................................
HGL_H00000233668    ..............................................................................
HGL_H00000416895    ..............................................................................
HGL_H00000394487    ..............................................................................
HGL_H00000345405    ..............................................................................
HGL_H00000386800-1  ..............................................................................
HGL_H00000408285-1  ..............................................................................
HGL_H00000393860    ..............................................................................
HGL_H00000260402    ..............................................................................
HGL_H00000311489    ..............................................................................
HGL_H00000263265    ..............................................................................
HGL_H00000353109    ..............................................................................
HGL_H00000288368    ..............................................................................
HGL_H00000344277    ..............................................................................
HGL_H00000262593    ..............................................................................
HGL_H00000401303-2  ..............................................................................
HGL_H00000322926    ..............................................................................
HGL_H00000339299    ..............................................................................
HGL_H00000378183    ..............................................................................
HGL_H00000381549    ..............................................................................
HGL_H00000376652-2  ..............................................................................
HGL_H00000276420    ..............................................................................
HGL_H00000302269    ..............................................................................
HGL_H00000296604    ..............................................................................
HGL_H00000248901    ..............................................................................
HGL_H00000370719    ..............................................................................
HGL_H00000359073    ..............................................................................
HGL_H00000298694    ..............................................................................
HGL_H00000360916    ..............................................................................
HGL_H00000263373    ..............................................................................
HGL_H00000374373    ..............................................................................
HGL_H00000264042    ..............................................................................
HGL_H00000335560    ..............................................................................
HGL_H00000352232    ..............................................................................
HGL_H00000261439-2  ..............................................................................
HGL_H00000282406    csilrgdnkqtvql................................................................
HGL_H00000379709    ..............................................................................
HGL_H00000364631    ..............................................................................
HGL_H00000353109    ..............................................................................
HGL_H00000356297    ..............................................................................
HGL_H00000410689    ..............................................................................
HGL_H00000391995    ..............................................................................
HGL_H00000412461    ..............................................................................
HGL_H00000357298    ..............................................................................
HGL_H00000256190    ..............................................................................
HGL_H00000354718    ..............................................................................
HGL_H00000349727    ..............................................................................
HGL_H00000379527    ..............................................................................
HGL_H00000264042    ..............................................................................
HGL_H00000346378    ..............................................................................
HGL_H00000367299-1  ..............................................................................
HGL_H00000330278    gqvdlnshcqivrgegaqtfqli.......................................................
HGL_H00000361202    ..............................................................................
HGL_H00000262940    ..............................................................................
HGL_H00000409493    ..............................................................................
HGL_H00000389787    ..............................................................................
HGL_H00000285094    ..............................................................................
HGL_H00000296414    ..............................................................................
HGL_H00000409572    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000364277    ..............................................................................
HGL_H00000234313    ..............................................................................
HGL_H00000395986    hvqps.........................................................................
HGL_H00000324287    ..............................................................................
HGL_H00000264057    ..............................................................................
HGL_H00000396185-1  ..............................................................................
HGL_H00000346378    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000366977    ..............................................................................
HGL_H00000304895    ..............................................................................
HGL_H00000399903    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000386911    ..............................................................................
HGL_H00000322926    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000336522    ..............................................................................
HGL_H00000402861    ..............................................................................
HGL_H00000312262    ..............................................................................
HGL_H00000367747    ..............................................................................
HGL_H00000250617    ..............................................................................
HGL_H00000288266    ..............................................................................
HGL_H00000352721    ..............................................................................
HGL_H00000351969    ..............................................................................
HGL_H00000020673    ..............................................................................
HGL_H00000366843    ..............................................................................
HGL_H00000158762    ..............................................................................
HGL_H00000274710    ..............................................................................
HGL_H00000362751    ..............................................................................
HGL_H00000276185    ..............................................................................
HGL_H00000407267    ..............................................................................
HGL_H00000251507    ..............................................................................
HGL_H00000245796    ..............................................................................
HGL_H00000316029    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000276204    ..............................................................................
HGL_H00000371397    ..............................................................................
HGL_H00000366284    ..............................................................................
HGL_H00000285046    ..............................................................................
HGL_H00000343899    ..............................................................................
HGL_H00000362014    ..............................................................................
HGL_H00000328118    ..............................................................................
HGL_H00000405405    ..............................................................................
HGL_H00000303476    ..............................................................................
HGL_H00000384312    ..............................................................................
HGL_H00000274376    ..............................................................................
HGL_H00000328800    ..............................................................................
HGL_H00000339299    ..............................................................................
HGL_H00000354611    ..............................................................................
HGL_H00000349298    ..............................................................................
HGL_H00000317786    ..............................................................................
HGL_H00000394225    ..............................................................................
HGL_H00000292140    ..............................................................................
HGL_H00000345988    ..............................................................................
HGL_H00000386733    ..............................................................................
HGL_H00000234313    ..............................................................................
HGL_H00000362405    ..............................................................................
HGL_H00000417003    ..............................................................................
HGL_H00000379967-2  ..............................................................................
HGL_H00000317912    ..............................................................................
HGL_M00000071081-2  ..............................................................................
HGL_M00000071081-1  ..............................................................................
HGL_H00000388152    ..............................................................................
HGL_H00000285046    ..............................................................................
HGL_H00000318965-1  ..............................................................................
HGL_H00000258390    ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000394487    ..............................................................................
HGL_H00000354919-1  slfpeplsiqshtvqflralwekaqaggahsfetammestfpqqkdldqvqlhleevrffdvfgfsetagawqcfmcn
HGL_H00000366995    ..............................................................................
HGL_H00000344961    ..............................................................................
HGL_H00000388152    ..............................................................................
HGL_N10025555       ..............................................................................
HGL_H00000288266    ..............................................................................
HGL_H00000373214    ..............................................................................
HGL_H00000295888    ..............................................................................
HGL_H00000385609    ..............................................................................
HGL_H00000386800-1  ..............................................................................
HGL_H00000345895    ..............................................................................
HGL_H00000399588    ..............................................................................
HGL_H00000364277    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000262995    ..............................................................................
HGL_H00000398481    ..............................................................................
HGL_H00000317786    ..............................................................................
HGL_H00000376700    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000339381    ..............................................................................
HGL_H00000263650    ..............................................................................
HGL_H00000393860    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000296721    ..............................................................................
HGL_H00000318965-1  ..............................................................................
HGL_H00000347244    ..............................................................................
HGL_H00000296721    ..............................................................................
HGL_H00000313731    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000261729    ..............................................................................
HGL_H00000410689    ..............................................................................
HGL_H00000348828    ..............................................................................
HGL_H00000347134    ..............................................................................
HGL_H00000415034    ..............................................................................
HGL_H00000386331    ..............................................................................
HGL_H00000330278    ..............................................................................
HGL_H00000350297    ..............................................................................
HGL_H00000265748    ..............................................................................
HGL_H00000376700    ..............................................................................
HGL_H00000011684    ..............................................................................
HGL_H00000338769    ..............................................................................
HGL_H00000279227    ..............................................................................
HGL_H00000407746    ..............................................................................
HGL_H00000303909    ..............................................................................
HGL_H00000326706    ..............................................................................
HGL_H00000405963    ..............................................................................
HGL_H00000395182    ..............................................................................
HGL_H00000217289    ..............................................................................
HGL_H00000341071    ..............................................................................
HGL_H00000368719    ..............................................................................
HGL_H00000298542    ..............................................................................
HGL_H00000264051    ..............................................................................
HGL_H00000364207    ..............................................................................
HGL_H00000279227    ..............................................................................
HGL_H00000286827    ..............................................................................
HGL_H00000396519    ..............................................................................
HGL_H00000345808-3  ..............................................................................
HGL_H00000367764    ..............................................................................
HGL_M00000082342    ..............................................................................
HGL_H00000378262    ..............................................................................
HGL_H00000261439-1  ..............................................................................
HGL_H00000056217    ..............................................................................
HGL_H00000221086    ..............................................................................
HGL_H00000274498    ..............................................................................
HGL_H00000342858-1  ..............................................................................
HGL_H00000320563    ..............................................................................
HGL_H00000311837    ..............................................................................
HGL_H00000346127    ..............................................................................
HGL_H00000272666    ..............................................................................
HGL_H00000363371-1  ..............................................................................
HGL_H00000315410    ..............................................................................
HGL_H00000282406    ..............................................................................
HGL_H00000281172    ..............................................................................
HGL_H00000265080    ..............................................................................
HGL_H00000412733-1  ..............................................................................
HGL_H00000262593    ..............................................................................
HGL_H00000386800-2  ..............................................................................
HGL_H00000356655    ..............................................................................
HGL_H00000407267    ..............................................................................
HGL_H00000403323    ..............................................................................
HGL_H00000362369    ..............................................................................
HGL_H00000217289    ..............................................................................
HGL_H00000336923    ..............................................................................
HGL_H00000411012-3  ..............................................................................
HGL_H00000180173-2  ..............................................................................
HGL_H00000342858-1  ..............................................................................
HGL_H00000386897    ..............................................................................
HGL_H00000407163    ..............................................................................
HGL_H00000256190    ..............................................................................
HGL_H00000303507    ..............................................................................
HGL_H00000354952    ..............................................................................
HGL_H00000411012-2  ..............................................................................
HGL_H00000312753    ..............................................................................
HGL_H00000339769-3  ..............................................................................
HGL_H00000344277    ..............................................................................
HGL_H00000371221    ..............................................................................
HGL_H00000362894    ..............................................................................
HGL_H00000376293    ..............................................................................
HGL_H00000406026    ..............................................................................
HGL_H00000259351    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000380413    ..............................................................................
HGL_H00000364631    ..............................................................................
HGL_H00000378262    ..............................................................................
HGL_H00000363617    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000263826-1  ..............................................................................
HGL_H00000298815    ..............................................................................
HGL_H00000365411    ..............................................................................
HGL_H00000407834    ..............................................................................
HGL_H00000368719    ..............................................................................
HGL_H00000361009    ..............................................................................
HGL_H00000402299    ..............................................................................
HGL_H00000367638    ..............................................................................
HGL_H00000411012-1  ..............................................................................
HGL_H00000371067    ..............................................................................
HGL_H00000356607    ..............................................................................
HGL_H00000339769-2  ..............................................................................
HGL_H00000342858-2  ..............................................................................
HGL_H00000254806    ..............................................................................
HGL_H00000389913-1  ..............................................................................
HGL_H00000367629    ..............................................................................
HGL_H00000364550    ..............................................................................
HGL_H00000333568    ..............................................................................
HGL_H00000328160    ..............................................................................
HGL_H00000391668    ..............................................................................
HGL_N10005278       ..............................................................................
HGL_H00000403459    ..............................................................................
HGL_H00000260283    ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000381793    ..............................................................................
HGL_H00000372160    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000377566    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000405963    ..............................................................................
HGL_H00000325285    ..............................................................................
HGL_H00000315662    ..............................................................................
HGL_H00000338185    ..............................................................................
HGL_H00000283937    ..............................................................................
HGL_H00000201647    ..............................................................................
HGL_H00000265080    ..............................................................................
HGL_H00000371577    ..............................................................................
HGL_H00000342804    ..............................................................................
HGL_H00000417003    ..............................................................................
HGL_H00000385326    ..............................................................................
HGL_H00000264276    ..............................................................................
HGL_H00000384651    ..............................................................................
HGL_H00000276420    ..............................................................................
HGL_H00000352336    ..............................................................................
HGL_H00000231487-8  ..............................................................................
HGL_H00000272430    ..............................................................................
HGL_H00000356278    ..............................................................................
HGL_H00000399532-2  ..............................................................................
HGL_H00000263847    ..............................................................................
HGL_H00000362409    ..............................................................................
HGL_H00000337572-2  ..............................................................................
HGL_H00000355026    ..............................................................................
HGL_H00000363317    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000382697    ..............................................................................
HGL_N10007969       ..............................................................................
HGL_H00000320291    ..............................................................................
HGL_H00000342793    ..............................................................................
HGL_H00000317985    ..............................................................................
HGL_H00000317578    ..............................................................................
HGL_H00000391648-2  ..............................................................................
HGL_H00000407802    ..............................................................................
HGL_H00000369121    ..............................................................................
HGL_H00000233668    ..............................................................................
HGL_H00000386183    ..............................................................................
HGL_H00000401910    ..............................................................................
HGL_H00000259406    ..............................................................................
HGL_H00000377386    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000361202    ..............................................................................
HGL_H00000345492    ..............................................................................
HGL_H00000376306    ..............................................................................
HGL_H00000349727    ..............................................................................
HGL_H00000345133    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000270747    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000355060    ..............................................................................
HGL_H00000412733-6  ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000264818    ..............................................................................
HGL_H00000300584    ..............................................................................
HGL_H00000295095-2  ..............................................................................
HGL_H00000335341-1  ..............................................................................
HGL_H00000318075    ..............................................................................
HGL_H00000262719    ..............................................................................
HGL_H00000335341-2  ..............................................................................
HGL_H00000263674    ..............................................................................
HGL_H00000356621    ..............................................................................
HGL_H00000345808-1  ..............................................................................
HGL_H00000397663-5  ..............................................................................
HGL_H00000379804    ..............................................................................
HGL_H00000336522    ..............................................................................
HGL_H00000358316    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000234453-1  ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000263088    ..............................................................................
HGL_H00000343204    ..............................................................................
HGL_H00000315334    ..............................................................................
HGL_H00000339769-4  ..............................................................................
HGL_H00000348611    ..............................................................................
HGL_H00000389913-1  ..............................................................................
HGL_H00000264554    ..............................................................................
HGL_H00000311837    ..............................................................................
HGL_H00000342858-4  ..............................................................................
HGL_H00000007414    ..............................................................................
HGL_H00000381571    ..............................................................................
HGL_H00000293349    ..............................................................................
HGL_H00000342804    ..............................................................................


                                                                   10        20        30           
                                                                    |         |         |           
d1mi1a2               .....................................--VVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDE..D.DS
HGL_H00000278412-1  .....................................-----------------------------------..-.--
HGL_H00000278412-2  .....................................-----------V-----------------------..-.--
HGL_H00000286827    .....................................----------------------L------------..-.--
HGL_H00000407746    .....................................-----------------------------------..-.--
HGL_H00000401303-1  .....................................------------------P----------------..-.--
HGL_H00000265381    .....................................-----------------------------------..-.--
HGL_H00000413502    .....................................---------------------L-------------..-.--
HGL_H00000401303-3  .....................................----------------------------L------..-.--
HGL_H00000219865    .....................................-----------------------------------..-.--
HGL_H00000391942    .....................................-----------------------------------..-.--
HGL_H00000341737    .....................................----------------Q------------------..-.--
HGL_H00000364995    .....................................-------------------------------F---..-.--
HGL_H00000308176    .....................................-----------------------------------..-.--
HGL_H00000381854    .....................................-----------------------------------..-.--
HGL_H00000280665    .....................................-----------------------------------..-.--
