SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Sialidases alignments

These alignments are sequences aligned to the 0046491 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1e8ua_ g...........................................................................................
d1ms9a2 apgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsr
d1nsca_ epewtyprlscqgstfqkallisphrfgeargnsapliirepfiacgpkeckhfalthyaaqpggyyngtredrnklrhlisvklgkiptve
d1so7a_ lpvlqkesvfqsgahayripallylpgqqsllafaeqraskkdehaelivlrrgdydapthqvqwqaqevvaqarldghrsmnpcplydaqt
d1v0ea1 sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqplyyaseefvqgelfkitdtpyynawpqdkafvy
d1v3ea_ ithdvgik....................................................................................
d1w0pa3 vifrgpdripsivassvtpgvvtafaekrvgggdpgalsntndiitrtsrdggitwdtelnlteqinvsdefdfsdprpiydpssntvlvsy
d1w8oa3 geplyteqdlavngregfpnyripaltvtpdgdllasydgrptgigapgpnsilqrrstdggrtwgeqqvvsagqttapikgfsdpsylvdr
d1z4va_ i...........................................................................................
d2aepa1 eyrnwskpqckitgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttlnnrhsndtvhdrtpyrtllmnelgvpfhlgtkqv
d2htua_ tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllndkhsngtvkdrspfrtlmsvevgqspnvyqarf
d2slia2 genifyagdvtesnyfripslltlstgtvisaadaryggthdskskiniafakstdggntwseptlplkfddyiaknidwprdsvgknvqiq
d3sila_ eksvvfkaegehftdqkgntivgsgsggttkyfripamcttskgtivvfadarhntasdqsfidtaaarstdggktwnkkiaiyndrvnskl
d4cpzb_ epewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpneckhfalthyaaqpggyyngtrgdrnklrhlisvklgkiptve
d4gezb_ ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqhllntsmeweeslyktpigsastlstsemilpg
d4mc7a_ atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygtttnfadlivseqmnvysvklgdpptpdklkfea
d4yz5a2 ghliytandttgsnyfripvlytfsngrvfssidaryggthdflnkiniatsysddngktwtkpkltlafddfapvplewprevggrdlqis
d5nopa_ ttikpieypkpdgcnrtgdhftmepg..................................................................


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 vvdptvivkgnklyvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagvaiva
d1nsca_ nsifhmaawsgsachdgrewtyigvdgpdsnalikikygeaytdtyhsyannilrtqesacn..............................
d1so7a_ gtlflffiaipgqvteqqqlqtranvtrlcqvtstdhgrtwssprdltdaaigpayrewstfavgpghclqlndrarslvvp..........
d1v0ea1 enviyapymgsdrhgvsrlhvswvksgddgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpmsrslh
d1v3ea_ ............................................................................................
d1w0pa3 arwptdaaqngdrikpwmpngifysvydvasgnwqapixvnpgpghgitltrqqnisgsqn...............................
d1w8oa3 etgtifnfhvysqrqgfagsrpgtdpadpnvlhanvatstdggltwshrtitaditpdpgwrsrfaasgeg.....................
d1z4va_ ............................................................................................
d2aepa1 ciawsssschdgkawlhvcvtghdenatasfiydgrlvdsigswskkilrtqesecvcingtctvvmtdgsasgradtkilfieegkivhis
d2htua_ eavawsatachdgkkwmtvgvtgpdskavavihyggvptdvvnsw...............................................
d2slia2 gsasyidpvlledkltkriflfadlmpagigssnasvgsgfkevngkkylklrwhkdagraydytirekgviyndatnqptefrvdgeynly
d3sila_ srvmdptcivaniqgretilvmvgkwnnndktwgayrdkapdtdwdlvlykstddgvtfskvetni..........................
d4cpzb_ nsifhmaawsgsachdgkewtyigvdgpdndallkvkygeaytdtyhsyankllrtqesacnci............................
d4gezb_ rsssacfdglkwtvlvangrdrnsfimikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsv..................
d4mc7a_ vgwsasschdgfqwtvlsvagdgfvsi.................................................................
d4yz5a2 ggatyidsvivekknkqvlmfadvmpagvsfreatrkdsgykqidgnyylklrkqgdtdynytirengtvyddrtnrptefsvdknfgikqn
d5nopa_ ............................................................................................