HGL_H00000171887    .....................................-----------------------------------..-.--
HGL_H00000320828    .....................................-----------------------------------..-.--
HGL_H00000319756    .....................................-----------------------------------..-.--
HGL_H00000005587    .....................................-----------------------------------..-.--
HGL_H00000334382    .....................................-----------------------------------..-.--
HGL_H00000329668    .....................................-----------------------------------..-.--
HGL_H00000305632-2  .....................................--------A--------------------------..-.--
HGL_H00000398560-2  .....................................-----------------------------------..-.--
HGL_H00000364004-2  .....................................-----------------------------------..-.--
HGL_H00000331381    .....................................-------------LSVSYKGVKFIDATNKNIIAE-..-.-H
HGL_H00000283195    .....................................-----------I-----------------------..-.--
HGL_H00000370912-2  .....................................------------------ERLFVLTKSMLTYYEGR..A.EK
HGL_H00000245932    .....................................------INCAIV-----------------------..-.--
HGL_H00000344220    .....................................-----------------------------------..-.--
HGL_H00000315136    .....................................-----------------------------------..-.--
HGL_H00000264554    .....................................-----------------------------------..-.--
HGL_H00000398655    .....................................-----------------------------------..-.--
HGL_H00000348150    .....................................-------------N---------------------..-.--
HGL_H00000338934-1  .....................................-----------------------------------..-.--
HGL_H00000353518    .....................................-------------------------A---------..-.--
HGL_H00000345752-1  .....................................--------------TGAVRGTLTVTNYRLYFKS--..-.--
HGL_H00000386867-1  .....................................-------------------------NKHLYYVFN-..-.--
HGL_H00000283195    .....................................--------------------PLNVSNNALVWT---..-.--
HGL_H00000374195    .....................................-----------------------------------..-.--
HGL_H00000420773    .....................................-----------------------------------..-.--
HGL_H00000398560-1  .....................................----------------------------L------..-.--
HGL_H00000347169-1  .....................................-----------------VKAVLWVSADGLRVVD--..-.--
HGL_H00000384136-2  .....................................-----------------------------------..-.--
HGL_H00000353408    .....................................-----------------------------------..-.--
HGL_H00000254051    .....................................-----------------------------------..-.--
HGL_H00000363458    .....................................-----------------------------------..-.--
HGL_H00000283195    .....................................--------------------------------L--..-.--
HGL_H00000252891    .....................................---------------------------------D-..-.--
HGL_H00000308774    .....................................---------------------FVLTKTNLSYYEYD..K.MK
HGL_H00000318965-3  .....................................E----------------------------------..-.--
HGL_H00000264042    .....................................-----------------------------------..-.--
HGL_H00000391677    .....................................-----------------------------------..-.--
HGL_H00000344666    .....................................-----------------------------------..-.--
HGL_H00000319831    .....................................-----------------------------------..-.--
HGL_H00000359423-2  .....................................----------------PIKGRVYITNYRLYLRS--..-.--
HGL_H00000322926    .....................................-----------------------------------..-.--
HGL_H00000305632-1  .....................................---------D-------------------------..-.--
HGL_H00000355133    .....................................--------------------K--------------..-.--
HGL_H00000381083    .....................................-------------------GIMELTDTELILYTR-..-.--
HGL_H00000304701    .....................................-----------------------------------..-.--
HGL_H00000334105    .....................................-------------S---------------------..-.--
HGL_H00000315630    .....................................-----------------------------------..-.--
HGL_H00000360275    .....................................-----------------------------------..-.--
HGL_H00000357110    .....................................-----------------------------------..-.--
HGL_H00000341138    .....................................-----------------------------------..-.--
HGL_H00000339184    .....................................-----------------------------------..-.--
HGL_H00000283195    .....................................-----------------------------------..-.--
HGL_H00000359417    .....................................-------------FMGAVSGTLTVTDFKMYFKNVE..R.DP
HGL_H00000387784    .....................................-----------------------------------..-.--
HGL_H00000263713    .....................................-----------------------------------..-.--
HGL_H00000362904    .....................................-----------------------------------..-.--
HGL_H00000201647    .....................................-----------------------------------..-.--
HGL_H00000364754    .....................................-----------------------------------..-.--
HGL_H00000357177    .....................................------L----------------------------..-.--
HGL_H00000367394    .....................................-----------------------------------..-.--
HGL_H00000358820    .....................................-----------------------------------..-.--
HGL_H00000241014    .....................................-----------------------------------..-.--
HGL_H00000313391    .....................................-----------------------------------..-.--
HGL_H00000217381    .....................................-----------------------------------..-.--
HGL_H00000278412-3  .....................................-----------------------------------..-.--
HGL_H00000368824    .....................................---------------------FVLKDASLYWYINE..E.DE
HGL_H00000363694    .....................................-----------------------------------..-.--
HGL_H00000338191    .....................................-----------------------------------..-.--
HGL_H00000390595    .....................................------------------------------V----..-.--
HGL_H00000349259    .....................................-----------------------------------..-.--
HGL_H00000352995-2  .....................................-----------------------------------..-.--
HGL_H00000299084    .....................................---------------------L-------------..-.--
HGL_H00000216373    .....................................-----------------------------------..-.--
HGL_H00000378649    .....................................-----------------------------------..-.--
HGL_H00000362109    .....................................-----------------------------------..-.--
HGL_H00000303508-1  .....................................-----------------------------------..-.--
HGL_H00000365891    .....................................-----------------------------------..-.--
HGL_H00000265963    .....................................---------Q-------------------------..-.--
HGL_N10018877       .....................................-----------------------------------..-.--
HGL_H00000338171    .....................................-----------------------------------..-.--
HGL_H00000341483    .....................................-----------------------------------..-.--
HGL_H00000403067    .....................................-------------------------------YLYV..S.QK
HGL_H00000330572    .....................................-----------------------------------..-.--
HGL_H00000394751    .....................................---------------------VVLKGSSLYWYSNQ..M.AE
HGL_H00000402046    .....................................-----------------------------------..-.--
HGL_H00000374557    .....................................-----------------------------------..-.--
HGL_H00000261486    .....................................-----------------------------------..-.--
HGL_H00000363371-2  .....................................----------------WRRCWFVLKGHMLYWYHQP..Q.DE
HGL_H00000376247    .....................................--------------------WFILTDNCLYYFEYT..T.DK
HGL_H00000318965-3  .....................................------------------------E----------..-.--
HGL_H00000384136-1  .....................................-----------------------------------..-.--
HGL_H00000372160    .....................................------------------ECTMQITHENIYLWD--..-.--
HGL_H00000352995-1  .....................................-----------------------------------..-.--
HGL_H00000359610    .....................................-----------------------------------..-.--
HGL_H00000374557    .....................................-----------------------I-----------..-.--
HGL_H00000234179    .....................................-----------------------------------..-.--
HGL_H00000262539    .....................................-----------------------------------..-.--
HGL_H00000364893    .....................................-----------------------------------..-.--
HGL_H00000391648-1  .....................................--------------------WFILTDNCLYYFEYT..T.DK
HGL_H00000379967-1  .....................................--------------------WFILTDNCLYYFEYT..T.DK
HGL_H00000353646    .....................................-----------------------------------..-.--
HGL_H00000279230    .....................................--------------M--------------------..-.--
HGL_H00000304895    .....................................-----------------------LTSKTISFVK--..-.--
HGL_H00000330276    .....................................-----------------------------------..-.--
HGL_H00000233668    .....................................-----------------------------------..-.--
HGL_H00000416895    .....................................-----------------------------------..-.--
HGL_H00000394487    .....................................-----------------------------------..-.--
HGL_H00000345405    .....................................-----------------------------------..-.--
HGL_H00000386800-1  .....................................--------------------------KRRYFQLDE..N.TI
HGL_H00000408285-1  .....................................-----------------------------------..-.--
HGL_H00000393860    .....................................-----------------------------------..-.--
HGL_H00000260402    .....................................-----------------------------------..-.--
HGL_H00000311489    .....................................-----------------------------------..-.--
HGL_H00000263265    .....................................-----------------------------------..-.--
HGL_H00000353109    .....................................-------------------GELILQDAFQVWDPKS..L.IR
HGL_H00000288368    .....................................-----------------------------------..-.--
HGL_H00000344277    .....................................------------------ECKLQITHENIYLWD--..-.--
HGL_H00000262593    .....................................-----------------------ITYECIC-----..-.--
HGL_H00000401303-2  .....................................-----------------------------------..-.--
HGL_H00000322926    .....................................-----------------------------------..-.-D
HGL_H00000339299    .....................................-----------------AQGKLLLQDTFLVTDQDA..-.--
HGL_H00000378183    .....................................------------------SSLMLIESTRDSLCFTV..T.HY
HGL_H00000381549    .....................................-----------------------------------..-.--
HGL_H00000376652-2  .....................................-------------------------Q---------..-.--
HGL_H00000276420    .....................................-----------------------------------..-.--
HGL_H00000302269    .....................................-----------------------------------..-.--
HGL_H00000296604    .....................................-----------------------------------..-.--
HGL_H00000248901    .....................................--------------------WFILTDNCLYYFEFT..T.DK
HGL_H00000370719    .....................................-----------------------------------..-.--
HGL_H00000359073    .....................................-----------------------------------..-.--
HGL_H00000298694    .....................................-----------------------------------..-.--
HGL_H00000360916    .....................................-----------------------------------..-.--
HGL_H00000263373    .....................................-----------------------------------..-.--
HGL_H00000374373    .....................................-----------------------------------..-.--
HGL_H00000264042    .....................................--------------------------------D--..-.--
HGL_H00000335560    .....................................-----------------------------------..-.--
HGL_H00000352232    .....................................----------------------------------T..-.--
HGL_H00000261439-2  .....................................-----------------------------Y-----..-.--
HGL_H00000282406    .....................................-----------------------------------..-.--
HGL_H00000379709    .....................................-----------------------------------..-.--
HGL_H00000364631    .....................................-----------------------------------..-.--
HGL_H00000353109    .....................................-----------------------------Y-----..-.--
HGL_H00000356297    .....................................-----------------------------------..-.--
HGL_H00000410689    .....................................-------------------C---------------..-.--
HGL_H00000391995    .....................................--------------------------K--------..-.--
HGL_H00000412461    .....................................-----------------------------------..-.--
HGL_H00000357298    .....................................-----------------------------------..-.--
HGL_H00000256190    .....................................-------------------------------Y---..-.--
HGL_H00000354718    .....................................-----------------------------------..-.--
HGL_H00000349727    .....................................-----------------------------------..-.--
HGL_H00000379527    .....................................-----------------------------------..-.--
HGL_H00000264042    .....................................-----------------------M-----------..-.--
HGL_H00000346378    .....................................-------------------A---------------..-.--
HGL_H00000367299-1  .....................................------------------AGTLLLSTHRLIWRDQ-..-.--
HGL_H00000330278    .....................................-----------------------------------..-.--
HGL_H00000361202    .....................................-----------------------------------..-.--
HGL_H00000262940    .....................................-----------------------------------..-.--
HGL_H00000409493    .....................................-----------------------------------..-.--
HGL_H00000389787    .....................................-----------------------------------..-.--
HGL_H00000285094    .....................................-----------------------------------..-.--
HGL_H00000296414    .....................................-----------------------------------..-.--
HGL_H00000409572    .....................................-----------------------------------..-.--
HGL_H00000377233    .....................................-----------------------------------..-.--
HGL_H00000364277    .....................................------------------------------Y----..-.--
HGL_H00000234313    .....................................-----------------------------------..-.--
HGL_H00000395986    .....................................-----------------------------------..-.--
HGL_H00000324287    .....................................-----------------------------------..-.--
HGL_H00000264057    .....................................--------------------------------F--..-.--
HGL_H00000396185-1  .....................................-----------------------------------..-.--
HGL_H00000346378    .....................................-----------------------------------..-.-S
HGL_H00000391106    .....................................-----------------------------------..-.--
HGL_H00000366977    .....................................-----------------------------------..-.--
HGL_H00000304895    .....................................-----------------------------------..-.--
HGL_H00000399903    .....................................EKLVLTEDCELITMTDVIPGKLEITTQHIYFYDGS..I.EK
HGL_H00000346733    .....................................-----------------------------------..-.--
HGL_H00000386911    .....................................-----------------------------------..-.--
HGL_H00000322926    .....................................-----------------------------L-----..-.--
HGL_H00000377233    .....................................-----------------------------------..-.--
HGL_H00000336522    .....................................-----------------------------------..-.--
HGL_H00000402861    .....................................-----------------------------------..-.--
HGL_H00000312262    .....................................----------------------------------R..-.--
HGL_H00000367747    .....................................-----------------------------------..-.--
HGL_H00000250617    .....................................-----------------------------------..-.--
HGL_H00000288266    .....................................------------LAARAIHNIFRMTESHLLVTCDC..L.K-
HGL_H00000352721    .....................................-----------------------------------..-.--
HGL_H00000351969    .....................................-----------------------------------..-.--
HGL_H00000020673    .....................................-----------------------------------..-.--
HGL_H00000366843    .....................................-----------------------------------..-.--
HGL_H00000158762    .....................................-----------------------------------..-.--
HGL_H00000274710    .....................................-----------------------------------..-.--
HGL_H00000362751    .....................................-----------------------------------..-.--
HGL_H00000276185    .....................................---------------R-------------------..-.--
HGL_H00000407267    .....................................-----------------------------------..-.--
HGL_H00000251507    .....................................-----------------------------------..-.--
HGL_H00000245796    .....................................-----------------------------------..-.--
HGL_H00000316029    .....................................-------------------------KECVMRVD--..-.--
HGL_H00000216446    .....................................-----------------------------------..-.--
HGL_H00000276204    .....................................-----------------------------------..-.--
HGL_H00000371397    .....................................------------------PGHLYLLHRVTYCVA--..-.--
HGL_H00000366284    .....................................-----------------------------------..-.--
HGL_H00000285046    .....................................-----------------------------------..-.--
HGL_H00000343899    .....................................-----------------------------------..-.--
HGL_H00000362014    .....................................-----------------------------------..-.--
HGL_H00000328118    .....................................-----------------------------------..-.--
HGL_H00000405405    .....................................-----------------------------------..-.--
HGL_H00000303476    .....................................-----------------------------------..-.--
HGL_H00000384312    .....................................---------------------FVLTDSSLKYYRDS..T.AE
HGL_H00000274376    .....................................------------------KGLIDLSVCSVYVVHDS..L.FG
HGL_H00000328800    .....................................----------------TKRGTLFLTSYRVIFVRAY..S.VS
HGL_H00000339299    .....................................------------------QGELILQESFQVWDPKT..L.IR
HGL_H00000354611    .....................................-----------------------------------..-.--
HGL_H00000349298    .....................................-----------------------------------..-.--
HGL_H00000317786    .....................................-----------------------------------..-.--
HGL_H00000394225    .....................................-----------------------------------..-.--
HGL_H00000292140    .....................................------------------------------Y----..-.--
HGL_H00000345988    .....................................-----------------------------------..-.--
HGL_H00000386733    .....................................-----------------------------------..-.--
HGL_H00000234313    .....................................-----------------------------------..-.--
HGL_H00000362405    .....................................---------------------------H-------..-.--
HGL_H00000417003    .....................................-----------------------------------..-.--
HGL_H00000379967-2  .....................................--------------------WFTLTDNCLYYFEHT..T.DK
HGL_H00000317912    .....................................----------------CVPSNLTLLPGHLYMMSE-..-.--
HGL_M00000071081-2  .....................................-----------------------------------..-.--
HGL_M00000071081-1  .....................................-----------------------------------..-.--
HGL_H00000388152    .....................................-----------------------------------..-.--
HGL_H00000285046    .....................................--------------------------------H--..-.--
HGL_H00000318965-1  .....................................-----------------------------------..-.--
HGL_H00000258390    .....................................-----------------------------------..-.--
HGL_H00000258530    .....................................-----------------V-----------------..-.--
HGL_H00000394487    .....................................-----------------------------------..-.--
HGL_H00000354919-1  npekatvvnqdgqpliegklkekqvrwkfikrwktry---------------------FTLAGNQLLFQKGK..S.KD
HGL_H00000366995    .....................................---------------------SQIINSKLNIMSTL..A.EF
HGL_H00000344961    .....................................----------------------------------F..-.--
HGL_H00000388152    .....................................-----------------------------------..-.--
HGL_N10025555       .....................................-----------------------------------..-.--
HGL_H00000288266    .....................................-----------------------------------..-.--
HGL_H00000373214    .....................................-----------------------------------..-.--
HGL_H00000295888    .....................................EKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGF..T.MT
HGL_H00000385609    .....................................--------------------------GHLIYYDDQ..T.RQ
HGL_H00000386800-1  .....................................-----------------------------------..-.--
HGL_H00000345895    .....................................-----------------------------------..-.--
HGL_H00000399588    .....................................-----------------------------------..-.--
HGL_H00000364277    .....................................---------------------FKITQSHLSWYFSP..E.TE
HGL_H00000391106    .....................................-----------------------------------..-.--
HGL_H00000262995    .....................................-----------------------------------..-.--
HGL_H00000398481    .....................................-----------------------------------..-.--
HGL_H00000317786    .....................................-----------------------------------..-.--
HGL_H00000376700    .....................................-----------------------------------..-.--
HGL_H00000216446    .....................................-----------------------------------..-.--
HGL_H00000281419    .....................................-----------------------------N-----..-.--
HGL_H00000339381    .....................................-----------------------------------..-.--
HGL_H00000263650    .....................................-----------------------------------..-.--
HGL_H00000393860    .....................................-----------------------------------..-.--
HGL_H00000302895    .....................................-----------------------------------..-.--
HGL_H00000296721    .....................................----------------L------------------..-.--
HGL_H00000318965-1  .....................................----------------------------H------..-.--
HGL_H00000347244    .....................................--------------------Q--------------..-.--
HGL_H00000296721    .....................................--------------------------------A--..-.--
HGL_H00000313731    .....................................-----------------------------------..-.--
HGL_H00000302895    .....................................-----------------------------------..-.--
HGL_H00000261729    .....................................-----------------------------------..-.--
HGL_H00000410689    .....................................-----------------------------------..-.--
HGL_H00000348828    .....................................-----------------------------------..-.--
HGL_H00000347134    .....................................-----------------------------------..-.--
HGL_H00000415034    .....................................EKLVLSAECQLVTVVAVVPGLLEVTTQHVYFYDGS..A.ER
HGL_H00000386331    .....................................----------------------------------W..-.--
HGL_H00000330278    .....................................--L--------------------------------..-.--
HGL_H00000350297    .....................................-----------------------------------..-.--
HGL_H00000265748    .....................................-----------------------------------..-.--
HGL_H00000376700    .....................................-----------------------VRDSHLHFYQDR..N.RS
HGL_H00000011684    .....................................-----------------------------------..-.--
HGL_H00000338769    .....................................------------------Y----------------..-.--
HGL_H00000279227    .....................................-----------------------------------..-.--
HGL_H00000407746    .....................................-----------------------------------..-.--
HGL_H00000303909    .....................................-----------------------------------..-.--
HGL_H00000326706    .....................................-----------------------------------..-.--
HGL_H00000405963    .....................................-------------------------E---------..-.--
HGL_H00000395182    .....................................-----------------------------------..-.-D
HGL_H00000217289    .....................................-----------------------------------..-.--
HGL_H00000341071    .....................................-----------------------------------..-.--
HGL_H00000368719    .....................................---------------DVSDCFLELFPSHLYFQAH-..-.--
HGL_H00000298542    .....................................-----------------------------------..-.--
HGL_H00000264051    .....................................-----------------------------------..-.--
HGL_H00000364207    .....................................------------------------K----------..-.--
HGL_H00000279227    .....................................-----------------------------------..-.--
HGL_H00000286827    .....................................-----------------------------------..-.--
HGL_H00000396519    .....................................-----------------------------------..-.--
HGL_H00000345808-3  .....................................-----------------------------------..-.--
HGL_H00000367764    .....................................-----------------------------------..-.--
HGL_M00000082342    .....................................-----------------------IKESFLLYYSES..E.--
HGL_H00000378262    .....................................---------------------------------E-..-.--
HGL_H00000261439-1  .....................................-----------------------------------..-.--
HGL_H00000056217    .....................................-----------------------------------..-.--
HGL_H00000221086    .....................................----------------AVEGTLCLTGHHLILSSRQ..D.NT
HGL_H00000274498    .....................................-----------------------------------..-.--
HGL_H00000342858-1  .....................................-----------------------------------..-.--
HGL_H00000320563    .....................................EKVTQKFSLVIVQGHLVSEGILLFGHQHFYLCENF..T.LS
HGL_H00000311837    .....................................-----------------------------------..-.--
HGL_H00000346127    .....................................-----------------------------------..-.--
HGL_H00000272666    .....................................-----------------RHGVLLIHPKTKELLTTY..P.FT
HGL_H00000363371-1  .....................................-----------------------------------..-.--
HGL_H00000315410    .....................................-----------------------------------..-.--
HGL_H00000282406    .....................................------------------------GKTLYYFRSQE..D.KF
HGL_H00000281172    .....................................-----------------------------------..-.--
HGL_H00000265080    .....................................-----------------------------------..-.--
HGL_H00000412733-1  .....................................-----------------------------------..-.--
HGL_H00000262593    .....................................-----------------------------------..-.--
HGL_H00000386800-2  .....................................-----------------------------------..-.--
HGL_H00000356655    .....................................-----------------------------------..-.--
HGL_H00000407267    .....................................-----------------------------------..-.--
HGL_H00000403323    .....................................-----------------------------------..-.--
HGL_H00000362369    .....................................-----------------------------------..-.--
HGL_H00000217289    .....................................-----------------------------------..-.--
HGL_H00000336923    .....................................---------------------------E-------..-.--
HGL_H00000411012-3  .....................................---------------------------GMYFVEDN..A.SD
HGL_H00000180173-2  .....................................---------DRVSSKKSALGTLYLTATHVIFMENA..P.DT
HGL_H00000342858-1  .....................................---------------V-------------------..-.--
HGL_H00000386897    .....................................-----------------------------------..-.--
HGL_H00000407163    .....................................------------LRPSLTYCIVPCSNGILYQYPD-..-.--
HGL_H00000256190    .....................................---------------LPAEGALFLTTYRILFRGTP..H.DQ
HGL_H00000303507    .....................................-----------------------------------..-.--
HGL_H00000354952    .....................................-----------------------------------..-.--
HGL_H00000411012-2  .....................................EKLHMECKAEMVTPLVTNPGHVCITDTNLYFQP--..-.--
HGL_H00000312753    .....................................-----------------------------------..-.--
HGL_H00000339769-3  .....................................-----------------------------------..-.--
HGL_H00000344277    .....................................-----------------------------------..-.--
HGL_H00000371221    .....................................----------------SLTGTLYLTATHLLFIDSH..Q.KE
HGL_H00000362894    .....................................-----------------------------------..-.--
HGL_H00000376293    .....................................-----------------------------------..-.--
HGL_H00000406026    .....................................-----------------------------------..-.--
HGL_H00000259351    .....................................-----------------------------------..-.--
HGL_H00000302895    .....................................-----------------------------------..-.--
HGL_H00000380413    .....................................-------------------G---------------..-.--
HGL_H00000364631    .....................................-----------------------------------..-.--
HGL_H00000378262    .....................................-----------------------------------..-.--
HGL_H00000363617    .....................................-----------------------------------..-.--
HGL_H00000378965    .....................................------------------------------F----..-.--
HGL_H00000263826-1  .....................................-----------------------------------..-.--
HGL_H00000298815    .....................................-----------------------------------..-.--
HGL_H00000365411    .....................................-----------------------------------..-.--
HGL_H00000407834    .....................................-----------------------------------..-.--
HGL_H00000368719    .....................................----------------------------I------..-.--
HGL_H00000361009    .....................................-----------------------------------..-.--
HGL_H00000402299    .....................................-----------------------------------..-.--
HGL_H00000367638    .....................................-----------------------------------..-.--
HGL_H00000411012-1  .....................................EKLHIECKAEMVTPLVTNPGHVCITDTNLYFQP--..-.--
HGL_H00000371067    .....................................-----------------------------------..-.--
HGL_H00000356607    .....................................-----------------------------------..-.--
HGL_H00000339769-2  .....................................-----------------------------------..-.--
HGL_H00000342858-2  .....................................-----------------------------------..-.--
HGL_H00000254806    .....................................-----------------------------------..-.--
HGL_H00000389913-1  .....................................--------C--------------------------..-.--
HGL_H00000367629    .....................................-----------------------------------..-.--
HGL_H00000364550    .....................................---------------------F-------------..-.--
HGL_H00000333568    .....................................-----------------NPHCFEITTTNVVYYVG-..-.--
HGL_H00000328160    .....................................----------------K------------------..-.--
HGL_H00000391668    .....................................-----------------LPGTLICTNFRVTFWPCG..W.QR
HGL_N10005278       .....................................------------------------KDGCLYFYFSI..R.ST
HGL_H00000403459    .....................................-----------------------------------..-.--
HGL_H00000260283    .....................................-----------------------------------..-.--
HGL_H00000258530    .....................................--------------------IFRMTESHLLVTSQ-..-.--
HGL_H00000381793    .....................................-----------------------------------..-.--
HGL_H00000372160    .....................................-----------------------------------..-.--
HGL_H00000377233    .....................................-----------------------------------..-.-L
HGL_H00000377566    .....................................-----------------------------------..-.--
HGL_H00000302895    .....................................-----------------------------------..-.--
HGL_H00000405963    .....................................-------SKHLIICTRGSGGKLHLTKNGVISLIDC..T.LL
HGL_H00000325285    .....................................-----------------------------------..-.--
HGL_H00000315662    .....................................-----------------------------------..-.--
HGL_H00000338185    .....................................----------------------------L------..-.--
HGL_H00000283937    .....................................------------------------STTGMQFLSGC..T.EK
HGL_H00000201647    .....................................-----------------------------------..-.--
HGL_H00000265080    .....................................-------------------------K---------..-.--
HGL_H00000371577    .....................................-----------------VYGRLICTDFKIAFLSDD..EsAL
HGL_H00000342804    .....................................-----------------------------------..-.--
HGL_H00000417003    .....................................------------------------S----------..-.--
HGL_H00000385326    .....................................-----------------------------------..-.--
HGL_H00000264276    .....................................-----------------------------------..-.--
HGL_H00000384651    .....................................-----------------------------------..-.--
HGL_H00000276420    .....................................-------------E---------------------..-.--
HGL_H00000352336    .....................................------------------------G----------..-.--
HGL_H00000231487-8  .....................................-------------------------------A---..-.--
HGL_H00000272430    .....................................-----------------------------------..-.--
HGL_H00000356278    .....................................-----------------------------------..-.--
HGL_H00000399532-2  .....................................-----------------------------------..-.--
HGL_H00000263847    .....................................--------------RHTCRGTINLATANITVEDSCnfV.IS
HGL_H00000362409    .....................................------------------A----------------..-.--
HGL_H00000337572-2  .....................................-----------------------------------..-.--
HGL_H00000355026    .....................................-------------------C---------------..-.--
HGL_H00000363317    .....................................------------------IGTLWFPRREIGKISTY..W.TG
HGL_H00000378965    .....................................-----------------------------------..-.--
HGL_H00000382697    .....................................----------------------VVSSKKILFYNDE..Q.DK
HGL_N10007969       .....................................-----------------------------------..-.--
HGL_H00000320291    .....................................-----------------------------F-----..-.--
HGL_H00000342793    .....................................-----------------------------------..-.--
HGL_H00000317985    .....................................---------------------VIVSSKKILFYDSE..Q.DK
HGL_H00000317578    .....................................-----------------------------------..-.--
HGL_H00000391648-2  .....................................-----------------A-----------------..-.--
HGL_H00000407802    .....................................----------------------------L------..-.--
HGL_H00000369121    .....................................----------------------------ILFIYYM..V.H-
HGL_H00000233668    .....................................-K---------------------------------..-.--
HGL_H00000386183    .....................................-----------------------------------..-.--
HGL_H00000401910    .....................................-----------------------------------..-.--
HGL_H00000259406    .....................................-----------------------------------..-.--
HGL_H00000377386    .....................................-----------------------------------..-.--
HGL_H00000377233    .....................................-----------------------------------..-.--
HGL_H00000361202    .....................................-----------------------------------..E.--
HGL_H00000345492    .....................................-----------------------------------..-.--
HGL_H00000376306    .....................................-----------------------------------..-.N-
HGL_H00000349727    .....................................-----------V-----------------------..-.--
HGL_H00000345133    .....................................-----------------------------------..-.--
HGL_H00000377233    .....................................------------------EGWFALTGSELRAVFPE..G.H-
HGL_H00000270747    .....................................--------------------------------L--..-.--
HGL_H00000391106    .....................................--------------------------N--------..-.--
HGL_H00000355060    .....................................-----------------------------------..-.-D
HGL_H00000412733-6  .....................................-----------------------------------..-.--
HGL_H00000302895    .....................................----------------WRKGWFALDKSSLHFCLQM..Q.EA
HGL_H00000264818    .....................................---S-------------------------------..-.--
HGL_H00000300584    .....................................-----------------------------------..-.--
HGL_H00000295095-2  .....................................--------------------WIVLSNQKIEFYKE-..-.--
HGL_H00000335341-1  .....................................-----------------------------------..-.--
HGL_H00000318075    .....................................-----------------------------------..-.--
HGL_H00000262719    .....................................-----------------------------------..-.--
HGL_H00000335341-2  .....................................-----------------------------------..-.--
HGL_H00000263674    .....................................-----------------------------------..-.--
HGL_H00000356621    .....................................-----------------------------------..-.--
HGL_H00000345808-1  .....................................-----------------------------------..-.--
HGL_H00000397663-5  .....................................-------------------GILLISGARNYHL---..-.--
HGL_H00000379804    .....................................-----------------------------------..-.--
HGL_H00000336522    .....................................-----------------------------------..-.--
HGL_H00000358316    .....................................-----------------------------------..-.--
HGL_H00000391106    .....................................-----------------------------------..-.--
HGL_H00000216446    .....................................-----------------------------------..-.--
HGL_H00000234453-1  .....................................-----------------------------------..-.--
HGL_H00000258530    .....................................---------------RAIHNIFRMTESHLLV----..-.--
HGL_H00000378965    .....................................---------------------VVLTEKDLLVYDSM..-.--
HGL_H00000263088    .....................................-----------------------------------..-.--
HGL_H00000343204    .....................................-----------------------------E-----..-.--
HGL_H00000315334    .....................................-----------------------------------..-.--
HGL_H00000339769-4  .....................................-----------------------------Y-----..-.--
HGL_H00000348611    .....................................-------------------------S---------..-.--
HGL_H00000389913-1  .....................................-----------------------------------..-.--
HGL_H00000264554    .....................................-----------------------------------..-.--
HGL_H00000311837    .....................................-----------------------------------..-.--
HGL_H00000342858-4  .....................................-----------------------------------..-.--
HGL_H00000007414    .....................................--------------------------K--------..-.--
HGL_H00000381571    .....................................-----------------Y-----------------..-.--
HGL_H00000293349    .....................................-----------------------------------..-.--
HGL_H00000342804    .....................................-----------------------------------..-.--


                      40        50                          60           70        80           90  
                       |         |                           |            |         |            |  
d1mi1a2               AFKKIDTKVLAYTEGL..................HGKWMFSEIRAVF...SRRYLLQNTALEVFMANR...TSVMFNF
HGL_H00000278412-1  ----------------..................-------------...-R----------------...-------
HGL_H00000278412-2  ----------------..................-------------...------------------...-------
HGL_H00000286827    ----------------..................-------------...------------------...-------
HGL_H00000407746    ---S------------..................-------------...------------------...-------
HGL_H00000401303-1  ----------------..................-------------...------------------...-------
HGL_H00000265381    ----------------..................SYIADIGNIVVLM...ARRRM-------------...-------
HGL_H00000413502    ----------------..................-------------...------------------...-------
HGL_H00000401303-3  ----------------..................-------------...------------------...-------
HGL_H00000219865    -M--------------..................-------------...------------------...-------
HGL_H00000391942    ----------------..................-------------...-------G----------...-------
HGL_H00000341737    ----------------..................-------------...------------------...-------
HGL_H00000364995    ----------------..................-------------...------------------...-------
HGL_H00000308176    ------L---------..................-------------...------------------...-------
HGL_H00000381854    ----------------..................R------------...------------------...-------
HGL_H00000280665    -----------I----..................-------------...------------------...-------
HGL_H00000171887    ----------------..................-------------...F-----------------...-------
HGL_H00000320828    -L--------------..................-------------...------------------...-------
HGL_H00000319756    ----------------..................-R-----------...------------------...-------
HGL_H00000005587    ----------------..................-------------...-----KKDCCFEICAPDK...RVYQFTA
HGL_H00000334382    ---------S------..................-------------...------------------...-------
HGL_H00000329668    ----------------..................-------------...------------------...-------
HGL_H00000305632-2  ----------------..................-------------...------------------...-------
HGL_H00000398560-2  ----------------..................-------------...------------------...-------
HGL_H00000364004-2  ----------------..................-------------...------------------...--VFFLF
HGL_H00000331381    EIRNISCAAQDPEDLS..................TFAYITKDLKSNH...HYCH--------------...-------
HGL_H00000283195    ----------------..................-------------...------------------...-------
HGL_H00000370912-2  KYRKGF----------..................-------------...------------------...-------
HGL_H00000245932    ----------------..................-------------...------------------...-------
HGL_H00000344220    ----------------..................-----F-------...------------------...-------
HGL_H00000315136    ----------------..................S------------...------------------...-------
HGL_H00000264554    ----------------..................-------------...------------------...-----P-
HGL_H00000398655    ------------SRIK..................CVEIVKSDIC---...------------------...-------
HGL_H00000348150    ----------------..................-------------...------------------...-------
HGL_H00000338934-1  ----------------..................-------------...F-----------------...-------
HGL_H00000353518    ----------------..................-------------...------------------...-------
HGL_H00000345752-1  ----------------..................-------------...------------------...-------
HGL_H00000386867-1  ----------------..................-------------...------------------...-------
HGL_H00000283195    ----------------..................-------------...------------------...-------
HGL_H00000374195    ----------------..................----------A--...------------------...-------
HGL_H00000420773    ----------------..................-V-----------...------------------...-------
HGL_H00000398560-1  ----------------..................-------------...------------------...-------
HGL_H00000347169-1  ----------------..................-------------...------------------...-------
HGL_H00000384136-2  ----------------..................----PWSEIRNIS...------------------...-------
HGL_H00000353408    ----------------..................----PWSEIRNIS...------------------...-------
HGL_H00000254051    ----------------..................-R-----------...------------------...-------
HGL_H00000363458    -IEN------------..................-------------...------------------...-------
HGL_H00000283195    ----------------..................-------------...------------------...-------
HGL_H00000252891    ----------------..................-------------...------------------...-------
HGL_H00000308774    ------------RGSR..................KGSIEIKKIRCV-...------------------...-------
HGL_H00000318965-3  ----------------..................-------------...------------------...-------
HGL_H00000264042    ----------------..................-------------...--R---------------...-------
HGL_H00000391677    ----------------..................-------------...K-----------------...-------
HGL_H00000344666    ----------------..................--SFPWNEIRNI-...------------------...-------
HGL_H00000319831    ----------------..................--L----------...------------------...-------
HGL_H00000359423-2  ----------------..................-------------...------------------...-------
HGL_H00000322926    ----------------..................-------------...---F--------------...-------
HGL_H00000305632-1  ----------------..................-------------...------------------...-------
HGL_H00000355133    ----------------..................-------------...------------------...-------
HGL_H00000381083    -------------KRD..................SVKWH-----YLC...LRRY--------------...-------
HGL_H00000304701    ----------------..................--SIPLSAIME--...------------------...-------
HGL_H00000334105    ----------------..................-------------...------------------...-------
HGL_H00000315630    ----------------..................---------K---...------------------...-------
HGL_H00000360275    ----------------..................--H----------...------------------...-------
HGL_H00000357110    ----------------..................-------------...--R---------------...-------
HGL_H00000341138    ----------------..................-------------...--R---------------...-------
HGL_H00000339184    ----------------..................-------------...------------------...----I--
HGL_H00000283195    ----------------..................-W-----------...------------------...-------
HGL_H00000359417    --------------HFvld...............VPLGVISRVEKIG...AQSHGDNSCGIEIVCKDM...RNLRLAY
HGL_H00000387784    ----------------..................-------------...--------HAFEIILKDE...NSVIFSA
HGL_H00000263713    ----------------..................-------------...------------------...--F----
HGL_H00000362904    ----------------..................-------------...--R---------------...-------
HGL_H00000201647    ----------------..................-----L-------...------------------...-------
HGL_H00000364754    ----------------..................-------------...-----------E------...-------
HGL_H00000357177    ----------------..................-------------...------------------...-------
HGL_H00000367394    ----------------..................-------------...--------KAVEVHVLLL...DDLLLLL
HGL_H00000358820    ----------------..................---Y---------...------------------...-------
HGL_H00000241014    ----------------..................-------------...----------------N-...-------
HGL_H00000313391    ----------------..................-------------...-K----------------...-------
HGL_H00000217381    ----------------..................-------------...----------LEICAADG...QDTFFLR
HGL_H00000278412-3  ----------------..................-------------...-R----------------...-------
HGL_H00000368824    KAEG------------..................-------------...------------------...-------
HGL_H00000363694    --------L-------..................-------------...------------------...-------
HGL_H00000338191    ----------------..................-------------...-------NRLIELHSPDS...RNTLI--
HGL_H00000390595    ----------------..................-------------...------------------...-------
HGL_H00000349259    ----------------..................-------------...-------------RLNDG...NEYLFQA
HGL_H00000352995-2  ----------------..................-------------...------------------...-------
HGL_H00000299084    ----------------..................-------------...------------------...-------
HGL_H00000216373    ----------------..................-------------...-------KHAFELVSKDE...NSIIFAA
HGL_H00000378649    ---------------K..................-------------...------------------...-------
HGL_H00000362109    ----------------..................-------------...------------------...DSNLFSF
HGL_H00000303508-1  ----------------..................-------------...------------------...---M---
HGL_H00000365891    ----------------..................-------------...------------------...-------
HGL_H00000265963    ----------------..................-------------...------------------...-------
HGL_N10018877       ----------------..................-------------...--------I---------...-------
HGL_H00000338171    ----------------..................-------------...LRKDSRKQCCFELTCGDR...RSYEFTA
HGL_H00000341483    ----------G-----..................-------------...------------------...-------
HGL_H00000403067    EEKKIILTYF------..................-------------...------------------...-------
HGL_H00000330572    ----------------..................-------------...------------------...-------
HGL_H00000394751    KADGFVNLSDFTVERAseckkkh...........AFKINHPQIKTFY...------------------...-------
HGL_H00000402046    ----------------..................LFKQASSGVKQWN...KRWFVLVDRCL-------...-------
HGL_H00000374557    ----------------..................-------------...------------------...----L--
HGL_H00000261486    ----------------..................-------------...----------------NE...TSFFFEA
HGL_H00000363371-2  KAQGLINVSNYS----..................-------------...------------------...-------
HGL_H00000376247    EPRGIIPL--------..................-------------...------------------...-------
HGL_H00000318965-3  ----------------..................-------------...------------------...-------
HGL_H00000384136-1  ----------------..................-------EIRSI-...------------------...-------
HGL_H00000372160    ---------IHNAKVK..................LVMWPLSSLRR--...---------------YGR...DSTWFTF
HGL_H00000352995-1  ----------------..................-------------...------------------...-------
HGL_H00000359610    ---------------L..................-------------...------------------...-------
HGL_H00000374557    ----------------..................-------------...------------------...-------
HGL_H00000234179    -------FQNESGSKY..................YKEIPLSEILQVS...S-----------------...-------
HGL_H00000262539    -----H----------..................-------------...------------------...-------
HGL_H00000364893    ----------------..................-------------...------H-----------...-------
HGL_H00000391648-1  EPRGIIPLE-------..................-------------...------------------...-------
HGL_H00000379967-1  EPRGIIP---------..................-------------...------------------...-------
HGL_H00000353646    ----------------..................-------------...-----------E------...-------
HGL_H00000279230    ----------------..................-------------...------------------...-------
HGL_H00000304895    ----------------..................-------------...------------------...-------
HGL_H00000330276    ----------------..................-------------...------------------...----F--
HGL_H00000233668    ----------------..................-------------...-R----------------...-------
HGL_H00000416895    ----------------..................-------------...---------C--------...-------
HGL_H00000394487    -------N--------..................-------------...------------------...-------
HGL_H00000345405    ----------------..................---W---------...------------------...-------
HGL_H00000386800-1  GYFK-----SELEKEP..................LRVIPLKEVHKVQeckQSDIMMRDNLFEIVTT-S...RTFYVQA
HGL_H00000408285-1  -CKCLTLFQNNTTNRY..................YKEIPLSEILLVE...------------------...-------
HGL_H00000393860    ----------------..................---------L---...------------------...-------
HGL_H00000260402    ----------------..................---------T---...------------------...-------
HGL_H00000311489    ----------------..................-------------...-------------SLQDG...KEYLFQA
HGL_H00000263265    ----------------..................------------W...------------------...-------
HGL_H00000353109    KGRERHLFLFEISLVF..................SKEIK--------...------------------...-------
HGL_H00000288368    ----------------..................-------------...-R----------------...-------
HGL_H00000344277    ---------IHNPRVK..................LVSWPLCSLRR--...------------------...-------
HGL_H00000262593    ------LWDLQNPRVK..................LISWPLSALRR--...------------------...-------
HGL_H00000401303-2  -------L--------..................-------------...------------------...-------
HGL_H00000322926    ----------------..................-------------...------------------...-------
HGL_H00000339299    ----------------..................-------------...------------------...-------
HGL_H00000378183    KHTKQQYNIQAKTVEE..................KRSW---------...------------------...-------
HGL_H00000381549    ----------------..................-------------...--------FAVEV-----...-------
HGL_H00000376652-2  ----------------..................-------------...------------------...-------
HGL_H00000276420    ----------------..................-------------...----------F-------...-------
HGL_H00000302269    ---A------------..................-------------...------------------...-------
HGL_H00000296604    -Q--------------..................-------------...------------------...-------
HGL_H00000248901    EPRGI-----------..................-------------...------------------...-------
HGL_H00000370719    ----------K-----..................-------------...------------------...-------
HGL_H00000359073    ----------------..................----S--------...------------------...-------
HGL_H00000298694    ----------------..................-------------...---Y--------------...-------
HGL_H00000360916    ----------------..................----T--------...------------------...-------
HGL_H00000263373    ----------------..................-------------...--------------TQDG...SEFLLQA
HGL_H00000374373    ------C---------..................-------------...------------------...-------
HGL_H00000264042    ----------------..................-------------...------------------...-------
HGL_H00000335560    ---------V------..................-------------...------------------...-------
HGL_H00000352232    ----------------..................-------------...------------------...-------
HGL_H00000261439-2  ----------------..................-------------...------------------...-------
HGL_H00000282406    ----------------..................-------------...--------------TTEK...HTYYLTA
HGL_H00000379709    ---S------------..................-------------...------------------...-------
HGL_H00000364631    -------E--------..................-------------...------------------...-------
HGL_H00000353109    ----------------..................-------------...------------------...-------
HGL_H00000356297    ----L-----------..................-------------...------------------...-------
HGL_H00000410689    ----------------..................-------------...------------------...-------
HGL_H00000391995    ----------------..................-------------...------------------...-------
HGL_H00000412461    --G-------------..................-------------...------------------...-------
HGL_H00000357298    ----------------..................-------------...------------------...-------
HGL_H00000256190    ----------------..................-------------...------------------...-------
HGL_H00000354718    ----------------..................-------------...------------------...-------
HGL_H00000349727    ----------------..................-----Y-------...------------------...-------
HGL_H00000379527    ----------------..................-------------...------------------...-TLFF--
HGL_H00000264042    ----------------..................-------------...------------------...-------
HGL_H00000346378    ----------------..................-------------...------------------...-------
HGL_H00000367299-1  -----------KNHEC..................CMAIPLSQIVFI-...------------------...-------
HGL_H00000330278    ----------------..................-------------...---------------SEK...KTYYLMA
HGL_H00000361202    ----------------..................-------------...------------------...-------
HGL_H00000262940    ----------------..................-------------...------------------...-------
HGL_H00000409493    ----------------..................-------------...-------D----------...-------
HGL_H00000389787    ----------------..................-------------...-R----------------...-------
HGL_H00000285094    ----------------..................-AKIDIKSIKE--...------------------...-------
HGL_H00000296414    -----------L----..................-------------...------------------...-------
HGL_H00000409572    ----------------..................----S--------...------------------...-------
HGL_H00000377233    ----------------..................--V----------...------------------...-------
HGL_H00000364277    ----------------..................-------------...------------------...-------
HGL_H00000234313    ----------------..................-------------...----------FEIITADE...VHYFLQA
HGL_H00000395986    -D--------------..................-------------...------------------...-------
HGL_H00000324287    ----------------..................--------I----...------------------...-------
HGL_H00000264057    ----------------..................-------------...------------------...-------
HGL_H00000396185-1  ----------------..................-------------...------Q-----------...-------
HGL_H00000346378    ----------------..................-------------...------------------...-------
HGL_H00000391106    --G-------------..................-------------...------------------...-------
HGL_H00000366977    ---------L------..................-------------...------------------...-------
HGL_H00000304895    ----------------..................------------H...KRFFVLR-----------...-------
HGL_H00000399903    EDG----------VGF..................DFKWPHSQIREIH...LRRYNLRRSALEIFHADQ...SNYFLNF
HGL_H00000346733    ----------------..................-------------...------R-----------...-------
HGL_H00000386911    ----------------..................-------------...T-----------------...-------
HGL_H00000322926    ----------------..................-------------...------------------...-------
HGL_H00000377233    ----------------..................-------------...----------FEVYTEGE...RLYLFGL
HGL_H00000336522    ----------------..................-------------...------------------...------L
HGL_H00000402861    ----------------..................-----I-------...------------------...-------
HGL_H00000312262    ----------------..................-------------...------------------...-------
HGL_H00000367747    -EHRSCLRWRPSRKNE..................KAKISIDSIQEV-...------------------...-------
HGL_H00000250617    ---------------L..................-------------...------------------...-------
HGL_H00000288266    ----------------..................-------------...------------------...-------
HGL_H00000352721    ----------------..................-------------...------------------...-------
HGL_H00000351969    ----------------..................-------------...------------------...-------
HGL_H00000020673    ----------------..................SKRPHVFYLRTAD...WRVFLFQAPSLE------...-------
HGL_H00000366843    ----------------..................------------H...RRWFVLRG----------...-NMLFYF
HGL_H00000158762    --------K-------..................-------------...------------------...-------
HGL_H00000274710    ----------------..................SKKSNVLKLKTAD...WRVFLFQ-----------...-------
HGL_H00000362751    ----------------..................----------F--...------------------...-------
HGL_H00000276185    ----------------..................-------------...------------------...-------
HGL_H00000407267    ----V-----------..................-------------...------------------...-------
HGL_H00000251507    -----------T----..................-------------...------------------...-------