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 sngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgps
d1nsca_ ............................................................................................
d1so7a_ ............................................................................................
d1v0ea1 ltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftvltpnqqtsdlnnagknwhmgtsfhkspwrktdlgli
d1v3ea_ ............................................................................................
d1w0pa3 ............................................................................................
d1w8oa3 ............................................................................................
d1z4va_ ............................................................................................
d2aepa1 plsgsaqhve..................................................................................
d2htua_ ............................................................................................
d2slia2 qhdtnltckq..................................................................................
d3sila_ ............................................................................................
d4cpzb_ ............................................................................................
d4gezb_ ............................................................................................
d4mc7a_ ............................................................................................
d4yz5a2 gnyltveqysvsfennkkteyrngtkvhmnifykdalfkvvptnyiayissndhgeswsaptllppimglnrnapylgpgrgiiesstgril
d5nopa_ ............................................................................................


                                                                            10        20        30  
                                                                             |         |         |  
d1e8ua_ ............................................................-APIHDPDFIGGIGKELIVDNASDVTSFYP..
d1ms9a2 ...................pksnqpgsqssftavtiegmrvmlfthplnfkgrwlrdrln------------------------------..
d1nsca_ ............................................................------------------------------..
d1so7a_ ............................................................------------------------------..
d1v0ea1 psvtevhsfatidnngfamgyhqgdvaprevglfyfpdafnspsnyvrrqipseyepdas------------------------------..
d1v3ea_ ............................................................---------------PLNPDDFWRCTSGLPsl
d1w0pa3 ............................................................------------------------------..
d1w8oa3 ............................................................------------------------------..
d1z4va_ ............................................................----NDNRYINGINQFYF--SIAEGRNLTL..
d2aepa1 ............................................................------------------------------..
d2htua_ ............................................................------------------------------..
d2slia2 ............................................................------------------------------..
d3sila_ ............................................................------------------------------..
d4cpzb_ ............................................................------------------------------..
d4gezb_ ............................................................------------------------------..
d4mc7a_ ............................................................------------------------------..
d4yz5a2 ................ipsytgkesafiysddngaswkvkvvplpsswsaeaqfvelspg------------------------------..
d5nopa_ ............................................................------------------------------..


                     40        50        60        70        80        90       100       110       
                      |         |         |         |         |         |         |         |       
d1e8ua_ .....SAFQEHLNFIPAPTTGSGCTRIPSFDMSATHYCYTHNVILSGCRDHSHSHQYLALGVLRTTATGRIFFSTLRSISLDDTQNRKSCSV
d1ms9a2 .....---------------------------------------------------------------------------------------
d1nsca_ .....---------------------------------------------------------------------------------------
d1so7a_ .....------------------------------------------------------------------A--------------------
d1v0ea1 .....---------------------------------------------------------------------------------------
d1v3ea_ mktpkIRLMPGPGLLAMPTTVDGCIRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLNPRISHTFNINDNRKSCSL
d1w0pa3 .....---------------------------------------------------------------------------------------