HGL_H00000245796    --------LATPATHY..................TKKPHVFQLRTAD...WRLYLFQ-----------...-------
HGL_H00000316029    ----------EKTKEV..................IQEWSLTNIKR--...------------------...-------
HGL_H00000216446    ----------------..................-------------...-------------ITKDD...THYYIQA
HGL_H00000276204    ----------------..................-------------...-----MRRHAFELKMLDK...YSHYLAT
HGL_H00000371397    ----------------..................-------------...------------------...-------
HGL_H00000366284    ---H------------..................-------------...------------------...-------
HGL_H00000285046    ----------------..................-----W-------...------------------...-------
HGL_H00000343899    -----------Y----..................-------------...------------------...-------
HGL_H00000362014    ----------------..................-------------...------------------...-------
HGL_H00000328118    ----------------..................-------------...----------LEIANRNGl..EKYILQA
HGL_H00000405405    K---------------..................-------------...------------------...-------
HGL_H00000303476    -----------KTKEV..................LQEWPLTTVK---...------------------...-------
HGL_H00000384312    EADEL-----------..................-------------...------------------...-------
HGL_H00000274376    RPNCFQIVV-------..................-------------...------------------...-------
HGL_H00000328800    DP--------------..................-------------...------------------...-------
HGL_H00000339299    KGRERHLFLFEMSLVF..................S------------...------------------...-------
HGL_H00000354611    ---------------A..................IEEVYYDHLRSAA...KKRFF-------------...-------
HGL_H00000349298    ----------------..................-------------...------------------...-------
HGL_H00000317786    ------------T---..................-------------...------------------...-------
HGL_H00000394225    ----------------..................-------------...----------I-------...-------
HGL_H00000292140    ----------------..................-------------...------------------...-------
HGL_H00000345988    ----------------..................--K----------...------------------...-------
HGL_H00000386733    ----------------..................P------------...------------------...-------
HGL_H00000234313    ----------------..................M------------...------------------...-------
HGL_H00000362405    ----------------..................-------------...------------------...-------
HGL_H00000417003    ----------------..................---------M---...------------------...-------
HGL_H00000379967-2  EPRGIIWLE-------..................-------------...------------------...-------
HGL_H00000317912    ----------------..................-------------...------------------...-------
HGL_M00000071081-2  ----------------..................V------------...------------------...-------
HGL_M00000071081-1  E---------------..................-------------...------------------...-------
HGL_H00000388152    ----------------..................-------------...----------------KH...RTWFFSA
HGL_H00000285046    ----------------..................-------------...------------------...-------
HGL_H00000318965-1  ----------------..................-----V-------...------------------...-------
HGL_H00000258390    ----------------..................-------------...----RLRKYAFELKMNDL...TYFVLAA
HGL_H00000258530    ----------------..................-------------...------------------...-------
HGL_H00000394487    -----V----------..................-------------...------------------...-------
HGL_H00000354919-1  DPDESPIEL-------..................---SKVQSVKAVAk..KRRDRSLPRAFEIFT-DN...KTYVFKA
HGL_H00000366995    ANISRVELTEESEKVS..................MVKVYLQDIKV--...------------------...-------
HGL_H00000344961    ----------------..................-------------...------------------...-------
HGL_H00000388152    ----------------..................-------------...----------------KH...RTWFFSA
HGL_N10025555       --------A-------..................-------------...------------------...-------
HGL_H00000288266    ----------------..................-------------...-R----------------...-------
HGL_H00000373214    ------------C---..................-------------...------------------...-------
HGL_H00000295888    ATREIRDIETLPLNMHepiiprgarqgpsqlkrtCSLFAYEDIKEVH...KRRYLLQPIAVEVFSGDG...RNYLLAF
HGL_H00000385609    SIEDKVH---------..................-------------...------------------...-------
HGL_H00000386800-1  ----------------..................-------------...-------------F----...-------
HGL_H00000345895    ----------------..................-------------...------------------...-TMLIRV
HGL_H00000399588    ----------------..................-------------...---------------TTS...RTFYLVA
HGL_H00000364277    ----------------..................-------------...------------------...-------
HGL_H00000391106    ----------------..................-------------...------------------...-N-----
HGL_H00000262995    ----------------..................-----I-------...------------------...-------
HGL_H00000398481    ----------------..................-K-----------...------------------...-------
HGL_H00000317786    ----------------..................------D------...------------------...-------
HGL_H00000376700    ----------------..................-------------...------------L-----...-------
HGL_H00000216446    ----------------..................-------------...------------L-----...-------
HGL_H00000281419    ----------------..................-------------...------------------...-------
HGL_H00000339381    ----------------..................---LFHHKIHQGI...ARRF--------------...-------
HGL_H00000263650    ----------------..................-------------...------------------...-------
HGL_H00000393860    ----------------..................-------------...------------------...QRYFLQA
HGL_H00000302895    ----------------..................--M----------...------------------...-------
HGL_H00000296721    ----------------..................-------------...------------------...-------
HGL_H00000318965-1  ----------------..................-------------...------------------...-------
HGL_H00000347244    ----------------..................-------------...------------------...-------
HGL_H00000296721    ----------------..................-------------...------------------...-------
HGL_H00000313731    ----------------..................LYRLQEDGLSVWF...QRRFPH------------...-------
HGL_H00000302895    ----------------..................-------------...-----------EIYLPSE...RVFLFGA
HGL_H00000261729    ----------------..................-------------...------------------...----L--
HGL_H00000410689    ----------------..................I------------...------------------...-------
HGL_H00000348828    ----------------..................-----FN------...------------------...-------
HGL_H00000347134    ----------------..................-------------...------------------...-------
HGL_H00000415034    VETE-------EGIGH..................DFRRPLAQLREVH...LRRFNLRRSALELFFIDQ...SNYFLNF
HGL_H00000386331    ----------------..................-------------...------------------...-------
HGL_H00000330278    ----------------..................-------------...------------------...-------
HGL_H00000350297    ----------------..................------------W...QRR---------------...-------
HGL_H00000265748    ----------------..................-------------...-REFCARRNTFELI----...-------
HGL_H00000376700    KA--------------..................-------------...------------------...-------
HGL_H00000011684    ----------------..................-----------V-...------------------...-------
HGL_H00000338769    ----------------..................-------------...------------------...-------
HGL_H00000279227    ---------------Idlavgdv...........VKTWRFSNMRQWN...V-NWDIRQVAIE------...-------
HGL_H00000407746    ---------C------..................-------------...------------------...-------
HGL_H00000303909    ----------------..................-------------...------------IHNRNG...KSYLFLL
HGL_H00000326706    ------------T---..................-------------...------------------...-------
HGL_H00000405963    ----------------..................-------------...------------------...-------
HGL_H00000395182    ----------------..................-------------...------------------...-------
HGL_H00000217289    ----------------..................-------------...--NWEIRQVAIE------...-------
HGL_H00000341071    --------------V-..................-------------...------------------...-------
HGL_H00000368719    ----------------..................-------------...------------------...-------
HGL_H00000298542    ----------------..................-------------...------------------...-------
HGL_H00000264051    ----------------..................-MEFKIKSVPIIS...HSRWLLK-----------...-------
HGL_H00000364207    ----------------..................-------------...------------------...-------
HGL_H00000279227    ---------N------..................-------------...------------------...-------
HGL_H00000286827    ----------------..................-------------...P-----------------...-------
HGL_H00000396519    --------------SL..................QEKIPVADIKAI-...------------------...-------
HGL_H00000345808-3  ----------------..................-------------...----------FELKTHQG...KELLIQS
HGL_H00000367764    ----------------..................-------------...---------A--------...-------
HGL_M00000082342    ----------------..................-------------...------------------...-------
HGL_H00000378262    ----------------..................-------------...------------------...-------
HGL_H00000261439-1  ----------------..................-------------...------------------...-------
HGL_H00000056217    ----------------..................-------------...------------------...-------
HGL_H00000221086    ----------------..................-------------...------------------...-------
HGL_H00000274498    ------------Y---..................-------------...------------------...-------
HGL_H00000342858-1  ----------------..................------------N...------------------...-------
HGL_H00000320563    PTGDIYCTRHCLSNISdpfifnmcskdrssdhysCQRHGYGDLRELR...QACFLLQDIAMEIFFQNG...YSKFLVF
HGL_H00000311837    ----------------..................-------------...-----LRSSGFEVLALDGa..RSGVLQF
HGL_H00000346127    ----------------..................------SSILRRW...KRNWF-------------...-------
HGL_H00000272666    K---------------..................-------------...------------------...-------
HGL_H00000363371-1  ---------S------..................-------------...------------------...-------
HGL_H00000315410    ----------------..................-------------...KRFFYL------------...-------
HGL_H00000282406    PLGQI-----------..................-------------...------------------...-------
HGL_H00000281172    -----------LLDAK..................GKVWTQDMILQV-...------------------...-------
HGL_H00000265080    ----------------..................-------------...------------------...-------
HGL_H00000412733-1  --T-------------..................-------------...------------------...-------
HGL_H00000262593    -------ERAAYFRCY..................HKVTELNHVKNVA...RLPKSTKKHAIGIYFNDD...TSKTFAC
HGL_H00000386800-2  ----------------..................-------------...-------P----------...-------
HGL_H00000356655    -----------F----..................-------------...------------------...-------
HGL_H00000407267    ----------------..................-------------...-------------Y----...-------
HGL_H00000403323    ----------------..................-------------...-------KNVLELRSRDG...SEYLIQH
HGL_H00000362369    ----------------..................-------------...-------------F----...-------
HGL_H00000217289    ----------------..................-------------...------------------...-------
HGL_H00000336923    ----------------..................-------------...------------------...-------
HGL_H00000411012-3  TVESSS--LQGELEPA..................SFSWTYEEIKEVH...KRWWQLRDNAVEIFLTNG...RTLLLAF
HGL_H00000180173-2  RKETWILHSQISTIEK..................-------------...------------------...-------
HGL_H00000342858-1  ----------------..................-------------...------------------...-------
HGL_H00000386897    ------C---------..................-------------...------------------...-------
HGL_H00000407163    ----------------..................-------------...------------------...-------
HGL_H00000256190    LVGEQTVV--------..................-RSF---------...------------------...-------
HGL_H00000303507    ----------------..................ALKIKISQIKSDI...------------------...-------
HGL_H00000354952    ----------------..................-------------...----------------SE...RTFYLVA
HGL_H00000411012-2  ---------LNGYPKP..................VVQITLQDVCRIY...KRRHGLMPLGLEIFCTENdlcSDIYLKF
HGL_H00000312753    ----------------..................-------------...------------------...-------
HGL_H00000339769-3  S---------------..................-------------...------------------...-------
HGL_H00000344277    ----------------..................-KVTEISNVKCVT...RLPKETKRQAVAIIFTDD...SARTFTC
HGL_H00000371221    T---------------..................-------------...------------------...-------
HGL_H00000362894    ----------------..................K------------...------------------...-------
HGL_H00000376293    ----------------..................------------H...KRFFVLD-----------...-------
HGL_H00000406026    ----------------..................---W---------...------------------...-------
HGL_H00000259351    ---------------S..................-------------...------------------...-------
HGL_H00000302895    ----------------..................---------D---...------------------...-------
HGL_H00000380413    ----------------..................-------------...------------------...-------
HGL_H00000364631    ----------------..................-----L-------...------------------...-------
HGL_H00000378262    ----------------..................--------T----...------------------...-------
HGL_H00000363617    ----------------..................-------------...-RYFLLRASG--------...-------
HGL_H00000378965    ----------------..................-------------...------------------...-------
HGL_H00000263826-1  ----------------..................-------N-----...------------------...-------
HGL_H00000298815    ----------------..................-----M-------...------------------...-------
HGL_H00000365411    ----------------..................------------W...KRRYFLL-----------...-------
HGL_H00000407834    -E--------------..................-------------...------------------...-------
HGL_H00000368719    ----------------..................-------------...------------------...-------
HGL_H00000361009    -------------D--..................-------------...------------------...-------
HGL_H00000402299    ----------------..................-------------...------------------...----FNA
HGL_H00000367638    -----S----------..................-------------...------------------...-------
HGL_H00000411012-1  ---------HSGYPKP..................VVQITLQDVCCIY...KRRHGLMPLDLEVFCTENdlcSDIYLKF
HGL_H00000371067    --NESRIVTIHKQDGK..................NLEIELSSLREA-...------------------...-------
HGL_H00000356607    ----------------..................-K-----------...------------------...-------
HGL_H00000339769-2  ----------------..................-------------...----------------E-...-------
HGL_H00000342858-2  ----------------..................---------K---...------------------...-------
HGL_H00000254806    -FSD------------..................-------------...------------------...-------
HGL_H00000389913-1  ----------------..................-------------...------------------...-------
HGL_H00000367629    ----------------..................---------L---...------------------...-------
HGL_H00000364550    ----------------..................-------------...------------------...-------
HGL_H00000333568    ----------------..................-------------...------------------...-------
HGL_H00000328160    ----------------..................-------------...------------------...-------
HGL_H00000391668    SQDT------------..................-------------...------------------...-------
HGL_N10005278       QASG------------..................-------------...------------------...-------
HGL_H00000403459    ------Y---------..................-------------...------------------...-------
HGL_H00000260283    ----------------..................----K--------...------------------...-------
HGL_H00000258530    ----------------..................-------------...------------------...-------
HGL_H00000381793    --R-------------..................-------------...------------------...-------
HGL_H00000372160    -------EKAAYFRNF..................HKVTELHNIKNIT...RLPRETKKHAVAIIFHDE...TSKTFAC
HGL_H00000377233    NSSCLRLYKEVRSHRP..................EKEWPVKSLKV--...------------------...-------
HGL_H00000377566    ----------------..................-------------...----------------D-...-------
HGL_H00000302895    ----------------..................-------------...----------------TQ...RTFVFRV
HGL_H00000405963    EDPE------------..................-------------...------------------...-------
HGL_H00000325285    ----------------..................-------------...-----Q------------...-------
HGL_H00000315662    ----------------..................-------------...-----------EVFLFND...LLVILKL
HGL_H00000338185    ----------------..................-------------...------------------...-------
HGL_H00000283937    PVTELWKKHTLTREDV..................F------------...------------------...-------
HGL_H00000201647    ----V-----------..................-------------...------------------...-------
HGL_H00000265080    ----------------..................-------------...------------------...-------
HGL_H00000371577    DNGETQFKNKVI----..................-------------...------------------...-------
HGL_H00000342804    ----------------..................-------------...------------------...-------
HGL_H00000417003    ----------------..................-------------...------------------...-------
HGL_H00000385326    ----------------..................-------------...------------I-----...-------
HGL_H00000264276    ------V---------..................-------------...------------------...-------
HGL_H00000384651    ----------------..................------------H...------------------...-------
HGL_H00000276420    ----------------..................-------------...------------------...-------
HGL_H00000352336    ----------------..................-------------...------------------...-------
HGL_H00000231487-8  ----------------..................-------------...------------------...-------
HGL_H00000272430    ----------------..................-------------...------------------...----L--
HGL_H00000356278    ----------------..................-------------...---------AVECVESTG...RHIYFTL
HGL_H00000399532-2  ----------------..................----------T--...------------------...-------
HGL_H00000263847    NGGTQTYHL-------..................-------------...------------------...-------
HGL_H00000362409    ----------------..................-------------...------------------...-------
HGL_H00000337572-2  ----------------..................-------------...------------------...----LAA
HGL_H00000355026    ----------------..................-------------...------------------...-------
HGL_H00000363317    EHGQCTNICVCFLQR-..................-------------...------------------...-------
HGL_H00000378965    ----------------..................-------------...------------------...-----R-
HGL_H00000382697    EQSNPSMVLDI-----..................-------------...------------------...-------
HGL_N10007969       ----------------..................-------------...------------------...----FNA
HGL_H00000320291    ----------------..................-------------...------------------...-------
HGL_H00000342793    -------F--------..................-------------...------------------...-------
HGL_H00000317985    EQSNPYMVLDIDKL--..................-------------...------------------...-------
HGL_H00000317578    ----------------..................-------------...------------------...RRYFY--
HGL_H00000391648-2  ----------------..................-------------...------------------...-------
HGL_H00000407802    ----------------..................-------------...------------------...-------
HGL_H00000369121    ----------------..................-------------...------------------...-------
HGL_H00000233668    ----------------..................-------------...------------------...-------
HGL_H00000386183    ----------------..................-------------...----LGQDYCFEVTTSSG...SKCF-SC
HGL_H00000401910    ----------------..................I------------...------------------...-------
HGL_H00000259406    ----------------..................-----------F-...------------------...-------
HGL_H00000377386    ----------------..................--------I----...------------------...-------
HGL_H00000377233    ----------------..................---------K---...------------------...-------
HGL_H00000361202    ----------------..................-------------...------------------...-------
HGL_H00000345492    ----------------..................-------------...---------------KDR...TDIIFEV
HGL_H00000376306    ----------------..................-------------...------------------...-------
HGL_H00000349727    ----------------..................-------------...------------------...-------
HGL_H00000345133    ----------------..................-------------...------------------...-------
HGL_H00000377233    ----------------..................-------------...------------------...-------
HGL_H00000270747    ----------------..................-------------...------------------...-------
HGL_H00000391106    ----------------..................-------------...------------------...-------
HGL_H00000355060    ----------------..................-------------...------------------...-------
HGL_H00000412733-6  ---------HDADEQE..................KWIHAL-------...------------------...-------
HGL_H00000302895    QEDRMHL---------..................-------------...------------------...-------
HGL_H00000264818    ----------------..................-------------...------------------...-------
HGL_H00000300584    ---N------------..................-------------...------------------...-------
HGL_H00000295095-2  ----------------..................-------------...------------------...-------
HGL_H00000335341-1  ----------------..................-------------...-R----------------...-------
HGL_H00000318075    ----------------..................-------------...------------------...RKYYFEC
HGL_H00000262719    ----------------..................----I--------...------------------...-------
HGL_H00000335341-2  --------ISQVIDMR..................DEEFSVSS-----...------------------...-------
HGL_H00000263674    ----------------..................------------P...LRRFLRQEMVTEVKAIGGkkdRSLFL--
HGL_H00000356621    ----------------..................-------------...-----GQDFCFEVTYISG...SKCF-SC
HGL_H00000345808-1  ----------------..................-------------...----L-------------...-------
HGL_H00000397663-5  ----------------..................-------------...------------------...-------
HGL_H00000379804    ------N---------..................-------------...------------------...-------
HGL_H00000336522    -------------A--..................-------------...------------------...-------
HGL_H00000358316    ---------S------..................-------------...------------------...-------
HGL_H00000391106    -----VYSCVTLPYFH..................SFLYMKGGLMNSW...KRRWC-------------...-------
HGL_H00000216446    ----------------..................-------------...---------------QTS...TEYFLEA
HGL_H00000234453-1  ----------------..................-------------...------------LIIPGE...QHFYMKA
HGL_H00000258530    ----------------..................-------------...------------------...-------
HGL_H00000378965    ----------------..................-------------...------------------...-------
HGL_H00000263088    ----------------..................-------------...----------F-------...-------
HGL_H00000343204    ----------------..................-------------...------------------...-------
HGL_H00000315334    ----------------..................-------------...----------------NH...ESYLLMA
HGL_H00000339769-4  ----------------..................-------------...------------------...-------
HGL_H00000348611    ----------------..................-------------...------------------...-------
HGL_H00000389913-1  ----------------..................----------C--...------------------...-------
HGL_H00000264554    ----------------..................-------------...------------------...-------
HGL_H00000311837    ----------------..................-----------V-...------------------...-------
HGL_H00000342858-4  ----------Q-----..................-------------...------------------...-------
HGL_H00000007414    ----------------..................-------------...------------------...-------
HGL_H00000381571    ----------------..................-------------...------------------...-------
HGL_H00000293349    -T--------------..................-------------...------------------...-------
HGL_H00000342804    ----------------..................-------------...---F--------------...-------


                           100                                                                      
                             |                                                                      
d1mi1a2               PDQATVKKVVYSLPR--vg...........................................................
HGL_H00000278412-1  -----------------vmkalvnrkitvpgnfqghsgaqcitcsykassgllyplergfiyvhkppvhirfdeiafv
HGL_H00000278412-2  -----------------nckitvpgnfqghlgaqcitcsykagsgllypleqgfvyihrpplhisfqeitfvsfahgi
HGL_H00000286827    -----------------vgahrlsiyeewdpfrfrhmiptealqvralasadaeantvceivhvksesegrpervfhl
HGL_H00000407746    -----------------hssadldpfkfrwlipisalqvrlgntagtennsiwelihikseiegrpetifqlccsdse
HGL_H00000401303-1  -----------------itltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachilec
HGL_H00000265381    -----------------prsnsqenveashpsqdgkrqykmichvfesedaqliaqsigqafsvayqeflr.......
HGL_H00000413502    -----------------kicanhyitpmmelkpnagsdrawvwnthadfadeypkpellairflnaenaqkfktkfee
HGL_H00000401303-3  -----------------kfagrpitltmstsslnlmaadckqmianhhmqlisftasgdpdtaeyvayvakdpgnqra
HGL_H00000219865    -----------------mdhalrtisyiadignivvlmarrrmprsasqdciettpgaqegkkqykmichvfesedaq
HGL_H00000391942    -----------------taveavtdssryfviriedgngrrafigigfgdrgdafdfnvalqdhfkwvkq........
HGL_H00000341737    -----------------ypgiavetvtdssryfviriqdgtgrsafigigftdrgdafdfnvslqdhfkwvkq.....
HGL_H00000364995    -----------------agsisltistaslnlrtpdskqiianhhmqsisfasggdpdttdyvayvakdpvnrrachi
HGL_H00000308176    -----------------yvfspteelrkrwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknalgcqil....
HGL_H00000381854    -----------------rhypvssvifcaldpqdrkwikegpscrvfgfvarkqgsatdnvchlfaehdpeqpasaiv
HGL_H00000280665    -----------------tkdldfqlqdpfllyrnarlsiygiwfydkeecqriaelmknltqye..............
HGL_H00000171887    -----------------rrhyplntvtfcdldpqerkwmkteggapaklfgfvarkqgsttdnachlfaeldpnqpas
HGL_H00000320828    -----------------enfplatvqhsqtvlnqlrypsvlllvcqdseqnkpdihffhcdeveaelvqediesalad
HGL_H00000319756    -----------------hypvssitfsstdpqdhrwtnpdgttskifgfvakkpgspwenvchlfaeldpdqpagaiv
HGL_H00000005587    ASPKDAEEWVQQL----kfvlq........................................................
HGL_H00000334382    -----------------ldgskaiinstitpnmtftktsqkfgqwadsrantvyglgfssehhlskfaekfqefkeaa
HGL_H00000329668    --Q--------------qiianhhmqsisfasggdpdttdyvayvakdpvnqrachilecrsgtaqdvistigqafel
HGL_H00000305632-2  -----------------kviinstitpnmtftktsqkfgqwadsrantvfglgfsseqqltkfaekfqevkeaaklar
HGL_H00000398560-2  --Q--------------liyckkdllrrdvlyykgrldmdglevvdledgkdrdlhvniknafrlhcsisgdshllca
HGL_H00000364004-2  DHQ--------------mvlckkdlirrdilyykgridmdkyevidiedgrdddfnvsmknafklhnketeevhlffa
HGL_H00000331381    -----------------vftafdvnlayeiiltlgqafevayqlal................................
HGL_H00000283195    -----------------rllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktpdea
HGL_H00000370912-2  -----------------idvsrikcvevvknddavipcqnkypfqvvhdantlyifapsaqsrdrwvkklkeeiksnn
HGL_H00000245932    -----------------rgvkynqatpnfhqwrdarqvwglnfgskedaaqfaagmasaleale..............
HGL_H00000344220    -----------------vhtpnrtyylmdpsgnahkwcrkiqevwrqryqshp.........................
HGL_H00000315136    -----------------yiadigpvlvlmarrrlarkpgaqdhncrlykmlchvfhsedaqviaqaigqafavayslf
HGL_H00000264554    -----------------atrqviashhmqsisfasggdtdmtdyvayvakdpinqrachilecceglaqsvistvgqa
HGL_H00000398655    -----------------ipchykypfqvvhdnyllyvfapdresrqrwvlalkeetrdnnslvskyhpnfwmdgkwrc
HGL_H00000348150    -----------------stvtpnmtftktsqkfgqwadsrantvyglgfaseqhltqfaekfqevkeaarlareksqd
HGL_H00000338934-1  -----------------ndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkpdtievqqmkaqare
HGL_H00000353518    -----------------snknviaeheirniscaaqdpedlctfayitkdlqtshhychvfstvdvnltyeiiltlgq
HGL_H00000345752-1  -----------------merdppfvldaslgvisrvekiggassrgensygletvckdirnlrfahkpegrtrrsife
HGL_H00000386867-1  -----------------sekcaeeitltigqafdlayrkflesgek................................
HGL_H00000283195    -----------------asdyadgeakveqlavrfktkemaecfkkkfeecqqnllk.....................
HGL_H00000374195    -----------------verleeesfrmknmfqviqperalyiqanncveardwidvltkvsqrnqqrlsvyhpsayl
HGL_H00000420773    -----------------epvnkdlefqlhepfllyrnaslsiysiwfydkndchriaklmadvveee...........
HGL_H00000398560-1  -----------------yykgrmdmdqvetvdvedgrdkdwnlhvrnafklvsrttdevhlfcarkqedkarwlqaca
HGL_H00000347169-1  -----------------ektkdlivdqtiekvsfcapdrnfdrafsyicrdgttrrwichcfmavkdtgerlshavgc
HGL_H00000384136-2  -----------------fndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqar
HGL_H00000353408    -----------------fndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqar
HGL_H00000254051    -----------------hyplstlrfcgtdpeqrkwqkyckpsrifgfvaknqteaqenvchlfaeydavqpaaqvir
HGL_H00000363458    -----------------vsiyrisyctadkmhdkvfayiaqsqhsenlechaffctkrkmaqavtltvaqafkvafef
HGL_H00000283195    -----------------rmlmrreqvlkvcanhwitttmnlkplsgsdrawmwlasdfsdgdakleqlaakfktpela
HGL_H00000252891    -----------------ktkdllvdqtiekvsfcapdrnldkafsyicrdgttrrwichcflalkdsgerlshavgca
HGL_H00000308774    -----------------ekvnleeqtpverqypfqivykdgllyvyasnedsrsqwlkalqkeirgnphllikyhsgf
HGL_H00000318965-3  -----------------evlvecrvrflsfmgvgkdihtfafimdtgsqrfechvfwcepnaanvseavqaacmlryq
HGL_H00000264042    -----------------krfliklhpevhgpyqdtlefllgsrdecknfwkicveyhtffrlldqpkpkakavffsrg
HGL_H00000391677    -----------------leessfnkknmfqvihtekplyvqanncveanewidvlcrvsrcnqnrlssfhpsaylngi
HGL_H00000344666    -----------------sysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrkadslevqqmkaqa
HGL_H00000319831    -----------------wkrghlrrnwterwfqlqpsclcyfgsedckekrgtipldahccvellpdrdgkrcmfcvk
HGL_H00000359423-2  -----------------letdsalildvplgvisriekmggatsrgensyglditckdmrnlrfalkqeghsrrdmfe
HGL_H00000322926    -----------------liklrpdvnssyqdtleflmasrdfcksfwkicvehhaffrlfeepkpkpkpvlfsrgssf
HGL_H00000305632-1  -----------------rviihstitpnmtftktsrrfgqwadgrantmfglgfssdqqltkfaekfqeaketaklar
HGL_H00000355133    -----------------mlvmqdpiyrifyvshdsqdlkifsyiardgasnifrcnvfkskkksqamrivrtvgqafe
HGL_H00000381083    -----------------gydsnlfsfesgrrcqtgqgifafkcaraeelfnmlqeimqnnsinvveepvvernnhqte
HGL_H00000304701    -----------------vrttmplempekdntfvlkvengaeyiletidslqkhswvadiqgcvdpgdse........
HGL_H00000334105    -----------------irlgaipkdpkilaaleavgrsendlegrivcvcsgtdlvnisftymvaenpevtkqwveg
HGL_H00000315630    -----------------nwterwfvlkpnvisyyvsedlkdrkgdivldgnccveslpdkdgkkclflikcfdktfei
HGL_H00000360275    -----------------havheisyiakditdhrafgyvcgkegnhrfvaiktaqaaepvildlrdlfqliyelkqre
HGL_H00000357110    -----------------snfyikvrpaeleqfestigfklpnhraakrlwkvcvehhtfyrlvspeqppkakfltlgs
HGL_H00000341138    -----------------nnfyikirpgefeqfestigfklpnhraakrlwkvcvehhtffrlllpeappkkfltlgsk
HGL_H00000339184    -----------------kirpgeyeqfestigfklpnhrsakrlwkvciehhtffrlvspepppkgflvmgskfrysg
HGL_H00000283195    -----------------vwtacdfadgerkiehlavrfklqdvadlfkkifdeak.......................
HGL_H00000359417    KQEEQRK----------lgifenlnkhafplsngqalfafnyk...................................
HGL_H00000387784    KSAEEKNNWMAAL----islqyrstlermldvtmlqeekeeqmrlpsaev............................
HGL_H00000263713    -----------------vfrldhpkackhlwkcavehhaffrlrgpvqksshrsgfirlgsrfrysgkteyqttktnk
HGL_H00000362904    -----------------ssffikirpgeqeqyestigfklpsyraakklwkvcvehhtffrltstdtipkskflalgs
HGL_H00000201647    -----------------gsivrcdavtlpgrsrslllllvcqeperpqpdvhffqglrlgaelirediqgalhsy...
HGL_H00000364754    -----------------iwynsreevyiiqaptpeikaawvseirkvltsqlqacreasqhral..............
HGL_H00000357177    -----------------navlvrsvatayqenvvdmgsvgqggdqgedgsdkraffiictselgppqiyelvaltsse
HGL_H00000367394    Q----------------rqderlllkshsrtltptpdgktmlrpvlrltsamtrevatdhkafyviftwdqeaqiyel
HGL_H00000358820    -----------------rldnikaidvalntcsynsvlsitvqesglpgtstllfqcqevgaqrlrtslhkale....
HGL_H00000241014    -----------------kcshffqlknisfcgyhpknnkyfgfitkhpadhrfachvfvsedstkalaesvgrafqqf
HGL_H00000313391    -----------------tgviehehpvnkisfiardvtdsrafgyvcggegqhqffaiktgqqaeplvvdlkdlfqvi
HGL_H00000217381    AKD--------------eatarswagaihaqin.............................................
HGL_H00000278412-3  -----------------vtkalvnhkimvpgnsqrhsgaqcvtcsyeassrlltpmewxnpmewgfiyvhkppvhlcf
HGL_H00000368824    -----------------fislpefkidrasecrkkyafkachpkiksfyfaaehlddmnrwlnrinil..........
HGL_H00000363694    -----------------vvvedddqgreqehtfvfrldsartckhlwkcavehhaffrlrtpgngkanrsdfirlgsr
HGL_H00000338191    -----------------lrckdtatahswfiaihtnim........................................
HGL_H00000390595    -----------------rkdlvytkanptfhhwkvdnrkfgltfqspadarafdrgvrkaiedlie............
HGL_H00000349259    KDDEEMNTWIQAI----ssaissdkh....................................................
HGL_H00000352995-2  ------K----------yvfasvdskppvislqklivrevaneekamflisaslqgpemyeiytsskedrnawmahir
HGL_H00000299084    -----------------kkdliynkvtptfhhwkiddkkfgltfqspadarafdrgirraiedisq............
HGL_H00000216373    KSAEEKNNWMAAL----islhyrstldrmldsvllkeeneqplrlpspev............................
HGL_H00000378649    -----------------drkgmlqlkiagapepltvtapsltiaenmadlidgycrlvngatqsfiirp.........
HGL_H00000362109    ESGR-------------rcqtgqgifafkcsraeeifsllqdlmqcnsinvteepvivtrsshpaelnlprt......
HGL_H00000303508-1  -----------------lafhtstpaackhlwkcgvenqafykyakssqiktvssskiffkgsrfrysgkvakevvea
HGL_H00000365891    Y----------------glqagrmlweqelysqlvylaptsffhtfagddcqvglnfadegeaqafqalvqekiqkr.
HGL_H00000265963    -----------------kispegkakiqlqlvlhagdttnfhfsnestavkerdavkdllqqllpkfkrkan......
HGL_N10018877       -----------------nkkapdfvfyaprlrinkqilqlcmgnhelymhqrkpdttevqqmkaqareekhqkqlerq
HGL_H00000338171    TSPAEARDWVDQI----sfl..........................................................
HGL_H00000341483    -----------------rgllrlndmastddgtlqsrlvmrtqgslrlilntklwaqmqidkaseksiritamdtedq
HGL_H00000403067    -----------------aptpeackhlwkcgienqafyklekssqvrtvsssnlffkgsrfrysgrvakevmessaki
HGL_H00000330572    -N---------------isfcgchprnscyfgfitkhpllsrfachvfvsqesmrpvaqsvgrafleyyqehl.....
HGL_H00000394751    -----------------faaenlqemnmwlnklglav.........................................
HGL_H00000402046    -----------------fyykdekeesilgsipllsfrvaavqpsdnisrkhtfkvtvcwvdearassthclspqaeh
HGL_H00000374557    -----------------qledeslklvepqsqallhtqpivsirvwgvgrdsgrdfayvardkltqmlkchvfrceap
HGL_H00000261486    RSKTACKHL--------wkcsvehhtffrmpekesnslsrklskfgsisykhrysgrtalqmsrdlsiqlprpdqnva
HGL_H00000363371-2  -----------------lesghdqkkkyvfqlthevykpfvfaadtlsdlsmwvrhlitcis................
HGL_H00000376247    -----------------enlsirevedskkpncfelyipdnkdqvikackteadgrvvegnhtvyrisaptpeekeew
HGL_H00000318965-3  -----------------ndmlslvdpmdrtvlhsqpivsirvwgvgrdngrdfayvardkdtrilkchvfrcdtpaka
HGL_H00000384136-1  -----------------sfnnkkcvikpidkkapdfvfyaprlrinkwilalcmgnhelymrrrkpdtievqqlkqle
HGL_H00000372160    ESGRMCD----------tgeglftfqtregemiyqkvhsatlaiaeqherlmlemeqkarlqtsltepmtlsksis..
HGL_H00000352995-1  -------Y---------ifaavdqkpsvislqkliarevaneergmflisassagpemyeihtnskeernnwmrqiqq
HGL_H00000359610    -----------------kmdevgiteyvkgdnrkfeiwyggkeevyivqapnvdvkmswlkeirnillkqqel.....
HGL_H00000374557    -----------------ahqqteallgecrvrflsflavgrdvhtfafimaagpatffchmfwcepnaaslseavqaa
HGL_H00000234179    -----------------prdftnisqgsnphcfeiitdtmvyfvgenngdgshnpvlaatgigldvaqswekairqal
HGL_H00000262539    -----------------ivafnmlnyrscknlwkscvehhtffqakkllpqeknvlsqywtlgsrnpkksvnnqyckk
HGL_H00000364893    -----------------rnafeisgsmierilvscnhqqdlhewvdhlqkqtk.........................
HGL_H00000391648-1  -----------------nlsirevddprkpncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewi
HGL_H00000379967-1  -----------------lenlsirevedprkpncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekee
HGL_H00000353646    -----------------iwfrrrkardtfmlqassldtkqawttdiscllwrqavhn.....................
HGL_H00000279230    -----------------tvvagpdpvnttflnfmavqddtikvwseelfklamnilgqn...................
HGL_H00000304895    -----------------lnseaaavvlqlmnirrcghsenfffievgrsavtgpgefwmqvddsvvaqnmhetileam
HGL_H00000330276    -----------------qtedmetakyvwrlcvarhkfyrlnqcnlqtqtvtvnpirrrsssrmslpkpqpyvmpppp
HGL_H00000233668    -----------------rygrdkvmfsfeagrrcpsgpgtftfqtvqgndifqavetaihqqkaqg............
HGL_H00000416895    -----------------lfyykdsreevvlgsiplpsyvispvapedrisrkysfkavhmgmraliynssmagsqaeq
HGL_H00000394487    -----------------rvgidgmkiiethneeyphtfqvsgkertlelqasseqdkeewikalqetidafhqrhetf
HGL_H00000345405    -----------------slgdckfgltfqspaeadefqksllaalaalg.............................
HGL_H00000386800-1  DSPE-------------emhswikavsgaivaq.............................................
HGL_H00000408285-1  -----------------paqnftlvppgtnphcfeiitanatyfvgetpggapggpngqgaeaargwemairqalm..
HGL_H00000393860    -----------------ktheclvksgdllmrdnlfeiitgsrtfyvqadspedmhswikeigaavq...........
HGL_H00000260402    -----------------sirdtrfgkfakipkvgptalahlflwaspsclcmvsgpdmvdltfhnfvsykenvgkdwv
HGL_H00000311489    KDEAEMSSWLR------vvnagiasassd.................................................
HGL_H00000263265    -----------------krrwfvlsghclfyykdsreesvlgsvllpsysvrpdgpgaprgrrftftaehpgmrtyvl
HGL_H00000353109    -----------------dssghtkyvyknklltselgvtehvegdpckfalwsgrtpssdnktvlkasnietkqewik
HGL_H00000288368    -----------------khrrlknskgstdghrylfrgrintevmevenvddgtadfhssghivvngwkihntaknkw
HGL_H00000344277    -----------------ygrdatrftfeagrmcdageglytfqtqegeqiyqrvhsatlaiaeqhkrvllem......
HGL_H00000262593    -----------------ygrdttwftfeagrmcetgeglfifqtrdgeaiyqkvhsaalaiaeqhehllqsvkns...
HGL_H00000401303-2  -----------------vceavpgakgatrrrkpcsrplssvlgrsnlkfagmpvtltvstsslnlraagckqianhh
HGL_H00000322926    -----------------nhplaslpllgysltipsesenihkdyvfklhfkshvyyfraeseytferwmevirsat..
HGL_H00000339299    -----------------gllprckerrvflfeqivifsepldkkkgfsmpgflfknsikvsclcleenvendpckfal
HGL_H00000378183    -----------------thhikrlilenhhatip............................................
HGL_H00000381549    -----------------hdprrisvsrrtfgqsglfvqtwyanssliksiwvmaisqhqfyldrkqskakipsarsld
HGL_H00000376652-2  -----------------wrdarqvyglnfaskeeattfsnamlfalnimnsqeggpsaqrqvqngpspeemdiqrrqv
HGL_H00000276420    -----------------efetrqgneiflaleeaiaaqknaaspgpplvpatvpavptmlprpes.............
HGL_H00000302269    -----------------qgyelffktrelkkkwmeqfemalsniypenatanghdfqmfsfeettsckacqmllrgtf
HGL_H00000296604    -----------------gslrlilnsklwaqmkiqranhknlqitatdledycikvfliqagakdtrylyaaihhrli
HGL_H00000248901    -----------------iplenlsvqkvddpkkpfclelynprcrgqrikacktdgdgrvvegkhgsyrisaasteer
HGL_H00000370719    -----------------tpiflnevlvklptdpsgdepifhishidrvytlraesinertawvqkikaaselyietek
HGL_H00000359073    -----------------ygfylihtqgqnglefycktkdlkkkwleqfemalsnirpdfadsnfhdfkmhtftrvtsc
HGL_H00000298694    -----------------tlqaisaeiklkwtssiaqllwrqaahn.................................
HGL_H00000360916    -----------------ddpmhnkdikkvcpcplqwsygfylihlqgkqgfqffcktedmkrrwmeqfemamsnikpd
HGL_H00000263373    KDEEEMNSW--------leavaas......................................................
HGL_H00000374373    -----------------evavsykkkkhvfklrlsngsqwlfhgkdeeemlswlqsmstaites..............
HGL_H00000264042    -----------------yvfklqfkshvyffqaeskytfkrwmeviesas............................
HGL_H00000335560    -----------------ykssikvsclglegnlqgdpcrfaltsrgpeggiqryvlqasdptvsqawikqvaqilesq
HGL_H00000352232    -----------------fvvkvegpseyiletadaahvkawvsdiqeclspgpcp.......................
HGL_H00000261439-2  -----------------lispdtkkialeknfkeisfcsqgirhvdhfgficressggggfhfvcyvfqcanealvde
HGL_H00000282406    DSPNILEEWIKVL----qnvlrv.......................................................
HGL_H00000379709    -----------------eeeqpisvnaclidisysetkrknvfrlttsdceclfqaedredmlawiktiqess.....
HGL_H00000364631    -----------------kmdisglqvqdigkpnavhtfiltgrkrclelqtrteeekkewiqviqatiekhkqnsetf
HGL_H00000353109    -----------------lvleenvdndpckfalmnretsekvilqaansdiqqawvqdinqvletqrdfl........
HGL_H00000356297    -----------------mlvevipkeplsfsvfhyknpkvqhtvqaksqqdkrlwvlhlkrlilenhsakipakakqa
HGL_H00000410689    -----------------afllrkkrfgqwtkllcvikdtkllcyksskdqqpqmelplqgcsimyipkdskkkkhelk
HGL_H00000391995    -----------------girqltsqdakptclaefkqiksirclpleegqavlqlgiegapqslsiktsslaeaenma
HGL_H00000412461    -----------------fislqgtqvtellpgpedpgkhlfeispggareqekapaagpealllmassrrdmedwvqa
HGL_H00000357298    -----------A-----ldkpsvvslqnlivrdianqekgmflisaappemyevhtasrddrstwiraiqqsvr....
HGL_H00000256190    -----------------dsgedtsckghidlaevemvipagpslgapkhtndkaffdlktskrvynfcaqdgqsaqqw
HGL_H00000354718    -------Y---------ifasldqkstvislkklivrevareekglflismgvkdpemvevhasskeernswiqiiqd
HGL_H00000349727    -----------------hflrkfgsdkgmfsfeagrrcdsgeglfafsssrapdmcgavavaiarqrerlpelaapqp
HGL_H00000379527    -----------------ytdkkstiyvdkldildlirlteqnsaektcanftlvlpkeevclktentesgeewrgfil
HGL_H00000264042    -----------------gsshfrfrgllplrgmlveesenewpaphcftiyaaqktivvaastrqekekwvldlstai
HGL_H00000346378    -----------------mlsvsdsvmtahpiqaeasteeeplwqcpvrlvtfigigrdphtfgliadlghqsfqcaaf
HGL_H00000367299-1  -----------------eeqaagigksakivvhlhpappnkepgpfqssknsyiklsfkehgqiefyrrlseemtqrr
HGL_H00000330278    DSPSLLEE---------wiralqsllkv..................................................
HGL_H00000361202    ------S----------vvvqllsirrcghseqyfflevgrstvigpgelwmqvddcvvaqnmhelflekmral....
HGL_H00000262940    ----A------------aekveeksfgsshvmqviytddvgqlqtaylqckcvnelnqwlsalrkvsinntgllgsyh
HGL_H00000409493    -----------------rafevwheredsvrkyvlqarttviksswvkeicgiqqrlal...................
HGL_H00000389787    -----------------kyrsqhiipleevtleplpdtmeaknrwmiktakksfvvsaastterqewishieecvrrq
HGL_H00000285094    -----------------vrtgkntdifrsngisdqisedcafsviygenyesldlvansadianvwvtglryli....
HGL_H00000296414    -----------------tecsavqfdysqervncfclvfpfrtfylcaktgveadewikilr................
HGL_H00000409572    -----------------iediqevrmghrteglekfardvpedrcfsivfkdqrntldliapspadaqhwvrglhkii
HGL_H00000377233    -----------------acisrvtaigdqkfevitnnrtfafraesdaerkewmqslqrava................
HGL_H00000364277    -----------------cvprlrllgqkfsvraridvdgmelkessnlnlprtflvsgkqrslelqarteeekkdwvq
HGL_H00000234313    AAPKERTEWIKAI----qvasr........................................................
HGL_H00000395986    -----------------seknrtmlfqvgrfeinlispdtksvvleknfkdisscsqgikhvdhfgficrespepgls
HGL_H00000324287    -----------------errfcfevvsptkscmlqadseklrqawikavqtsiatayr....................
HGL_H00000264057    -----------------devdltdasvaesstknvnnsftvitpcrklilcadnrkemedwiaalktvqnrehfeptq
HGL_H00000396185-1  -----------------ndgmtvwharqaggrekpsfsisdvetvrkghdsellrglaedfpleqgftvvfhgrrsnl
HGL_H00000346378    -----------------lihcqplvhirvwgvgsskgrpistsardfafvagdkdscmlkchvfhcnvpakaiasalh
HGL_H00000391106    -----------------tievrsakeivdntskengidivmadrtfhliaespedasqwfsvlsqv............
HGL_H00000366977    -----------------lvdkivcrelrdpgsflliylnefhsavaaytfqasgqalcrgwvdaiynaqnq.......
HGL_H00000304895    -----------------aaseaggparleyyenekkwrhkssapkrsipletcfninkradsknkhlvalytrdehfa
HGL_H00000399903    KKEVRNKVYSRLL----sln..........................................................
HGL_H00000346733    -----------------rfcfevvsptkscmlqadseklrqawvqavqasiasayr......................
HGL_H00000386911    -----------------npeeagkfvfevtpalwdlnrtaqdsyilmassqaemeewvkflrrva.............
HGL_H00000322926    -----------------ytsrgltasnqfkvhgqlplygmtmeesedewgvphcltlrgqrqsivvaassraemekwv
HGL_H00000377233    ESAELAREWVKC-----iaka.........................................................
HGL_H00000336522    -----------------dktkhqlryydhrvdteckgvidlaeveavgpgtptmgapktvdekaffdvkttrrvynfc
HGL_H00000402861    -----------------aaikeirlgkntetfrnngladqicedcafsilhgenyesldlvansadvaniwvsglryl
HGL_H00000312262    -----------------lewrgegeapqslltmeeiqsveetqikerkclllkirggkqfvlqcdsdpelvqwkkelr
HGL_H00000367747    -----------------segrqseifqrypdgsfdpnccfsiyhgshresldlvspsgdkartwvtglrylm......
HGL_H00000250617    -----------------sasprmsgfiyqvsrfhmkqitglksrldeiegndctfeitgnivervvvhcnnnqdfqew
HGL_H00000288266    -----------------lidpqtqvtrltfplpcvvlyathqenkrlfgfvlqtsggrsesnlssvcyifesnnegek
HGL_H00000352721    ------D----------vekgfmsnkhvfaifnteqrnvykdlrqielacdsqedvdswkasflragvy.........
HGL_H00000351969    ------------M----sskhifalfnteqrnvykdyrflelacdsqedvdswkasllragv................
HGL_H00000020673    -----------------qmqswitrinvvaamf.............................................
HGL_H00000366843    -----------------egpgsreplgvivlegctvelveaaeefafavrftgaharcyalaaesqaalegwvkalsr
HGL_H00000158762    -----------------lcpdserrfcfevvstskscllqadserllqlwisavqssiasa.................
HGL_H00000274710    -----------------apskeemlswilrinlvatifsapafpaavnsmkkfcrpllp...................
HGL_H00000362751    -----------------cvrghdgtpesdcfafteshynaelfrihvfrceiqeavsrilysfatafrrsak......
HGL_H00000276185    -----------------enqgvarvetsimdakplvllmewpeatnfacliagycrllldsrkmvfsr..........
HGL_H00000407267    -----------------figskesgytvleglppstqgyhwphgitivtperkflftceteagrrewveafqkvvgrp
HGL_H00000251507    -----------------tesncfaftesslgseefqihvfsceikeavsrilysfctafkrssrqvsd..........
HGL_H00000245796    -----------------aptakemtswiarinlaaathsappfpaavgsqrrfvrpilp...................
HGL_H00000316029    -----------------waaspksftldfgdyqdgyysvqttegeqiaqliagyidii....................
HGL_H00000216446    SSK--------------teraewieaikk.................................................
HGL_H00000276204    ETEQEMEEWLTTL----kkiiqintdslvqe...............................................
HGL_H00000371397    -----------------darlpkvfawvyrhelkhkavmlrchavlvskpekaqamalllyqtsanalaefkrlkrrd
HGL_H00000366284    -----------------fvvvrrpyvfiynsdkdpvergiinlstaqveysedrqamvktpntfavstkhrrvllqav
HGL_H00000285046    -----------------faikgkvlytytaredkvamesipllgftiapgreegssdpgpifhlyhkktlfysfkaed
HGL_H00000343899    -----------------tgcptrsrhllqllsnshrlymnlqpvlrhirkleeneekkqyresyisdnldldmdqlek
HGL_H00000362014    ------D----------vekgfmsskhifalfnteqrnvykdyrqlelacetqeevdswkasflragvyp........
HGL_H00000328118    PSKEIRDCWFSEI----skllmeqqn....................................................
HGL_H00000405405    -----------------lkgviyfqaieevyydhlknankspnplltfsvkthdriyymvapspeamriwmdviv...
HGL_H00000303476    -----------------rwaaspksftldfgeyqesyysvqttegeqisqliagyidii...................
HGL_H00000384312    -----------------dgeidlrsctdvteyavqrnygfqihtkdavytlsamtsgirrnwiealrktvrpts....
HGL_H00000274376    -----------------qhfseehyifyfagetpeqaedwmkglqaf...............................
HGL_H00000328800    -----------------mmsftmpfnlmkncaveqpvfganyitgtiqaapdggwegqatfklvfrkggaihfaqlm.
HGL_H00000339299    -----------------kevkdssgrskylyksklftselgvtehvegdpckfalwvgrtptsdnkiv..........
HGL_H00000354611    -----------------cftvvtespnpaltfcvkthdrlyymvapsaeamriwmdviv...................
HGL_H00000349298    ------S----------ivllfkmistraasglyraitethafyrqcdtvtsavmmqysrdlkghlaslflnenin..
HGL_H00000317786    -----------------cydvteypvqrnygfqihtkegeftlsamtsgirrnwiqtimkhvhptt............
HGL_H00000394225    -----------------emfteeeslvrvelhvldvkpitllmessdamnlacltagyyrllvdsrrsifnm......
HGL_H00000292140    -----------------yadkeqtklkgviyfqaieevyydhlrnaskspnprltfcvktyerlfymvapspeamriw
HGL_H00000345988    -----------------ilidsiykvtegrqseifhrqaegnfdpsccftiyhgnhmesldlitsnpeeartwitglk
HGL_H00000386733    -----------------lgfkvsdltipkhrhllqaknqeekrlwvhclqrlffenhpas..................
HGL_H00000234313    -----------------fvfkitsikqqdqyfqaayleerdawvrdikkaikci........................
HGL_H00000362405    -----------------tagwakrfvvvrrpyaymynsdkdtverfvlnlstaqveysedqqamlktpntfavctehr
HGL_H00000417003    -----------------fvlskaylmafqpgkldedpllsynvdvclavqidhldgcdscfqvifpqdvlrlraetrq
HGL_H00000379967-2  -----------------nlsirevedprkpnclelynrshkgqvikackteddglvvegnqlvycisalspeakeewr
HGL_H00000317912    -----------------vltkeearr....................................................
HGL_M00000071081-2  -----------------teylvqrnygfqihtkegeftlsamtsgirqnwiqtimkhvhptt................
HGL_M00000071081-1  -----------------avdlggeidlstcydvteypvqrnygfqihtkggeftlsamtsgiqrnwiqtimkhvyp..
HGL_H00000388152    SSEDERKSWMA------llrrei.......................................................
HGL_H00000285046    -----------------pekdgkyrlksslpvagmkvsrpvmenipyalrietaqcclmlsasscterdewhsclsra
HGL_H00000318965-1  -----------------ghedgrdfayvardkdtrilkchvfrcdtpakaiatslheicskimaewkn..........
HGL_H00000258390    ETELDMDEWIHTL----nrilqispegplqgrrs............................................
HGL_H00000258530    -----------------aggliqdldncsvmavdcedrrycfqitapngksgiilqaesrkeneewicainni.....
HGL_H00000394487    -----------------csflqymekskpwqkawcvipkqdplvlymygapqdvraqatipllgyivddmprsadlph
HGL_H00000354919-1  KDEKNAEEWLQ------cinvava......................................................
HGL_H00000366995    -----------------ltlllesnsakdlacliagyyrlfvnpvisiflwp..........................
HGL_H00000344961    -----------------llvtktkrnkkklggsdtgvmcplltpelqaiikeggsckvldqpipldrlvvksidplhv
HGL_H00000388152    SSEDERKSWMA------llrrei.......................................................