d1w8oa3 .....---------------------------------------------------------------------------------------
d1z4va_ .....GPLLNMPSFIPTATTPEGCTRIPSFSLTKTHWCYTHNVILNGCQDHVSSNQFVSMGIIEPTSAGFPFFRTLKTLYLSDGVNRKSCSI
d2aepa1 .....-----------------------------------------------------------------------------------ECSC
d2htua_ .....---------------------------------------------------------------------------------------
d2slia2 .....---------------------------------------------------------------------------------------
d3sila_ .....---------------------------------------------------------------------------------------
d4cpzb_ .....---------------------------------------------------------------------------------------
d4gezb_ .....---------------------------------------------------------------------------------------
d4mc7a_ .....---------------------------------------------------------------------------------------
d4yz5a2 .....---------------------------------------------------------------------------------------
d5nopa_ .....ANFYTVPNLGPASSNSDECYTNPSFSIGSSIYMFSQEIRKTDCTAGEILSIQIVLGRIVDKGQQGPQASPLLVWAVPNPKIINSCAV


        120       130       140       150         160       170       180        190       200      
          |         |         |         |           |         |         |          |         |      
d1e8ua_ SATPLGCDMLCSKVTETEEEDYNSAVPTLMAHGRLGFDGQY..HEKDLDVTTLFEDWVANYPGVGGGSFID.GRVWFSVYGGLKPNSPSDTV
d1ms9a2 -----------------------------------------..----------------------------.--------------------
d1nsca_ -----------------------------------------..----------------------------.--------------------
d1so7a_ -----------------------------------------..----------------------------.--------------------
d1v0ea1 -----------------------------------------..----------------------------.--------------------
d1v3ea_ ALLNTDVYQLCSTPKVDERSDYASPGIEDIVLDIVNYDGSIstTRFKNNNISFDQPYAALYPSVGPGIYYK.GKIIFLGYGGLEHPIN----
d1w0pa3 -----------------------------------------..----------------------------.--------------------
d1w8oa3 -----------------------------------------..------------------------I---.--------------------
d1z4va_ STVPGGCMMYCFVSTQPERDDYFSAAPPEQRIIIMYYNDTI..VERIINPPGVLDVWATLNPGTGSGVYYL.GWVLFPIYGGVIKGTSLWNN
d2aepa1 YPRYPGVRCVCR-----------------------------..----------------------------.--------------------
d2htua_ -----------------------------------------..----------------------------.--------------------
d2slia2 -----------------------------------------..-------------Y--------------.--------------------
d3sila_ -----------------------------------------..----HDIVTKNGTISAMLGGVGSGLQLNdGKLVFPV-------------
d4cpzb_ -----------------------------------------..----------------------------.--------------------
d4gezb_ -----------------------------------------..----------------------------.--------------------
d4mc7a_ -----------------------------------------..----------------------------.------LYGGIITDTI--HP
d4yz5a2 -----------------------------------------..--------------------V-------.--------------------
d5nopa_ AAGDEMGWVLCSVTLTAASGEPIPHMFDGFWLYKLEPDTEVvsYRITGYAYLLDKQYDSVFIGKGGGIQKG.NDLYFQMYGLSRNRQS----


         210       220       230       240       250       260       270       280       290       3
           |         |         |         |         |         |         |         |         |        
d1e8ua_ QEGKYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRIQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRILTVGTSHFLYQRGSSYF
d1ms9a2 --------------------------------------------------------------------------------------------
d1nsca_ --------------C-----------------------------------------------------------------------------
d1so7a_ --------------------------------------------------------------------------------------------
d1v0ea1 -----------------------------------------------------------------------E--------------------
d1v3ea_ --------ENVICNTTGCPGKTQRDCNQASHSPWFSDRRMVNSIIVVDKGLNSIPKLKVWTISMRQNYWGSEGRLLLLGNKIYIYTRSTSWH
d1w0pa3 ------------------------------------G-------------------------------------------------------
d1w8oa3 --------------------------------------------------------------------------------------------
d1z4va_ QANKYFIPQMVAALCSQNQATQVQNAKSSYYSSWFGNRMIQSGILACPLRQDLTNECLVLPFSNDQVLMGAEGRLYMYGDSVYYYQRSNSWW
d2aepa1 --------------------------------------------------------------------------------------------
d2htua_ -AGDILRTQESSCTCIQ---------------------------------------------------------------------------
d2slia2 --------------------------------------------------------------------------------------------