HGL_N10025555       -----------------eveavgpgtptmgapktvdekaffdvkttrrvynfcaqdvpsaqqwvdriqscl.......
HGL_H00000288266    -----------------rycfqitsfdgkkssilqaeskkdheewictinni..........................
HGL_H00000373214    -----------------syrekkaepqellqldgytvdytdpqpgleggraffnavkegdtvifasddeqdrilwvqa
HGL_H00000295888    QKGIRNKVYQRFL----.............................................................
HGL_H00000385609    -----------------mpvdcinirtahecrdiqppdgkpkdcllqivcrdgktislcaestddclawkftlq....
HGL_H00000386800-1  -----------------vmnagmrkyflqandqqdlvewvnvlnkaikitvp..........................
HGL_H00000345895    KTSEDADELH-------rillekke.....................................................
HGL_H00000399588    KTEEEMQVWVHS-----isqvcnlghleaaa...............................................
HGL_H00000364277    -----------------elqrrwmavlgra................................................
HGL_H00000391106    -----------------slklgtlvlnslcsvvppdekifketgywnitvygrkhcyrlytkllneatrwasaiqnvt
HGL_H00000262995    -----------------ntidrifylvadseeemnkwvrcicdic.................................
HGL_H00000398481    -----------------ksepqelmqlegytvdytdphpglqggqmffnavkegdtvmfasddeqdrilwvqamyrat
HGL_H00000317786    -----------------empttlpqgtinmnqcsdvvdgegrtgqkfslciltpekehfiraetkeiisgwlemlmvy
HGL_H00000376700    -----------------cvirdtrllcyksskdhspqldvnllgssvvhkekqvrkqehklkimpmnadvivlglqsr
HGL_H00000216446    -----------------ktqtsteyfleacsreerdawafeitgaihagqpg..........................
HGL_H00000281419    -----------------lltcqvktnpeekkcfdlishdrtyhfqaedeqecqiwmsvlqnskeealnnafkgdd...
HGL_H00000339381    -----------------gfactadpdtsgc................................................
HGL_H00000263650    -------W---------vgtvllhccelierpskkdgfcfklfhpldqsiwamkgpkgesvgsitqplpssylifraa
HGL_H00000393860    NDQKDLKDWVEA-----lnhaskitv....................................................
HGL_H00000302895    -----------------fpltsmkfylgvkkkmkpptswgltaysekhhwhlccdssqtqmewmasifiaqhendiwp
HGL_H00000296721    -----------------ksgtlyfhkdradlhthvnaialhgcevapgfgprhpfafrilrnrqevaileascsedmg
HGL_H00000318965-1  -----------------tfafimdtrsqhfechafcckpnaanvseavqaaymlhyqk....................
HGL_H00000347244    -----------------fkmyktpiflnevlvklptdpssdepvfhishidrvytgqgirepplpggpcpvrtphpap
HGL_H00000296721    -----------------kqltvikedqllcyksskdrqphlrlaldicsviyvpkdsrhkrhelrfsqgasevlvlal
HGL_H00000313731    -----------------apsrhiflvqhieavrqghqseglrrfgaafpparcltitfrgrrknldlvarsaeeaqhw
HGL_H00000302895    ETSQ-------------aqrkwtetiakhfvpfvaenltetdydligqlfykdchaldqwrkgwf.............
HGL_H00000261729    -----------------qcknvnelnqwlsalrkasapnqeklaachpgafrggrwtcclqaersaagcsrth.....
HGL_H00000410689    -----------------vsiplrgcevipgldskhpltfrllrngqevavleasssedmgrwigilla..........
HGL_H00000348828    -----------------dvliitkkkseesynvndyslrdqllvescdneelnsspgknsstmlysrqssashlftlt
HGL_H00000347134    ---V-------------trnerhsyqvyrqpipvqelvledlqdgdvrvggsfrgafgnsdkaknifrvrfqdpspgq
HGL_H00000415034    P----------------c............................................................
HGL_H00000386331    -----------------ssgntyfhitignlvrgskllcetslgykmddlltsyisqm....................
HGL_H00000330278    -----------------lsshctlvihppehsptylligtkhekdtwlyhltvvaggssgkvgtay............
HGL_H00000350297    -----------------kcavkngiltishatsnrqpaklnlltcqvkpnaedkksfdlishnrtyhfqaedeqdyva
HGL_H00000265748    -----------------tvrpqreddretlvsqcrdtlcvtknwlsadtkeerdlwmqklnqvlv.............
HGL_H00000376700    -----------------aqqplslvgcevvpdpspdhlysfrilhngeelakleaksseemghwlglllse.......
HGL_H00000011684    -----------------tkpprkadkakiirppvmleklvcqplrdpnsflvigltefqcvasafvaycrsptdcaqw
HGL_H00000338769    -----------------gcltishsminrppvkltlftcqvrpnseekkcfdlvthnrtyhfqaedeheceawvsvlq
HGL_H00000279227    -----------------fdehinvafgcvsascrivheyiggyifls...............................
HGL_H00000407746    -----------------alfaedsivqsvpehpkkenvfclsnsfgdvylfqatsqtdlenwvtaihsacasl.....
HGL_H00000303909    SSDYERSEWR-------eaiqklqkk....................................................
HGL_H00000326706    -----------------velgsyekcqdlrallkrkhrfillrspgnkvsdikfqapsgeekeswikalnegi.....
HGL_H00000405963    -----------------kqhyftvnfthenqkalelrtedakdcdewvaaiahas.......................
HGL_H00000395182    -----------------ekniqevfdlsdyekceelrksksrskknhskftlthskqpgntapnliflavspeekesw
HGL_H00000217289    -----------------fdqnvsiaftclsadckvvheyiggyifls...............................
HGL_H00000341071    -----------------rlggslrgafsnneriknffrvsfkngsqsqthslqandtfnkqqwlncirqa........
HGL_H00000368719    -----------------gsdgltfqgllplsdlsicplegsrehgfqitgplpapilvlcpteaelsswlyhlekqma
HGL_H00000298542    -------A---------fwktcveyhaffrlseepkskpktllcskgssfryrkhypsqyderqcr............
HGL_H00000264051    -----------------qgelqqmsgpktsrtlrtkklfreiylflfndllvicrqipgdkyqvfdsaprgllrveel
HGL_H00000364207    -----------------tpsrvitlkattkqvmlywlqqlqmkrwefh..............................
HGL_H00000279227    -----------------vssqkfcikllvpspegmseiylrcqdeqqyahwmagcrlas...................
HGL_H00000286827    -----------------ehpkkdfvfclsnslgdaflfqttsqtelenwitaihsacaaavarhhhkedtlrllksei
HGL_H00000396519    -----------------vtgkdcphmkeksalkqnkevlelafsilydpdetlnfiapnkyeyciwidglsall....
HGL_H00000345808-3  DNDAVINDWFKVL----ssainnqa.....................................................
HGL_H00000367764    -----------------vhtwyacaaliksiwamaisqhqfyldrkqskskihaarslseiaidltetgtlktsklan
HGL_M00000082342    -----------------kksfetnkyfnihpkgviplggclveakeepsmpyamkishqdfhgnvllaaesefeqtqw
HGL_H00000378262    -----------------kighphglqitygreshtrnlflyhesgkeivdwfnalraa....................
HGL_H00000261439-1  ---K-------------ktaleksfkeisfssqgirhmdhfgficqessggggfhfvcsmfqctnealvdkitmtvkq
HGL_H00000056217    D----------------hapfssirgekcemklhgphknlfrlflrhntqgtqseflfrtdtqseklrwisalsmpre
HGL_H00000221086    -----------------eelafchsnidaidkrfvgslgtiiikckdfriiqldipgmeeclniassiealstldsit
HGL_H00000274498    -----------------qrdskqiimvpfdqksggkggedesvtlksctrrktdsiekrfcfdveavdrpgvitmqal
HGL_H00000342858-1  -----------------vnweikmvtvefadevrlsfictevdckvvhefiggyifls....................
HGL_H00000320563    YNSDRSKVFKSFC----sfq..........................................................
HGL_H00000311837    PTTQDCVDWLHAI----sahi.........................................................
HGL_H00000346127    -----------------alwldgtlgyyhdetaqdeedrvlihfnvrdikvgqechdvqppegrsrdglltvnlregs
HGL_H00000272666    -----------------isswssgstyfhmvrgslgrgsrllcetslgykmddlltsyvqq.................
HGL_H00000363371-1  -----------------yslesghdqkkkyvfqlthevyknfdfaadtlsdlsmwvrhliasi...............
HGL_H00000315410    -----------------dkgilkyaksqadiereklhgcidvglsvmsvkksckcidldteehiyhlkvkseevfdew
HGL_H00000282406    -----------------klweakveevdrscdsdedyeasgrsllsthhtivvhpkdqgptylligskyekdtwlyhl
HGL_H00000281172    -----------------ddraanlise...................................................
HGL_H00000265080    -G---------------eqsgrpagvyllegcscerapappratagagsardaldkqyyftvlfghegqkplelrcee
HGL_H00000412733-1  -----------------itvdqktfhfqardaderekwihaleet.................................
HGL_H00000262593    ESDLEADEWCKVL----qme..........................................................
HGL_H00000386800-2  -----------------kaefcfvmnagmrkyflqandqqdpvewvnvlnkaikitvp....................
HGL_H00000356655    -----------------tasvalhrlliedipdskyvknafilqgpkhewlcateveddkflwmsilqkairssv...
HGL_H00000407267    -----------------lkdnstrnifvyhedgkemvdwfnalraa................................
HGL_H00000403323    DSEGVISAW--------hqaigqgieeppadp..............................................
HGL_H00000362369    -----------------rpdqshcfvilygmefrlktlslqatsedevnmwikgltwlm...................
HGL_H00000217289    ----I------------ayfknkdleqgepveklnlrgcevvpdvnvagrkfgikllipiadgmnevylrcdhenqya
HGL_H00000336923    -----------------vfflkectkrhtdsidrrfcfdieaadrpgvsltmqafseeerrqwlealg..........
HGL_H00000411012-3  DNTKVRDDVYHSI----l............................................................
HGL_H00000180173-2  -----------------qattatgcpllircknfqiiqliipqerdchdvyvslirlakpvkyeelycfsf.......
HGL_H00000342858-1  -----------------nisgqkfnikllipvaegmneiwlrcdnekqyahwmaacrlask.................
HGL_H00000386897    -----------------sspsissstspkldpppsphanrkkhrrkkstsnfkadglsgtaeeqeenfefiivsltgq
HGL_H00000407163    -----------------rtdvipllsvnmggeqcggcrrsnttdrphafqviladrpclelsaeseaemadwmqhlcq
HGL_H00000256190    -----------------piasitkekkitmqnqlqqnmqeglqitsasfqlikvafdeevspevveifkkqlmkfryp
HGL_H00000303507    -----------------qrekrankaskamerlkkklseqesllllmspsmafkvhsrngksytflissdyeraewre
HGL_H00000354952    ETEEDMNKWVQ------sicqicgfnqaeettdsqrnis.......................................
HGL_H00000411012-2  YEPQDRDDLYFY-----i............................................................
HGL_H00000312753    ------------V----legctvelaeapvpeefafaihfdapgvrphllaadgqeaqeawvkalsrasfsymrlvvr
HGL_H00000339769-3  -----------------eaenydlalsfqekagcdeiwekicqvq.................................
HGL_H00000344277    DSELEAEEWYKTL----sv...........................................................
HGL_H00000371221    -----------------wilhhhiasveklplttsgcplliqcknfrtvhfivprerdchdiynsllqlskqakyedl
HGL_H00000362894    -----------------krihnfsvinplagqatthifavdskadlqqwmeafwqhffdlsqwkhcceelmkieimsp
HGL_H00000376293    -----------------ngmlkyskapldiqkgkvhgsidvglsvmsikkkarridldteehiyhlkvksqdwfdawv
HGL_H00000406026    -----------------sparcqfafvarnprnpasrlfchlfvgsqpgemqilylllcrsfqlay............
HGL_H00000259351    -----------------imgwmvqlpddpehpdifqlnnpdkgnvykfqtgsrfhailwhkhlddacksnrp......
HGL_H00000302895    -----------------rtvkqsfeiitpyrsfsftaesekekqdwieavqqsiaetlsdy.................
HGL_H00000380413    -----------------tspranglplersntqlgggpgaphsassaslhsertlsssawagprpeglhqrscsvssa
HGL_H00000364631    -----------------qqgqqswylstpsaelkqrwlealrav..................................
HGL_H00000378262    -----------------ivtphrrfvltcpsekeqrewlesfrdvls...............................
HGL_H00000363617    -----------------iyyvpkgkakvsrdlvcflqldhvnvyygqdyrnkykaptdyclvlkhpqiqkksqyikyl
HGL_H00000378965    -----------------hpdqksiplrmcyvtrslaladpenrv..................................
HGL_H00000263826-1  -----------------fsvakcqlmkterpkpntfiirclqwttviertfhvdtpeereewteaiqavadrlqrqee
HGL_H00000298815    -----------------svsemkssgkmnglvtsspemfklkscirrktdsidkrfcfdievverhgiitlqafsean
HGL_H00000365411    -----------------rasgiyyvpkgktktsrdlacfiqfenvniyygvqckmkykaptdhcfvlkhpqiqkesqy
HGL_H00000407834    -----------------aenydlalsfqekagcdeiwekicqvq..................................
HGL_H00000368719    -----------------nleeeekqirsfliegrlintirvvcassedyshwllclrtvsr.................
HGL_H00000361009    -----------------yhsngytvtngwkihntaknkwfvcmaktaeekqkwldaiirereq...............
HGL_H00000402299    PNPQDRKKF--------tddlresvaevqemek.............................................
HGL_H00000367638    -----------------lhllksgtfacralypmaqcllcrvfghsggpcggllslsfpreklllmstdqeelshwyq
HGL_H00000411012-1  YEPQDRDDLYFY-----i............................................................
HGL_H00000371067    -----------------lsfvslidgyyrltadahhylcke.....................................
HGL_H00000356607    -----------------stsnknvsvvgwmvmmaddpehpdlflltdsekgnsykfqagsrmnamlwfkhlsaacqsn
HGL_H00000339769-2  -----------------nydlalsfqekagcdeiwekicqvq....................................
HGL_H00000342858-2  -----------------qwnvnweikmvtvefadevrlsfictgvncrvvpdfigssq....................
HGL_H00000254806    -----------------mrnvpeafkgtkkgtayltpyreceikqpvfganyikgtvkaeagggwegsasykltftag
HGL_H00000389913-1  -----------------sllrceavgpahsdgrfelvfaskklalrassqdeaedwlervrealqkvrpqqehewvdv
HGL_H00000367629    -----------------iitkkksedsyavqdygqldhvqvrklepsepylpgggnrsssvphpfrvtllrnsegrqe
HGL_H00000364550    -----------------plvemhmqlfqnsyyqfgikllsavpggerkvliifnapslqdrlrftsdlresiaevqem
HGL_H00000333568    -----------------edtvnpsspppnssvltsgvgadvarrwemaiqhalm........................
HGL_H00000328160    -----------------dmstvqmgegpeatiptpspspspsslqpppdqtskhllkpdrnlaralstdctpsgdlsp
HGL_H00000391668    -----------------plsseydfalgnigrldavsglsrvqllrpgsqlkfipeeilihgrdfrllrvgfeaggle
HGL_N10005278       -----------------glylqgykvseqihsfkqsateleppseefktfyfcaenrten..................
HGL_H00000403459    -----------------vadvnesnvymvtrgrklyglptdfgfcvkpnklrsghkglrifcsedeqsrtcwlaafrl
HGL_H00000260283    -----------------ltdmwtascvdevgevntsamksfvlgwptvnfvatfsspeqkdkwlsllqryi.......
HGL_H00000258530    -----------------alsvslspqfeltsvtqfaahqenrrlfgfvvrmpestggeslsayifesnsegekicyav
HGL_H00000381793    -----------------hlqlladledstvftliagkkqysaptdhglcikpnkvrnetkelrllcaedeqslacwmt
HGL_H00000372160    ESELEAEEWCKHL----cme..........................................................
HGL_H00000377233    -----------------ylgvkkklrpptcwgftvvhetekhekqqwylccdtqmelrewfatflfvqhdglvwpsep
HGL_H00000377566    -----------------rgeeeaylnfiapskrdfylwtdglsall................................
HGL_H00000302895    EKEEERNDWISILL---nalksq.......................................................
HGL_H00000405963    -----------------saeeeakgsgqdidhldfkigvepkdsppftvilvassrqekaawtsdisqcvdni.....
HGL_H00000325285    -----------------lhisckdskvvrchfptfkqcqewlsrlsratarpakpedlfafay...............
HGL_H00000315662    CPKKKCASTYTF-----cksvgllgmqfhlfeneyyshgitlvtplsgaekkqvlhfcalgsdemqkfvedlkesiae
HGL_H00000338185    -----------------vafqeevakewtnevfslatnllaqn...................................
HGL_H00000283937    -----------------panalleirpfqvwlhhldhkgeatvhmdtfqvariayctadhnvspnifawvyreinddl
HGL_H00000201647    -----------------htvedasrklavmdsqgrvwtqemllr..................................
HGL_H00000265080    -----------------egerqcflftkhflictrssggklhllktggvlsliectlieeqdasddesrgsaqmfghl
HGL_H00000371577    -----------------genditlhcvdqiygvfdekkktlfgqlkkypekliihckdlrvfhfclrytkeeevkriv
HGL_H00000342804    -D---------------lsrqnafqviavdgvcsgiiqclstedsvdwlqaiatnis.....................
HGL_H00000417003    -----------------pynlyfysldssgnqnlcatyqlshfqsisvlghlearmvdtvlcdntqlqlkaespweal
HGL_H00000385326    -----------------gkeggpqdvdqresplnnfsvarkcndgtfigykerpqdvdqresplnnfsvaqcqlmkte
HGL_H00000264276    -----------------fplatlwveplseeassvnglkvttpeeqftllsstpqektkwlraisqavdqalrgts..
HGL_H00000384651    -----------------ltckdckvircqfstfeqcqdwlkrlnnairppakiedlfsfay.................
HGL_H00000276420    -----------------aggeassprdtsafvmetkerlyllaapsaerddwmqaic.....................
HGL_H00000352336    -----------------thfvlstlslatdsredaimwlsglkilh................................
HGL_H00000231487-8  -----------------sqvalytfghranewvradatg.......................................
HGL_H00000272430    -----------------sisnqygddevmhtlqtdsqealqswrealwqlffdmsqwkqccdeimkietpapr.....
HGL_H00000356278    -----------------vtegggeidfrcp................................................
HGL_H00000399532-2  -----------------viertfhvdspdereewmraiqmvanslkq...............................
HGL_H00000263847    -----------------kasseverqrwvtalelakakavkmlaes................................
HGL_H00000362409    -----------------gykvltsldqylelvgnslpgttsksggtpifkcptqfplilwhpfarhyyfcmmteaeqd
HGL_H00000337572-2  PNRKDMEEWIN------iiktvqqgeinkxp...............................................
HGL_H00000355026    -----------------lllfsdlllitqpksgqrlqvldyahrslvqaqqvpdpsgpptfrlsllsnhqgrpthrll
HGL_H00000363317    -----------------kkftitssitwkkhtfvtdsaktctyllglcsaqhglhaqtgsg.................
HGL_H00000378965    -----------------skdsataqawfsaihanvs..........................................
HGL_H00000382697    -----------------dklfhvrpvtqgdvyraeteeipkifqilyanegecrkdvemepvqqaektnfqnhkghef
HGL_N10007969       PNPQDRKKF--------tddlresvaevqemek.............................................
HGL_H00000320291    -----------------fikcfddtihgfrvpknslqqsrenwleaieehsaysthycsqdqmtede...........
HGL_H00000342793    -----------------vllvdkefrikvgkkdtetkyglridnlsrtlilkcnsyrharwwggaiedfiq.......
HGL_H00000317985    -----------------fhvrpvtqtdvyradakeiprifqilyanegeskkeqefpvepvgeksnyichkghefipt
HGL_H00000317578    -----------------lfpnrlewrgegesrsdp...........................................
HGL_H00000391648-2  -----------------dgwvvegnqmvyrisapmqeekdkwiksiqaavs...........................
HGL_H00000407802    -----------------syydspedawkgckgsiqmavceiqefaent..............................
HGL_H00000369121    -----------------eekkyfhvflnevtalvpvlseakhcfalynpertrqrwpvrlaapteqdmndwlallsls
HGL_H00000233668    -----------------virlaecvsvapvavesppepgaaafrldtaqrshllaadapssavwvqtlcrnafpghtv
HGL_H00000386183    RSAAERDKWMENL----rravhpnkdnsrrv...............................................
HGL_H00000401910    -----------------clmplsqikkvldiretedcrnafallvrppteqanvllsfqmtsdelpkdnwlkmlcrhv
HGL_H00000259406    -----------------tkedepgrcnvlrnplylqsiklqegssgdlkfcllylaekaeclftleahsqeqkk....
HGL_H00000377386    -----------------rtvpghefllqsdqeselrawhrglravierldrenplel.....................
HGL_H00000377233    -----------------eadrrsfdlttpyrifsfsadtelekeqwleamqgaiaealstlevaeqiwaaapn.....
HGL_H00000361202    -----------------tadaparleyyenarkfrhsneyfamvaeneseqeswylllsrl.................
HGL_H00000345492    GDEQQLNSWM-------aelweytgqgp..................................................
HGL_H00000376306    -----------------takadvpyilkmeshphttcwpgrtlyllapsfpdkqrwvtalesvvag............
HGL_H00000349727    -----------------lpadgescprdtgaflltttershllaaqhrqswmgpicqlafpgtrdcs...........
HGL_H00000345133    ---R-------------aspastallqaldlrdpqfsatpvlasdvihaqskdlprifrvtasqltvppttctvllls
HGL_H00000377233    -----------------ceeplqlrrlqelsvqgesenqvlvlverrrtlyiqgerrldfmgwlgaiqkaaaslgdtl
HGL_H00000270747    -----------------fndclllsrrkelgkfavfihakmaelqvrdlslklqgipghvfllqllprqhtkhqsekq
HGL_H00000391106    -----------------rvlhcnadapeemhhwitllqrc......................................
HGL_H00000355060    -----------------lqkdlavveqitllvstlhgtyqnlnmavaqdwclalqrllrvkeeeihsankcrlrlllp
HGL_H00000412733-6  -----------------eeiilchslqlq.................................................
HGL_H00000302895    -----------------rrlqelttstmiqngekldvlflvekgrtlyihghskldftvwhtaiekaagtdgn.....
HGL_H00000264818    -----------------lsspaaalsfaalvdgyfrlttdsshylche..............................
HGL_H00000300584    -----------------rqlmtywlqelqqkrweycnsld......................................
HGL_H00000295095-2  -----------------skqqalsnmpk..................................................
HGL_H00000335341-1  -----------------dipcifrvtasllgspsktsslliltenenekrkwvgileglq..................
HGL_H00000318075    CTQEQCQEWMEAL----rrasyeym.....................................................
HGL_H00000262719    -----------------ggkveevkkhqhclsfsssgpqsqtyyicfdtfteylrwlrqvskv...............
HGL_H00000335341-2  -----------------vlasdvihasrkdipcifrvtasqlsapnnkcsilmladsenekskwvgvlselhki....
HGL_H00000263674    -----------------ftdlivcttlkrksgslrrssmslytaasvidtaskykmlwklpledadii..........
HGL_H00000356621    NSASERDKWMEN-----lrrtvqpnkdncrraen............................................
HGL_H00000345808-1  -----------------rtrqgtelliqsdndaiisdwfkvlsstisnq.............................
HGL_H00000397663-5  -----------------ksssevdrqqwitalelakakavrmmn..................................
HGL_H00000379804    -----------------klnafwdnlykrysvfsilaadakekqfwvtqlracakyh.....................
HGL_H00000336522    -----------------altkekrisvqtpmdqllqdglqlrsctfqllkmafdeevgsdsaelfrkqlhklrypadi
HGL_H00000358316    -----------------yykdhhhrgsieidrnssvevgikspekmqsvqkmfkcqpdqvmsisttnrdyfliaeds.
HGL_H00000391106    -----------------vlkgeaflwfrskqe..............................................
HGL_H00000216446    CSREERDAW--------afeitgaihagqpg...............................................
HGL_H00000234453-1  V----------------naaerqrwlvalgsskacltd........................................
HGL_H00000258530    -----------------tsqalrrtnp...................................................
HGL_H00000378965    -----------------prrkeawlspahsypllatrlvhsgpgkgspqaglelsfatrtgtkqgiethlfraevskd
HGL_H00000263088    -----------------evqvgkrstetrygvridtshrslilkcssyrqarwwgqeite..................
HGL_H00000343204    -----------------lqlssheealsfvslvdgyfrltadahhslct.............................
HGL_H00000315334    STQNDMEDWVKSIR---rviwgpfgggifg................................................
HGL_H00000339769-4  -----------------isralsfqdpedcqkiweeicqvqg....................................
HGL_H00000348611    -----------------svkecqtgkmhilplvggkieevkrrqhslafssagaqaqtyhvsfetlaeyqrwqrq...
HGL_H00000389913-1  -----------------frvrnnekmlsdshgveairdilpdtslggpaffkiitakavlklqagnaeeaalwrglvr
HGL_H00000264554    ---V-------------treainrlheavpgvrgswkk........................................
HGL_H00000311837    -----------------lfkahklwvmdgywlpanlclrlqdldlenqrpycfsllagqgrshvftvelgtelavwek
HGL_H00000342858-4  -----------------mdantgdtikmwrfsnmkq..........................................
HGL_H00000007414    -----------------aqridldtedniyhlkiksqdlfqswvaqlrahr...........................
HGL_H00000381571    -----------------lgpgqlyhdlqnllhdlnvvgqiaqligslrgnyqnlnqsvahdwtsglqslilkkedeir
HGL_H00000293349    -----------------glwsvtvsgrkhnvrlcsprqaeaerwgvalrevi..........................
HGL_H00000342804    -----------------tvqsesgedlyfsveldsdlaqwerafqtatf.............................


                                                                                                    
                                                                                                    
d1mi1a2               ..............................................................................
HGL_H00000278412-1  nfargttttrsfdfeietkqgtqytfssiereeygklfdfvnakklnikn............................
HGL_H00000278412-2  attrffdldieteqgtrytfssiqkeeygklfdfisakklniks..................................
HGL_H00000286827    ccsspegrtdflktvhsilrdkhrrq....................................................
HGL_H00000407746    sktnivkvirsilrenfrrh..........................................................
HGL_H00000401303-1  peglaqdvistigqafelrfkqylr.....................................................
HGL_H00000265381    ..............................................................................
HGL_H00000413502    crkeieerek....................................................................
HGL_H00000401303-3  chilecpeglaqdvistigqafelrfkqylr...............................................
HGL_H00000219865    liaqsigqafsvayqeflr...........................................................
HGL_H00000391942    ..............................................................................
HGL_H00000341737    ..............................................................................
HGL_H00000364995    leccdglaqdvigsigqafelrfkqylq..................................................
HGL_H00000308176    ..............................................................................
HGL_H00000381854    nfvskvmi......................................................................
HGL_H00000280665    ..............................................................................
HGL_H00000171887    aivnfvskvml...................................................................
HGL_H00000320828    c.............................................................................
HGL_H00000319756    tfitkvllgq....................................................................
HGL_H00000005587    ..............................................................................
HGL_H00000334382    rlakeksqekmeltstpsqesaggdlqsplt...............................................
HGL_H00000329668    rfkqylr.......................................................................
HGL_H00000305632-2  eksqekietssnhsqass............................................................
HGL_H00000398560-2  kkaeqkqrwlkafsrereqvrldqetgfsitemqrkqamln.....................................
HGL_H00000364004-2  kkleekirwlrafreerkmvqedekigfeisenqkrqaam......................................
HGL_H00000331381    ..............................................................................
HGL_H00000283195    alfkckfeeaqs..................................................................
HGL_H00000370912-2  nimikyhpkfwadgsyqccrqteklapgceky..............................................
HGL_H00000245932    ..............................................................................
HGL_H00000344220    ..............................................................................
HGL_H00000315136    lr............................................................................
HGL_H00000264554    felrfkqyl.....................................................................
HGL_H00000398655    csqmeklavgcahyd...............................................................
HGL_H00000348150    ggelsspalglmshqvppspl.........................................................
HGL_H00000338934-1  ekhqkqlerqqletekkrretverekeqmlre..............................................
HGL_H00000353518    afevayqlal....................................................................
HGL_H00000345752-1  nlmkyafpvsnnlslfafeyk.........................................................
HGL_H00000386867-1  ..............................................................................
HGL_H00000283195    ..............................................................................
HGL_H00000374195    nghwlccrassdtaagcspct.........................................................
HGL_H00000420773    ..............................................................................
HGL_H00000398560-1  derrqvqedremgmeipenqkklamln...................................................
HGL_H00000347169-1  afaaclerkq....................................................................
HGL_H00000384136-2  eekhqkqleraqlenekkkreiaekeker.................................................
HGL_H00000353408    aekhqkqmerallenekkkremaekekeki................................................
HGL_H00000254051    lvvallq.......................................................................
HGL_H00000363458    wqaakeeke.....................................................................
HGL_H00000283195    eefkqkfeecq...................................................................
HGL_H00000252891    faaclerkqrreke................................................................
HGL_H00000308774    fvdgkflccqqsckaapgctl.........................................................
HGL_H00000318965-3  k.............................................................................
HGL_H00000264042    ssfrysgrtqkqlvdyikdggmkripyerwhsk.............................................
HGL_H00000391677    wlccqetsestpgckpct............................................................
HGL_H00000344666    reekarkqmerqrlarekqmreeaertrdel...............................................
HGL_H00000319831    ttsrtyemsasdtrqrqewtaaiqtairl.................................................
HGL_H00000359423-2  tltrhafplahslplfafln..........................................................
HGL_H00000322926    rfsgrtqkqvldyvkegghkkvqferkhsk................................................
HGL_H00000305632-1  eksqekmepsnnhsqas.............................................................
HGL_H00000355133    vchklslqh.....................................................................
HGL_H00000381083    levprtpr......................................................................
HGL_H00000304701    ..............................................................................
HGL_H00000334105    lrsiihnfrann..................................................................
HGL_H00000315630    sasdkkkkqewiqaihst............................................................
HGL_H00000360275    elekk.........................................................................
HGL_H00000357110    kfrysgrtqaqtrqastlidrpaphfdrtsskr.............................................
HGL_H00000341138    frysgrtqaqtrrasalidrpapyferssskr..............................................
HGL_H00000339184    rtqaqtrqasalidrpapfferssskr...................................................
HGL_H00000283195    ..............................................................................
HGL_H00000359417    ..............................................................................
HGL_H00000387784    ..............................................................................
HGL_H00000263713    arrsasferrpsk.................................................................
HGL_H00000362904    kfrysgrtqaqtrqasalidrpaphfertaskr.............................................
HGL_H00000201647    ..............................................................................
HGL_H00000364754    ..............................................................................
HGL_H00000357177    kniwmelleeavr.................................................................
HGL_H00000367394    vaqtvserknwcaliteta...........................................................
HGL_H00000358820    ..............................................................................
HGL_H00000241014    ykqfv.........................................................................
HGL_H00000313391    ynvkkkeeekkk..................................................................
HGL_H00000217381    ..............................................................................
HGL_H00000278412-3  ieitfvnfacgtttthsfdfeintkqgtqytfgsiereey......................................
HGL_H00000368824    ..............................................................................
HGL_H00000363694    frfsgrteyqathgar..............................................................
HGL_H00000338191    ..............................................................................
HGL_H00000390595    ..............................................................................
HGL_H00000349259    ..............................................................................
HGL_H00000352995-2  ravesc........................................................................
HGL_H00000299084    ..............................................................................
HGL_H00000216373    ..............................................................................
HGL_H00000378649    ..............................................................................
HGL_H00000362109    ..............................................................................
HGL_H00000303508-1  sskiqreppevhrinitq............................................................
HGL_H00000365891    ..............................................................................
HGL_H00000265963    ..............................................................................
HGL_N10018877       qvetekkrregverenq.............................................................
HGL_H00000338171    ..............................................................................
HGL_H00000341483    gvkvflisasskdtgqlyaalhhrilalrs................................................
HGL_H00000403067    kreppeihrag...................................................................
HGL_H00000330572    ..............................................................................
HGL_H00000394751    ..............................................................................
HGL_H00000402046    agvrtyffsaespeeqeawiqamgeaar..................................................
HGL_H00000374557    akniatslheicskal..............................................................
HGL_H00000261486    rsrsk.........................................................................
HGL_H00000363371-2  ..............................................................................
HGL_H00000376247    ikcikaaisrdpf.................................................................
HGL_H00000318965-3  iatslheicskimae...............................................................
HGL_H00000384136-1  rtqle.........................................................................
HGL_H00000372160    ..............................................................................
HGL_H00000352995-1  aveg..........................................................................
HGL_H00000359610    ..............................................................................
HGL_H00000374557    cmlryqk.......................................................................
HGL_H00000234179    m.............................................................................
HGL_H00000262539    liggmvwnpamrrslsve............................................................
HGL_H00000364893    ..............................................................................
HGL_H00000391648-1  ksiqaavsv.....................................................................
HGL_H00000379967-1  wmksikasisrdpfy...............................................................
HGL_H00000353646    ..............................................................................
HGL_H00000279230    ..............................................................................
HGL_H00000304895    ram...........................................................................
HGL_H00000330276    qlhynghytepyassq..............................................................
HGL_H00000233668    ..............................................................................
HGL_H00000416895    sgmrtyyfsadtledmnawvramnqaaq..................................................
HGL_H00000394487    rnaiakdndihsevstaelgkrapr.....................................................
HGL_H00000345405    ..............................................................................
HGL_H00000386800-1  ..............................................................................
HGL_H00000408285-1  ..............................................................................
HGL_H00000393860    ..............................................................................
HGL_H00000260402    edvlalakhplian................................................................
HGL_H00000311489    ..............................................................................
HGL_H00000263265    aadtledlrgwlralgras...........................................................
HGL_H00000353109    nireviqeriihl.................................................................
HGL_H00000288368    fvcmaktpeekhewfeailkerer......................................................
HGL_H00000344277    ..............................................................................
HGL_H00000262593    ..............................................................................
HGL_H00000401303-2  vqsisfvsggdpdtad..............................................................
HGL_H00000322926    ..............................................................................
HGL_H00000339299    tsrtgdvvetfilhssspsvrqtwiheinqilenqrnfl.......................................
HGL_H00000378183    ..............................................................................
HGL_H00000381549    diamdltetgmqrasklvtleakshfimasn...............................................
HGL_H00000376652-2  ..............................................................................
HGL_H00000276420    ..............................................................................
HGL_H00000302269    yq............................................................................
HGL_H00000296604    alr...........................................................................
HGL_H00000248901    dqwieaiqasitrvpfy.............................................................
HGL_H00000370719    kk............................................................................
HGL_H00000359073    kvcqmllrgtfyq.................................................................
HGL_H00000298694    ..............................................................................
HGL_H00000360916    kananhhsfqmytfdkttsckacrmflrgtfyq.............................................
HGL_H00000263373    ..............................................................................
HGL_H00000374373    ..............................................................................
HGL_H00000264042    ..............................................................................
HGL_H00000335560    rdfl..........................................................................
HGL_H00000352232    ..............................................................................
HGL_H00000261439-2  immtlkqaftvaavq...............................................................
HGL_H00000282406    ..............................................................................
HGL_H00000379709    ..............................................................................
HGL_H00000364631    rafsstc.......................................................................
HGL_H00000353109    ..............................................................................
HGL_H00000356297    ilemdaihhpg...................................................................
HGL_H00000410689    itqqgtdplvlavqskeqaeqwlkvikea.................................................
HGL_H00000391995    dlidgycrlqgehkgslilhp.........................................................
HGL_H00000412461    irrviwa.......................................................................
HGL_H00000357298    ..............................................................................
HGL_H00000256190    mdriqsci......................................................................
HGL_H00000354718    tin...........................................................................
HGL_H00000349727    cplpratsmp....................................................................
HGL_H00000379527    tvkelsvpqhlsllpgqvirlhevlekekkrr..............................................
HGL_H00000264042    qaaks.........................................................................
HGL_H00000346378    wcqphagglseavqaacmvqyqk.......................................................
HGL_H00000367299-1  w.............................................................................
HGL_H00000330278    ..............................................................................
HGL_H00000361202    ..............................................................................
HGL_H00000262940    pgvfrgdkwscchqkdrtdrgcdkt.....................................................
HGL_H00000409493    ..............................................................................
HGL_H00000389787    ..............................................................................
HGL_H00000285094    ..............................................................................
HGL_H00000296414    ..............................................................................
HGL_H00000409572    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000364277    ainstllkheqt..................................................................
HGL_H00000234313    ..............................................................................
HGL_H00000395986    qyicyvfqcaseslvdevmltlkqafstaa................................................
HGL_H00000324287    ..............................................................................
HGL_H00000264057    ysmdhfsgthnwyacsharpt.........................................................
HGL_H00000396185-1  dlvansveeaqtwmqglqllv.........................................................
HGL_H00000346378    glcaqilservris................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000366977    ..............................................................................
HGL_H00000304895    iaadseaeqdswyqallq............................................................
HGL_H00000399903    ..............................................................................
HGL_H00000346733    ..............................................................................
HGL_H00000386911    ..............................................................................
HGL_H00000322926    ediqmaidla....................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000336522    aqdvpsaqqwvdriqscl............................................................
HGL_H00000402861    v.............................................................................
HGL_H00000312262    dayreaqqlvqrvpkm..............................................................
HGL_H00000367747    ..............................................................................
HGL_H00000250617    leqlsrlt......................................................................
HGL_H00000288266    icdsvglakqialhaeldrr..........................................................
HGL_H00000352721    ..............................................................................
HGL_H00000351969    ..............................................................................
HGL_H00000020673    ..............................................................................
HGL_H00000366843    asfhylrlvvreleqqlaam..........................................................
HGL_H00000158762    ..............................................................................
HGL_H00000274710    ..............................................................................
HGL_H00000362751    ..............................................................................
HGL_H00000276185    ..............................................................................
HGL_H00000407267    mlpqeya.......................................................................
HGL_H00000251507    ..............................................................................
HGL_H00000245796    ..............................................................................
HGL_H00000316029    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000276204    ..............................................................................
HGL_H00000371397    ..............................................................................
HGL_H00000366284    ndkdmndwlyafn.................................................................
HGL_H00000285046    asaaqrwmeamedas...............................................................
HGL_H00000343899    rsrasg........................................................................
HGL_H00000362014    ..............................................................................
HGL_H00000328118    ..............................................................................
HGL_H00000405405    ..............................................................................
HGL_H00000303476    ..............................................................................
HGL_H00000384312    ..............................................................................
HGL_H00000274376    ..............................................................................
HGL_H00000328800    ..............................................................................
HGL_H00000339299    ..............................................................................
HGL_H00000354611    ..............................................................................
HGL_H00000349298    ..............................................................................
HGL_H00000317786    ..............................................................................
HGL_H00000394225    ..............................................................................
HGL_H00000292140    mdvivtaad.....................................................................
HGL_H00000345988    ylm...........................................................................
HGL_H00000386733    ..............................................................................
HGL_H00000234313    ..............................................................................
HGL_H00000362405    gillqassdkdmhdwlyafn..........................................................
HGL_H00000417003    raqewmealktaan................................................................
HGL_H00000379967-2  ksikasisrvpfy.................................................................
HGL_H00000317912    ..............................................................................
HGL_M00000071081-2  ..............................................................................
HGL_M00000071081-1  ..............................................................................
HGL_H00000388152    ..............................................................................
HGL_H00000285046    vpe...........................................................................
HGL_H00000318965-1  ..............................................................................
HGL_H00000258390    ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000394487    sfkltqsksvhsfaadseelkqkwlkiill................................................
HGL_H00000354919-1  ..............................................................................
HGL_H00000366995    ..............................................................................
HGL_H00000344961    svfglrnafliqhenryrqciaafllqaqmendkkawiaqltaaisc...............................
HGL_H00000388152    ..............................................................................
HGL_N10025555       ..............................................................................
HGL_H00000288266    ..............................................................................
HGL_H00000373214    myratgqshkpvpptqvqk...........................................................
HGL_H00000295888    ..............................................................................
HGL_H00000385609    ..............................................................................
HGL_H00000386800-1  ..............................................................................
HGL_H00000345895    ..............................................................................
HGL_H00000399588    ..............................................................................
HGL_H00000364277    ..............................................................................
HGL_H00000391106    dskapidtptqqliq...............................................................
HGL_H00000262995    ..............................................................................
HGL_H00000398481    gqsykpipaiqtqkl...............................................................
HGL_H00000317786    prtnkqnqkkkrkvepptpqepgpakvavtsn..............................................
HGL_H00000376700    dqaeqwlrviqevs................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000281419    ..............................................................................
HGL_H00000339381    ..............................................................................
HGL_H00000263650    sesdgrcwldalelalr.............................................................
HGL_H00000393860    ..............................................................................
HGL_H00000302895    pagkerkrsitknpkigglplipiqhe...................................................
HGL_H00000296721    rwlgll........................................................................
HGL_H00000318965-1  ..............................................................................
HGL_H00000347244    wrpkwtawvqkikaaseqyidtekrk....................................................
HGL_H00000296721    qsreqaeewlkvirevs.............................................................
HGL_H00000313731    argldkl.......................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000261729    ..............................................................................
HGL_H00000410689    ..............................................................................
HGL_H00000348828    vlnnhanekvemllgaetqserarwitalghssgkqp.........................................
HGL_H00000347134    shtlqandvfhkqqwfncirtai.......................................................
HGL_H00000415034    ..............................................................................
HGL_H00000386331    ..............................................................................
HGL_H00000330278    ..............................................................................
HGL_H00000350297    wisvltnskeealnmafrgeqsagen....................................................
HGL_H00000265748    ..............................................................................
HGL_H00000376700    ..............................................................................
HGL_H00000011684    lkktwea.......................................................................
HGL_H00000338769    nskdeal.......................................................................
HGL_H00000279227    ..............................................................................
HGL_H00000407746    ..............................................................................
HGL_H00000303909    ..............................................................................
HGL_H00000326706    ..............................................................................
HGL_H00000405963    ..............................................................................
HGL_H00000395182    inalnsaitraknrildevtvee.......................................................
HGL_H00000217289    ..............................................................................
HGL_H00000341071    ..............................................................................
HGL_H00000368719    ..............................................................................
HGL_H00000298542    ..............................................................................
HGL_H00000264051    edqgqtlanvfilrllenaddreatymlkassqsemkrwmtslapnrrt.............................
HGL_H00000364207    ..............................................................................
HGL_H00000279227    ..............................................................................
HGL_H00000286827    kkleqkidmdekmk................................................................
HGL_H00000396519    ..............................................................................
HGL_H00000345808-3  ..............................................................................
HGL_H00000367764    mgskgkiis.....................................................................
HGL_M00000082342    lemlqesgkvtwknaql.............................................................
HGL_H00000378262    ..............................................................................
HGL_H00000261439-1  afmaatvq......................................................................
HGL_H00000056217    eldllecydspqvqclray...........................................................
HGL_H00000221086    lmypffyr......................................................................
HGL_H00000274498    seedrrlwmeamd.................................................................
HGL_H00000342858-1  ..............................................................................
HGL_H00000320563    ..............................................................................
HGL_H00000311837    ..............................................................................
HGL_H00000346127    klflcaetrddavawktalleanatpvrvyspyqdyyevv......................................
HGL_H00000272666    ..............................................................................
HGL_H00000363371-1  ..............................................................................
HGL_H00000315410    vaklrhhrmfrqne................................................................
HGL_H00000282406    tvgag.........................................................................
HGL_H00000281172    ..............................................................................
HGL_H00000265080    eqdgkewmeaihqas...............................................................
HGL_H00000412733-1  ..............................................................................
HGL_H00000262593    ..............................................................................
HGL_H00000386800-2  ..............................................................................
HGL_H00000356655    ..............................................................................
HGL_H00000407267    ..............................................................................
HGL_H00000403323    ..............................................................................
HGL_H00000362369    ..............................................................................
HGL_H00000217289    rwmaacilask...................................................................
HGL_H00000336923    ..............................................................................
HGL_H00000411012-3  ..............................................................................
HGL_H00000180173-2  ..............................................................................
HGL_H00000342858-1  ..............................................................................
HGL_H00000386897    twhfeattyeerdawvqaiesqilaslqscess.............................................
HGL_H00000407163    av............................................................................
HGL_H00000256190    qsifstfafaa...................................................................
HGL_H00000303507    nireqqkkc.....................................................................
HGL_H00000354952    ..............................................................................
HGL_H00000411012-2  ..............................................................................
HGL_H00000312753    el............................................................................
HGL_H00000339769-3  ..............................................................................
HGL_H00000344277    ..............................................................................
HGL_H00000371221    yafsy.........................................................................
HGL_H00000362894    rkppl.........................................................................
HGL_H00000376293    sklrhhrlyrqne.................................................................
HGL_H00000406026    ..............................................................................
HGL_H00000259351    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000380413    dqwsmqhpaggtadvlssspklepppsphsnrkkhrwkksagnprpdgpssaaeeaeesfefvvvsltgqtwhfeast
HGL_H00000364631    ..............................................................................
HGL_H00000378262    ..............................................................................
HGL_H00000363617    ccddmrtlhqwvngiriakygkqly.....................................................
HGL_H00000378965    ..............................................................................
HGL_H00000263826-1  ermncsptsqid..................................................................
HGL_H00000298815    rklwleamd.....................................................................
HGL_H00000365411    ikylccddartlnqwvtgiriaky......................................................
HGL_H00000407834    ..............................................................................
HGL_H00000368719    ..............................................................................