d3sila_ --------------------------------------------------------------------------------------------
d4cpzb_ ----------------G---------------------------------------------------------------------------
d4gezb_ --------------------------------------------------------------------------------------------
d4mc7a_ TNGGPLRTQASSCICNDGTCYTII--------------------------------------------------------------------
d4yz5a2 --------------------------------------------------------------------------------------------
d5nopa_ ---FKALCEHGSCLGTG-GGGYQVLCDRAVMSFGSEESLITNAYLKVNDLASGKPVIIGQTFPPSDSYKGSNGRMYTIGDKYGLYLAPSSWN


        00                  310       320       330         340       350           360       370   
         |                    |         |         |           |         |             |         |   
d1e8ua_ SPALLYPMTV...........SNKTATLHSPYTFNAFTRPGSIPCQA..SARCPNSCVTGVYTDPYPLIFYR....NHTLRGVFGTMLDSEQ
d1ms9a2 ----------...........--------------------------..-----------------------....----------------
d1nsca_ ----------...........--------------------------..-----------------------....----------------
d1so7a_ ----------...........--------------------------..-----------------------....----------------
d1v0ea1 ----------...........--------------------------..-----------------------....----------------
d1v3ea_ SKLQLGIIDI...........TDYSDIRIKWTWHNVLSRPGNNECPW..GHSCPDGCITGVYTDAYPLN---....-PTGSIVSSVILDSQK
d1w0pa3 ----------...........--------------------------..-----------------------....----------------
d1w8oa3 ----------...........--------------------------..-----------------------....----------------
d1z4va_ PMTMLYKVTItftn.......GQPSAISAQNVPTQQVPRPGTGDCSA..TNRCPGFCLTGVYADAWLLTNPSststFGSEATFTGSYLNTAT
d2aepa1 ----------...........--------------------------..-----------------------....----------------
d2htua_ ----------...........--------------------------..-----------------------....----------------
d2slia2 ----------...........--------------------------..-----------------------....----------------
d3sila_ ----------...........--------------------------..-----------------------....----------------
d4cpzb_ ----------...........--------------------------..-----------------------....----------------
d4gezb_ ----------...........--------------------------..-----------------------....----------------
d4mc7a_ ----------...........--------------------------..-----------------------....----------------
d4yz5a2 ----------...........--------------------------..-----------------------....----------------
d5nopa_ RYLRFGITPDisvrsttwlksQDPIMKILS-------------TCTNtdRDMCPEICNTRGYQDIFPLSEDS....EY----YTYIGITPNN


            380       390       400       410       420       430       440                         
              |         |         |         |         |         |         |                         
d1e8ua_ ARLNPASAVFDSTSRSRITRVSSSSTKAAYTTSTCFKVVKTNKTYCLSIAEISNTLFGEFRIVPLLVEILK--nd.................
d1ms9a2 ------L------------------------------------------------------------------wltdnqriynvgqvsigde
d1nsca_ -------------------------------------------------------------------------iggdcylmitdgsasgisk
d1so7a_ -------------------------------------------------------------------------yayrklhpiqrpipsafcf
d1v0ea1 -------------------------------------------------------------------------pcikyydgvlylitrgtrg
d1v3ea_ SRVNPVITYSTATERVNELAILNRTLSAGYTTTSCI--THYNKGYCFHIVEINHKSLNTLQPMLFKTEIPKSCs..................
d1w0pa3 -------------------------------------------------------------------------rliypaivldrfflnvmsi
d1w8oa3 -------------------------------------------------------------------------qlrygphagrliqqytiin
d1z4va_ QRINPTMYIANNTQIISSQQFGSSGQEAAYGHTTCFRDTGSVMVYCIYIIELSSSLLGQFQIVPFIRQVTL--s..................
d2aepa1 -------------------------------------------------------------------------dnwkgsnrpivdinvkdys
d2htua_ -------------------------------------------------------------------------gdcywvmtdgpanrqaqyr
d2slia2 -------------------------------------------------------------------------dynfsgnnliesktdvdvn
d3sila_ -------------------------------------------------------------------------qmvrtknittvlntsfiys
d4cpzb_ -------------------------------------------------------------------------gncylmitdgsasgvsecr
d4gezb_ ----HRIYELQNGTVQRWKQLNTTGINFEYST--CY--TINNLIKCTG-------------------------tnlwndakrpllrftkeln
d4mc7a_ -------------------------------------------------------------------------adgttytasshrlyrlvng
d4yz5a2 -------------------------------------------------------------------------iqaymrtnngkiayltskd
d5nopa_ GGTKNFVAVRDSDGHIASIDILQNYYSITSATISCF--MYKDEIWCIAITEGKKQKDNPQRIYAHSYKIRQMCy..................