HGL_H00000361009    ..............................................................................
HGL_H00000402299    ..............................................................................
HGL_H00000367638    slalai........................................................................
HGL_H00000411012-1  ..............................................................................
HGL_H00000371067    ..............................................................................
HGL_H00000356607    kqqvp.........................................................................
HGL_H00000339769-2  ..............................................................................
HGL_H00000342858-2  ..............................................................................
HGL_H00000254806    gaiefgqrm.....................................................................
HGL_H00000389913-1  qy............................................................................
HGL_H00000367629    qvllssdsaedsyavqdygqldhvqvrklepsepylpgggnrsssvphpfrvtllrnsegrqeqvllssdsasdrarw
HGL_H00000364550    ek............................................................................
HGL_H00000333568    ..............................................................................
HGL_H00000328160    lsrepppspmvkkqrrkklttpsktegaavqaeakrkmwklksfgslrniykaeenfeflivsstgqtwhfeaasfee
HGL_H00000391668    pqafqvsmaivqaraqssqtqqya......................................................
HGL_N10005278       ..............................................................................
HGL_H00000403459    fky...........................................................................
HGL_H00000260283    ..............................................................................
HGL_H00000258530    nlgk..........................................................................
HGL_H00000381793    afrllkygmllyqsyripq...........................................................
HGL_H00000372160    ..............................................................................
HGL_H00000377233    srvsravpevrlgsvsliplrgsenem...................................................
HGL_H00000377566    ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000405963    ..............................................................................
HGL_H00000325285    ..............................................................................
HGL_H00000315662    vteleqiriewe..................................................................
HGL_H00000338185    ..............................................................................
HGL_H00000283937    syqmdchaveceskleakklahammeafkktfhsmk..........................................
HGL_H00000201647    ..............................................................................
HGL_H00000265080    dfkivvepphaapftvvllapsrqekaawmsdisqcvdni......................................
HGL_H00000371577    sgiihhtqapkllkrlflfsy.........................................................
HGL_H00000342804    ..............................................................................
HGL_H00000417003    dwgqklwevvht..................................................................
HGL_H00000385326    rprpntfiirclqwttviertfhvetpeereewttaiqtvadglkrq...............................
HGL_H00000264276    ..............................................................................
HGL_H00000384651    ..............................................................................
HGL_H00000276420    ..............................................................................
HGL_H00000352336    ..............................................................................
HGL_H00000231487-8  ..............................................................................
HGL_H00000272430    ..............................................................................
HGL_H00000356278    ..............................................................................
HGL_H00000399532-2  ..............................................................................
HGL_H00000263847    ..............................................................................
HGL_H00000362409    kwqavlqdcvrhcn................................................................
HGL_H00000337572-2  ..............................................................................
HGL_H00000355026    qasslsdmqrwlgaf...............................................................
HGL_H00000363317    ..............................................................................
HGL_H00000378965    ..............................................................................
HGL_H00000382697    iptlyhfpanceacakplwhvfkpppalecrrchvkchrdhldkkedlispckvsydvtsardmlllacsqdeqkkwv
HGL_N10007969       ..............................................................................
HGL_H00000320291    ..............................................................................
HGL_H00000342793    ..............................................................................
HGL_H00000317985    lyhfptnceacmkplwhmfkpppalecrrchikchkdhldrkeeiivpckvyydistaknllllansteeqqrwvsrl
HGL_H00000317578    ..............................................................................
HGL_H00000391648-2  ..............................................................................
HGL_H00000407802    ..............................................................................
HGL_H00000369121    ccisr.........................................................................
HGL_H00000233668    gi............................................................................
HGL_H00000386183    ..............................................................................
HGL_H00000401910    an............................................................................
HGL_H00000259406    ..............................................................................
HGL_H00000377386    ..............................................................................
HGL_H00000377233    ..............................................................................
HGL_H00000361202    ..............................................................................
HGL_H00000345492    ..............................................................................
HGL_H00000376306    ..............................................................................
HGL_H00000349727    ..............................................................................
HGL_H00000345133    gsegererwlqvlgelq.............................................................
HGL_H00000377233    seqqlgdsdipvivyrcvdyitqcgltsegi...............................................
HGL_H00000270747    rwisalcps.....................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000355060    gkpdksgrpisfmvifitpnplskiswvnrlhlakiglreenqpgwlcpde...........................
HGL_H00000412733-6  ..............................................................................
HGL_H00000302895    ..............................................................................
HGL_H00000264818    ..............................................................................
HGL_H00000300584    ..............................................................................
HGL_H00000295095-2  ..............................................................................
HGL_H00000335341-1  ..............................................................................
HGL_H00000318075    ..............................................................................
HGL_H00000262719    ..............................................................................
HGL_H00000335341-2  ..............................................................................
HGL_H00000263674    ..............................................................................
HGL_H00000356621    ..............................................................................
HGL_H00000345808-1  ..............................................................................
HGL_H00000397663-5  ..............................................................................
HGL_H00000379804    ..............................................................................
HGL_H00000336522    rgtfaft.......................................................................
HGL_H00000358316    ..............................................................................
HGL_H00000391106    ..............................................................................
HGL_H00000216446    ..............................................................................
HGL_H00000234453-1  ..............................................................................
HGL_H00000258530    ..............................................................................
HGL_H00000378965    lsqwtrsivqgc..................................................................
HGL_H00000263088    ..............................................................................
HGL_H00000343204    ..............................................................................
HGL_H00000315334    ..............................................................................
HGL_H00000339769-4  ..............................................................................
HGL_H00000348611    ..............................................................................
HGL_H00000389913-1  evlasyleaae...................................................................
HGL_H00000264554    ..............................................................................
HGL_H00000311837    afqkatf.......................................................................
HGL_H00000342858-4  ..............................................................................
HGL_H00000007414    ..............................................................................
HGL_H00000381571    aadrcriqlqlpgkqdksgrptfftavfntftpaikeawtsnlqmaklaleednh.......................
HGL_H00000293349    ..............................................................................
HGL_H00000342804    ..............................................................................


                                               
                                               
d1mi1a2               .........................
HGL_H00000278412-1  .........................
HGL_H00000278412-2  .........................
HGL_H00000286827    .........................
HGL_H00000407746    .........................
HGL_H00000401303-1  .........................
HGL_H00000265381    .........................
HGL_H00000413502    .........................
HGL_H00000401303-3  .........................
HGL_H00000219865    .........................
HGL_H00000391942    .........................
HGL_H00000341737    .........................
HGL_H00000364995    .........................
HGL_H00000308176    .........................
HGL_H00000381854    .........................
HGL_H00000280665    .........................
HGL_H00000171887    .........................
HGL_H00000320828    .........................
HGL_H00000319756    .........................
HGL_H00000005587    .........................
HGL_H00000334382    .........................
HGL_H00000329668    .........................
HGL_H00000305632-2  .........................
HGL_H00000398560-2  .........................
HGL_H00000364004-2  .........................
HGL_H00000331381    .........................
HGL_H00000283195    .........................
HGL_H00000370912-2  .........................
HGL_H00000245932    .........................
HGL_H00000344220    .........................
HGL_H00000315136    .........................
HGL_H00000264554    .........................
HGL_H00000398655    .........................
HGL_H00000348150    .........................
HGL_H00000338934-1  .........................
HGL_H00000353518    .........................
HGL_H00000345752-1  .........................
HGL_H00000386867-1  .........................
HGL_H00000283195    .........................
HGL_H00000374195    .........................
HGL_H00000420773    .........................
HGL_H00000398560-1  .........................
HGL_H00000347169-1  .........................
HGL_H00000384136-2  .........................
HGL_H00000353408    .........................
HGL_H00000254051    .........................
HGL_H00000363458    .........................
HGL_H00000283195    .........................
HGL_H00000252891    .........................
HGL_H00000308774    .........................
HGL_H00000318965-3  .........................
HGL_H00000264042    .........................
HGL_H00000391677    .........................
HGL_H00000344666    .........................
HGL_H00000319831    .........................
HGL_H00000359423-2  .........................
HGL_H00000322926    .........................
HGL_H00000305632-1  .........................
HGL_H00000355133    .........................
HGL_H00000381083    .........................
HGL_H00000304701    .........................
HGL_H00000334105    .........................
HGL_H00000315630    .........................
HGL_H00000360275    .........................
HGL_H00000357110    .........................
HGL_H00000341138    .........................
HGL_H00000339184    .........................
HGL_H00000283195    .........................
HGL_H00000359417    .........................
HGL_H00000387784    .........................
HGL_H00000263713    .........................
HGL_H00000362904    .........................
HGL_H00000201647    .........................
HGL_H00000364754    .........................
HGL_H00000357177    .........................
HGL_H00000367394    .........................
HGL_H00000358820    .........................
HGL_H00000241014    .........................
HGL_H00000313391    .........................
HGL_H00000217381    .........................
HGL_H00000278412-3  .........................
HGL_H00000368824    .........................
HGL_H00000363694    .........................
HGL_H00000338191    .........................
HGL_H00000390595    .........................
HGL_H00000349259    .........................
HGL_H00000352995-2  .........................
HGL_H00000299084    .........................
HGL_H00000216373    .........................
HGL_H00000378649    .........................
HGL_H00000362109    .........................
HGL_H00000303508-1  .........................
HGL_H00000365891    .........................
HGL_H00000265963    .........................
HGL_N10018877       .........................
HGL_H00000338171    .........................
HGL_H00000341483    .........................
HGL_H00000403067    .........................
HGL_H00000330572    .........................
HGL_H00000394751    .........................
HGL_H00000402046    .........................
HGL_H00000374557    .........................
HGL_H00000261486    .........................
HGL_H00000363371-2  .........................
HGL_H00000376247    .........................
HGL_H00000318965-3  .........................
HGL_H00000384136-1  .........................
HGL_H00000372160    .........................
HGL_H00000352995-1  .........................
HGL_H00000359610    .........................
HGL_H00000374557    .........................
HGL_H00000234179    .........................
HGL_H00000262539    .........................
HGL_H00000364893    .........................
HGL_H00000391648-1  .........................
HGL_H00000379967-1  .........................
HGL_H00000353646    .........................
HGL_H00000279230    .........................
HGL_H00000304895    .........................
HGL_H00000330276    .........................
HGL_H00000233668    .........................
HGL_H00000416895    .........................
HGL_H00000394487    .........................
HGL_H00000345405    .........................
HGL_H00000386800-1  .........................
HGL_H00000408285-1  .........................
HGL_H00000393860    .........................
HGL_H00000260402    .........................
HGL_H00000311489    .........................
HGL_H00000263265    .........................
HGL_H00000353109    .........................
HGL_H00000288368    .........................
HGL_H00000344277    .........................
HGL_H00000262593    .........................
HGL_H00000401303-2  .........................
HGL_H00000322926    .........................
HGL_H00000339299    .........................
HGL_H00000378183    .........................
HGL_H00000381549    .........................
HGL_H00000376652-2  .........................
HGL_H00000276420    .........................
HGL_H00000302269    .........................
HGL_H00000296604    .........................
HGL_H00000248901    .........................
HGL_H00000370719    .........................
HGL_H00000359073    .........................
HGL_H00000298694    .........................
HGL_H00000360916    .........................
HGL_H00000263373    .........................
HGL_H00000374373    .........................
HGL_H00000264042    .........................
HGL_H00000335560    .........................
HGL_H00000352232    .........................
HGL_H00000261439-2  .........................
HGL_H00000282406    .........................
HGL_H00000379709    .........................
HGL_H00000364631    .........................
HGL_H00000353109    .........................
HGL_H00000356297    .........................
HGL_H00000410689    .........................
HGL_H00000391995    .........................
HGL_H00000412461    .........................
HGL_H00000357298    .........................
HGL_H00000256190    .........................
HGL_H00000354718    .........................
HGL_H00000349727    .........................
HGL_H00000379527    .........................
HGL_H00000264042    .........................
HGL_H00000346378    .........................
HGL_H00000367299-1  .........................
HGL_H00000330278    .........................
HGL_H00000361202    .........................
HGL_H00000262940    .........................
HGL_H00000409493    .........................
HGL_H00000389787    .........................
HGL_H00000285094    .........................
HGL_H00000296414    .........................
HGL_H00000409572    .........................
HGL_H00000377233    .........................
HGL_H00000364277    .........................
HGL_H00000234313    .........................
HGL_H00000395986    .........................
HGL_H00000324287    .........................
HGL_H00000264057    .........................
HGL_H00000396185-1  .........................
HGL_H00000346378    .........................
HGL_H00000391106    .........................
HGL_H00000366977    .........................
HGL_H00000304895    .........................
HGL_H00000399903    .........................
HGL_H00000346733    .........................
HGL_H00000386911    .........................
HGL_H00000322926    .........................
HGL_H00000377233    .........................
HGL_H00000336522    .........................
HGL_H00000402861    .........................
HGL_H00000312262    .........................
HGL_H00000367747    .........................
HGL_H00000250617    .........................
HGL_H00000288266    .........................
HGL_H00000352721    .........................
HGL_H00000351969    .........................
HGL_H00000020673    .........................
HGL_H00000366843    .........................
HGL_H00000158762    .........................
HGL_H00000274710    .........................
HGL_H00000362751    .........................
HGL_H00000276185    .........................
HGL_H00000407267    .........................
HGL_H00000251507    .........................
HGL_H00000245796    .........................
HGL_H00000316029    .........................
HGL_H00000216446    .........................
HGL_H00000276204    .........................
HGL_H00000371397    .........................
HGL_H00000366284    .........................
HGL_H00000285046    .........................
HGL_H00000343899    .........................
HGL_H00000362014    .........................
HGL_H00000328118    .........................
HGL_H00000405405    .........................
HGL_H00000303476    .........................
HGL_H00000384312    .........................
HGL_H00000274376    .........................
HGL_H00000328800    .........................
HGL_H00000339299    .........................
HGL_H00000354611    .........................
HGL_H00000349298    .........................
HGL_H00000317786    .........................
HGL_H00000394225    .........................
HGL_H00000292140    .........................
HGL_H00000345988    .........................
HGL_H00000386733    .........................
HGL_H00000234313    .........................
HGL_H00000362405    .........................
HGL_H00000417003    .........................
HGL_H00000379967-2  .........................
HGL_H00000317912    .........................
HGL_M00000071081-2  .........................
HGL_M00000071081-1  .........................
HGL_H00000388152    .........................
HGL_H00000285046    .........................
HGL_H00000318965-1  .........................
HGL_H00000258390    .........................
HGL_H00000258530    .........................
HGL_H00000394487    .........................
HGL_H00000354919-1  .........................
HGL_H00000366995    .........................
HGL_H00000344961    .........................
HGL_H00000388152    .........................
HGL_N10025555       .........................
HGL_H00000288266    .........................
HGL_H00000373214    .........................
HGL_H00000295888    .........................
HGL_H00000385609    .........................
HGL_H00000386800-1  .........................
HGL_H00000345895    .........................
HGL_H00000399588    .........................
HGL_H00000364277    .........................
HGL_H00000391106    .........................
HGL_H00000262995    .........................
HGL_H00000398481    .........................
HGL_H00000317786    .........................
HGL_H00000376700    .........................
HGL_H00000216446    .........................
HGL_H00000281419    .........................
HGL_H00000339381    .........................
HGL_H00000263650    .........................
HGL_H00000393860    .........................
HGL_H00000302895    .........................
HGL_H00000296721    .........................
HGL_H00000318965-1  .........................
HGL_H00000347244    .........................
HGL_H00000296721    .........................
HGL_H00000313731    .........................
HGL_H00000302895    .........................
HGL_H00000261729    .........................
HGL_H00000410689    .........................
HGL_H00000348828    .........................
HGL_H00000347134    .........................
HGL_H00000415034    .........................
HGL_H00000386331    .........................
HGL_H00000330278    .........................
HGL_H00000350297    .........................
HGL_H00000265748    .........................
HGL_H00000376700    .........................
HGL_H00000011684    .........................
HGL_H00000338769    .........................
HGL_H00000279227    .........................
HGL_H00000407746    .........................
HGL_H00000303909    .........................
HGL_H00000326706    .........................
HGL_H00000405963    .........................
HGL_H00000395182    .........................
HGL_H00000217289    .........................
HGL_H00000341071    .........................
HGL_H00000368719    .........................
HGL_H00000298542    .........................
HGL_H00000264051    .........................
HGL_H00000364207    .........................
HGL_H00000279227    .........................
HGL_H00000286827    .........................
HGL_H00000396519    .........................
HGL_H00000345808-3  .........................
HGL_H00000367764    .........................
HGL_M00000082342    .........................
HGL_H00000378262    .........................
HGL_H00000261439-1  .........................
HGL_H00000056217    .........................
HGL_H00000221086    .........................
HGL_H00000274498    .........................
HGL_H00000342858-1  .........................
HGL_H00000320563    .........................
HGL_H00000311837    .........................
HGL_H00000346127    .........................
HGL_H00000272666    .........................
HGL_H00000363371-1  .........................
HGL_H00000315410    .........................
HGL_H00000282406    .........................
HGL_H00000281172    .........................
HGL_H00000265080    .........................
HGL_H00000412733-1  .........................
HGL_H00000262593    .........................
HGL_H00000386800-2  .........................
HGL_H00000356655    .........................
HGL_H00000407267    .........................
HGL_H00000403323    .........................
HGL_H00000362369    .........................
HGL_H00000217289    .........................
HGL_H00000336923    .........................
HGL_H00000411012-3  .........................
HGL_H00000180173-2  .........................
HGL_H00000342858-1  .........................
HGL_H00000386897    .........................
HGL_H00000407163    .........................
HGL_H00000256190    .........................
HGL_H00000303507    .........................
HGL_H00000354952    .........................
HGL_H00000411012-2  .........................
HGL_H00000312753    .........................
HGL_H00000339769-3  .........................
HGL_H00000344277    .........................
HGL_H00000371221    .........................
HGL_H00000362894    .........................
HGL_H00000376293    .........................
HGL_H00000406026    .........................
HGL_H00000259351    .........................
HGL_H00000302895    .........................
HGL_H00000380413    aeerelwvqsvqaqilaslqgcrsa
HGL_H00000364631    .........................
HGL_H00000378262    .........................
HGL_H00000363617    .........................
HGL_H00000378965    .........................
HGL_H00000263826-1  .........................
HGL_H00000298815    .........................
HGL_H00000365411    .........................
HGL_H00000407834    .........................
HGL_H00000368719    .........................
HGL_H00000361009    .........................
HGL_H00000402299    .........................
HGL_H00000367638    .........................
HGL_H00000411012-1  .........................
HGL_H00000371067    .........................
HGL_H00000356607    .........................
HGL_H00000339769-2  .........................
HGL_H00000342858-2  .........................
HGL_H00000254806    .........................
HGL_H00000389913-1  .........................
HGL_H00000367629    italtyqesq...............
HGL_H00000364550    .........................
HGL_H00000333568    .........................
HGL_H00000328160    rdawvqaiesqilaslqcce.....
HGL_H00000391668    .........................
HGL_N10005278       .........................
HGL_H00000403459    .........................
HGL_H00000260283    .........................
HGL_H00000258530    .........................
HGL_H00000381793    .........................
HGL_H00000372160    .........................
HGL_H00000377233    .........................
HGL_H00000377566    .........................
HGL_H00000302895    .........................
HGL_H00000405963    .........................
HGL_H00000325285    .........................
HGL_H00000315662    .........................
HGL_H00000338185    .........................
HGL_H00000283937    .........................
HGL_H00000201647    .........................
HGL_H00000265080    .........................
HGL_H00000371577    .........................
HGL_H00000342804    .........................
HGL_H00000417003    .........................
HGL_H00000385326    .........................
HGL_H00000264276    .........................
HGL_H00000384651    .........................
HGL_H00000276420    .........................
HGL_H00000352336    .........................
HGL_H00000231487-8  .........................
HGL_H00000272430    .........................
HGL_H00000356278    .........................
HGL_H00000399532-2  .........................
HGL_H00000263847    .........................
HGL_H00000362409    .........................
HGL_H00000337572-2  .........................
HGL_H00000355026    .........................
HGL_H00000363317    .........................
HGL_H00000378965    .........................
HGL_H00000382697    thlvkkipknp..............
HGL_N10007969       .........................
HGL_H00000320291    .........................
HGL_H00000342793    .........................
HGL_H00000317985    vkkipk...................
HGL_H00000317578    .........................
HGL_H00000391648-2  .........................
HGL_H00000407802    .........................
HGL_H00000369121    .........................
HGL_H00000233668    .........................
HGL_H00000386183    .........................
HGL_H00000401910    .........................
HGL_H00000259406    .........................
HGL_H00000377386    .........................
HGL_H00000377233    .........................
HGL_H00000361202    .........................
HGL_H00000345492    .........................
HGL_H00000376306    .........................
HGL_H00000349727    .........................
HGL_H00000345133    .........................
HGL_H00000377233    .........................
HGL_H00000270747    .........................
HGL_H00000391106    .........................
HGL_H00000355060    .........................
HGL_H00000412733-6  .........................
HGL_H00000302895    .........................
HGL_H00000264818    .........................
HGL_H00000300584    .........................
HGL_H00000295095-2  .........................
HGL_H00000335341-1  .........................
HGL_H00000318075    .........................
HGL_H00000262719    .........................
HGL_H00000335341-2  .........................
HGL_H00000263674    .........................
HGL_H00000356621    .........................
HGL_H00000345808-1  .........................
HGL_H00000397663-5  .........................
HGL_H00000379804    .........................
HGL_H00000336522    .........................
HGL_H00000358316    .........................
HGL_H00000391106    .........................
HGL_H00000216446    .........................
HGL_H00000234453-1  .........................
HGL_H00000258530    .........................
HGL_H00000378965    .........................
HGL_H00000263088    .........................
HGL_H00000343204    .........................
HGL_H00000315334    .........................
HGL_H00000339769-4  .........................
HGL_H00000348611    .........................
HGL_H00000389913-1  .........................
HGL_H00000264554    .........................
HGL_H00000311837    .........................
HGL_H00000342858-4  .........................
HGL_H00000007414    .........................
HGL_H00000381571    .........................
HGL_H00000293349    .........................
HGL_H00000342804    .........................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0048159 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Synechococcus elongatus PCC 7942
NoYes   Rivularia sp. PCC 7116
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Streptosporangium roseum DSM 43021
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces scabiei 87.22
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megamonas hypermegale
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Faecalibacterium prausnitzii
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Acetobacterium woodii DSM 1030
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium lentocellum DSM 5427
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium tetani E88
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Enterococcus sp. 7L76
NoYes   Weissella koreensis KACC 15510
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria innocua Clip11262
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Gramella forsetii KT0803
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Polaribacter sp. MED152
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Geobacillus sp. JF8
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Pelobacter propionicus DSM 2379
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Mesorhizobium sp. BNC1
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Photobacterium profundum SS9
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Pyrococcus yayanosii CH1
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechococcus elongatus PCC 6301
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Anabaena cylindrica PCC 7122
NoYes   Streptomyces albus J1074
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis orientalis HCCB10007
NoYes