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 nsayssvlykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpa...............................
d1nsca_ crflkiregriikeifptgrvehteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlmctetyldtprpddgsitgpcesngd
d1so7a_ lshdhgrtwarghfvaqdtlecqvaevetgeqrvvtlnarshlrarvqaqstndgldfqesqlvkklvepppqgcqgsvisfpsprsgpgsp
d1v0ea1 drlgsslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykasyprtfyarlnvnnwnaddiewvnitdqi
d1v3ea_ ............................................................................................
d1w0pa3 ysddggsnwqtgstlpipfrwksssiletlepseadmvelqngdllltarldfnqivngvnysprqqflskdggitwslleannanvfsnis
d1w8oa3 aagafqavsvysddhgrtwrageavgvgmdenktvelsdgrvllnsrdsarsgyrkvavstdgghsygpvtidrdlpdptnnasiirafpda
d1z4va_ ............................................................................................
d2aepa1 ivssyvcsglvgdtprkndssssshclnpnneegghgvkgwafddgndvwmgrtisekfrsgyetfkviegwskpnsklqinrqvivdrgnr
d2htua_ iykanqgriigqtdisfngghieecscypndgkvecvcrdgwtgtnrpvlvispdlsyrvgylcagipsdtprgedtqftgsctspmgnqgy
d2slia2 mnifyknsvfkafptnylamrysddegaswsdldivssfkpevskflvvgpgigkqistgenagrllvplyskssaelgfmysddhgdnwty
d3sila_ tdgitwslpsgycegfgsenniiefnaslvnnirnsglrrsfetkdfgktwtefppmdkkvdnrnhgvqgstitipsgnklvaahssaqnkn
d4cpzb_ flkiregriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlmctdtyldtprpddgsitgpcesngdkg
d4gezb_ yqivepcngaptdfprgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvslsyelfsnkrtgrsgff
d4mc7a_ tsagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtprgidttnycdktttegeggiqgfmieg
d4yz5a2 agttwsapeylkfvsnpsygtqlsiinysqlidgkkavilstpnstngrkhgqiwiglinddntidwryhhdvdysnygysystltelpnhe
d5nopa_ ............................................................................................


                                                                                                    
                                                                                                    
d1e8ua_ ............................................................................................
d1ms9a2 ............................................................................................
d1nsca_ kgrggikggfvhqrmaskigrwysrtmsktermgmelyvrydgdpwtdsdalahsgvmvsmkepgwysfgfeikdkkcdvpcigiemvhdgg
d1so7a_ aqwllythpthswqradlgaylnprppapeawsepvllakgscaysdlqsmgtgpdgsplfgclyeandyeeivflmftlkqafpaey....
d1v0ea1 yqggivnsgvgvgsvvvkdnyiyymfggedhfnpwtygdnsakdpfksdghpsdlycykmkigpdnrv........................
d1v3ea_ ............................................................................................
d1w0pa3 tgtvdasitrfeqsdgshfllftnpqgnpagtngrqnlglwfsfdegvtwkgpiqlvngasaysdiyqldsenaivivetdnsnmrilrmpi
d1w8oa3 pagsarakvllfsnaasqtsrsqgtirmscddgqtwpvskvfqpgsmsystltalpdgtygllyepgtgiryanfnlawlg...........
d1z4va_ ............................................................................................
d2aepa1 sgysgifsvegkscinrcfyvelirgrkqetevwwtsnsivvfcgtsgtygtgswpdgadinlmpi..........................
d2htua_ gvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngwtqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeekti
d2slia2 veadnltggataeaqivempdgslktylrtgsnciaevtsidggetwsdrvplqgisttsygtqlsvinysqpidgkpaiilsspnatngrk
d3sila_ ndytrsdislyahnlysgevkliddfypkvgnasgagysclsyrknvdketlyvvyeangsiefqdlsrhlpviksyn..............
d4cpzb_ sggikggfvhqrmeskigrwysrtmsktermgmglyvkydgdpwadsdalafsgvmvsmkepgwysfgfeikdkecdvpcigiemvhdggke
d4gezb_ qpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvqninwd............................................
d4mc7a_ snswigriinpgskkgfeiykflgtlfsvqtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsm
d4yz5a2 iglmfekfdswsrnelhmknvvpyitfkiedlkkn.........................................................
d5nopa_ ............................................................................................


                                                                                             
                                                                                             
d1e8ua_ .....................................................................................
d1ms9a2 .....................................................................................
d1nsca_ kktwhsaataiyclmgsgqllwdtvtgvdmal.....................................................
d1so7a_ .....................................................................................
d1v0ea1 .....................................................................................
d1v3ea_ .....................................................................................
d1w0pa3 tllkqklt.............................................................................
d1w8oa3 .....................................................................................
d1z4va_ .....................................................................................
d2aepa1 .....................................................................................
d2htua_ wtssssivmcgvdyevadwswhdgailpfdi......................................................
d2slia2 ngkiwiglvndtgntgidkysvewkysyavdtpqmgysysclaelpdgqvgllyekydswsrnelhlkdilkfekysiseltgqa
d3sila_ .....................................................................................
d4cpzb_ twhsaataiyclmgsgqllwdtvtgvdmal.......................................................
d4gezb_ .....................................................................................
d4mc7a_ pdvnw................................................................................
d4yz5a2 .....................................................................................
d5nopa_ .....................................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046491 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Daphnia pulex - Common water flea
NoYes   Echinococcus granulosus
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Phycomyces blakesleeanus
NoYes   Mucor circinelloides
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Melampsora laricis-populina
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Coniophora puteana
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Dichomitus squalens
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Ostreococcus sp. RCC809
NoYes   Bathycoccus prasinos
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Leishmania major strain Friedlin
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Aureococcus anophagefferens
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Perkinsus marinus ATCC 50983
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. PCC 6312
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7107
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia sp. EAN1pec
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium acnes SK137
NoYes   Salinispora arenicola CNS-205
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus opacus B4
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium chubuense NBB4
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Oceanithermus profundus DSM 14977
NoYes   Meiothermus silvanus DSM 9946
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium cellulolyticum H10
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium phytofermentans ISDg
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium perfringens ATCC 13124
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halanaerobium hydrogeniformans
NoYes   Melissococcus plutonius DAT561
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus mitis B6
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus oralis Uo5
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus pumilus SAFR-032
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Nitrospira defluvii
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Geobacter daltonii FRC-32
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   beta proteobacterium CB
NoYes   Burkholderia phytofirmans PsJN
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Magnetococcus marinus MC-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Hirschia baltica ATCC 49814
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia felis URRWXCal2
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Actinobacillus succinogenes 130Z
NoYes   Vibrio cholerae O395
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella tarda EIB202
NoYes   Serratia sp. ATCC 39006
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Psychrobacter sp. PRwf-1
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Aeropyrum pernix K1
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanospirillum hungatei JF-1
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Haloferax volcanii DS2
NoYes   Halalkalicoccus jeotgali B3
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Plasmodium falciparum HB3
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus sp. CC9605
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Mycoplasma cynos C142
NoYes   Mycoplasma hyorhinis SK76
NoYes   Mycoplasma hyorhinis MCLD
NoYes   Mycoplasma hyorhinis HUB-1
NoYes   Mycoplasma hyorhinis DBS 1050
NoYes   Mycoplasma gallisepticum NC08_2008.031-4-3P
NoYes   Mycoplasma gallisepticum CA06_2006.052-5-2P
NoYes   Mycoplasma gallisepticum NC06_2006.080-5-2P
NoYes   Mycoplasma gallisepticum WI01_2001.043-13-2P
NoYes   Mycoplasma gallisepticum NY01_2001.047-5-1P
NoYes   Mycoplasma gallisepticum NC96_1596-4-2P
NoYes   Mycoplasma gallisepticum NC95_13295-2-2P
NoYes   Mycoplasma gallisepticum VA94_7994-1-7P
NoYes   Mycoplasma gallisepticum S6
NoYes   Mycoplasma gallisepticum str. R(high)
NoYes   Mycoplasma gallisepticum str. R(low)
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium ulcerans BR-AD22
NoYes   Corynebacterium ulcerans 809
NoYes   Corynebacterium callunae DSM 20147
NoYes   Corynebacterium pseudotuberculosis 258
NoYes   Corynebacterium pseudotuberculosis Cp162
NoYes   Corynebacterium pseudotuberculosis P54B96
NoYes   Corynebacterium pseudotuberculosis 267
NoYes   Corynebacterium pseudotuberculosis 1/06-A
NoYes   Corynebacterium pseudotuberculosis 42/02-A
NoYes   Corynebacterium pseudotuberculosis 3/99-5
NoYes   Corynebacterium pseudotuberculosis 31
NoYes   Corynebacterium pseudotuberculosis CIP 52.97
NoYes   Corynebacterium pseudotuberculosis PAT10
NoYes   Corynebacterium pseudotuberculosis I19
NoYes   Corynebacterium pseudotuberculosis FRC41
NoYes   Corynebacterium pseudotuberculosis C231
NoYes   Corynebacterium pseudotuberculosis 1002
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium diphtheriae BH8
NoYes   Corynebacterium diphtheriae INCA 402
NoYes   Corynebacterium diphtheriae VA01
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Corynebacterium diphtheriae HC02
NoYes   Corynebacterium diphtheriae HC01
NoYes   Corynebacterium diphtheriae 241
NoYes   Corynebacterium diphtheriae CDCE 8392
NoYes   Corynebacterium diphtheriae PW8
NoYes   Corynebacterium diphtheriae C7 (beta)
NoYes   Corynebacterium diphtheriae 31A
NoYes   Gardnerella vaginalis HMP9231
NoYes   Gardnerella vaginalis ATCC 14019
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium animalis subsp. animalis ATCC 25527
NoYes   Bifidobacterium animalis subsp. lactis Bl12
NoYes   Bifidobacterium animalis subsp. lactis B420
NoYes   Bifidobacterium animalis subsp. lactis ATCC 27673
NoYes   Bifidobacterium animalis subsp. lactis BLC1
NoYes   Bifidobacterium animalis subsp. lactis CNCM I-2494
NoYes   Bifidobacterium animalis subsp. lactis Bi-07
NoYes   Bifidobacterium animalis subsp. lactis V9
NoYes   Bifidobacterium animalis subsp. lactis DSM 10140
NoYes   Bifidobacterium animalis subsp. lactis BB-12
NoYes   Bifidobacterium animalis subsp. lactis AD011
NoYes   Bifidobacterium breve UCC2003
NoYes   Bifidobacterium bifidum PRL2010
NoYes   Bifidobacterium bifidum BGN4
NoYes   Actinomyces graevenitzii C83
NoYes   Actinomyces odontolyticus ATCC 17982
NoYes   Actinomyces viscosus C505
NoYes   Dehalococcoides mccartyi GY50
NoYes   Dehalococcoides mccartyi BTF08
NoYes   Dehalococcoides sp. VS
NoYes   Dehalococcoides sp. CBDB1
NoYes   Chthonomonas calidirosea T49
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus thermophilus JL-18
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Sulfobacillus acidophilus TPY
NoYes   Clostridium acidurici 9a
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium saccharolyticum Clostridium cf. saccharolyticum K10
NoYes   Coprococcus catus GD/7
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Thermoanaerobacter sp. X513
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus delbrueckii subsp. bulgaricus 2038
NoYes   Streptococcus intermedius B196
NoYes   Streptococcus intermedius C270
NoYes   Streptococcus equi subsp. zooepidemicus ATCC 35246
NoYes   Streptococcus equi subsp. zooepidemicus MGCS10565
NoYes   Streptococcus equi subsp. zooepidemicus
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus pneumoniae A026
NoYes   Streptococcus pneumoniae ST556
NoYes   Streptococcus pneumoniae SPNA45
NoYes   Streptococcus pneumoniae SPN994039
NoYes   Streptococcus pneumoniae SPN994038
NoYes   Streptococcus pneumoniae SPN034183
NoYes   Streptococcus pneumoniae SPN034156
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae OXC141
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669
NoYes   Streptococcus pneumoniae TCH8431/19A
NoYes   Streptococcus pneumoniae CGSP14
NoYes   Streptococcus pneumoniae G54
NoYes   Streptococcus pneumoniae JJA
NoYes   Streptococcus pneumoniae 70585
NoYes   Streptococcus pneumoniae Hungary19A-6
NoYes   Streptococcus pneumoniae Taiwan19F-14
NoYes   Streptococcus pneumoniae D39
NoYes   Streptococcus pneumoniae 670-6B
NoYes   Streptococcus pneumoniae R6
NoYes   Streptococcus pneumoniae TIGR4
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus suis A7
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus licheniformis 9945A
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus cereus G9842
NoYes   Bacillus megaterium WSH-002
NoYes   Staphylococcus pseudintermedius ED99
NoYes   Salinibacter ruber DSM 13855
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Chlamydia psittaci 01DC12
NoYes   Chlamydia psittaci WC
NoYes   Chlamydia psittaci M56
NoYes   Chlamydia psittaci WS/RT/E30
NoYes   Chlamydia psittaci VS225
NoYes   Chlamydia psittaci MN
NoYes   Chlamydia psittaci GR9
NoYes   Chlamydia psittaci 84/55
NoYes   Chlamydia psittaci 08DC60
NoYes   Chlamydia psittaci 02DC15
NoYes   Chlamydia psittaci C19/98
NoYes   Chlamydia psittaci NJ1
NoYes   Chlamydia psittaci CP3
NoYes   Chlamydophila psittaci RD1
NoYes   Chlamydia psittaci Mat116
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydophila psittaci 6BC
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Brachyspira pilosicoli WesB
NoYes   Brachyspira pilosicoli B2904
NoYes   Brachyspira pilosicoli P43/6/78
NoYes   Treponema pedis str. T A4
NoYes   Treponema pallidum str. Fribourg-Blanc
NoYes   Treponema pallidum subsp. pertenue str. Gauthier
NoYes   Treponema pallidum subsp. pertenue str. CDC2
NoYes   Treponema pallidum subsp. pertenue str. SamoaD
NoYes   Treponema pallidum subsp. pallidum str. Mexico A
NoYes   Treponema pallidum subsp. pallidum str. Chicago
NoYes   Treponema pallidum subsp. pallidum DAL-1
NoYes   Treponema pallidum subsp. pallidum str. Nichols
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Helicobacter cetorum MIT 99-5656
NoYes   Helicobacter pylori BM012S
NoYes   Helicobacter pylori BM012A
NoYes   Helicobacter pylori SouthAfrica20
NoYes   Helicobacter pylori UM298
NoYes   Helicobacter pylori UM066
NoYes   Helicobacter pylori UM037
NoYes   Helicobacter pylori UM299
NoYes   Helicobacter pylori UM032
NoYes   Helicobacter pylori OK310
NoYes   Helicobacter pylori OK113
NoYes   Helicobacter pylori Rif2
NoYes   Helicobacter pylori Rif1
NoYes   Helicobacter pylori HUP-B14
NoYes   Helicobacter pylori PeCan18
NoYes   Helicobacter pylori Shi169
NoYes   Helicobacter pylori Shi112
NoYes   Helicobacter pylori Shi417
NoYes   Helicobacter pylori XZ274
NoYes   Helicobacter pylori Aklavik86
NoYes   Helicobacter pylori Aklavik117
NoYes   Helicobacter pylori SNT49
NoYes   Helicobacter pylori Puno135
NoYes   Helicobacter pylori Puno120
NoYes   Helicobacter pylori ELS37
NoYes   Helicobacter pylori Gambia94/24
NoYes   Helicobacter pylori SouthAfrica7
NoYes   Helicobacter pylori India7
NoYes   Helicobacter pylori Lithuania75
NoYes   Helicobacter pylori 2017
NoYes   Helicobacter pylori 2018
NoYes   Helicobacter pylori 908
NoYes   Helicobacter pylori F57
NoYes   Helicobacter pylori F30
NoYes   Helicobacter pylori F16
NoYes   Helicobacter pylori Sat464
NoYes   Helicobacter pylori Cuz20
NoYes   Helicobacter pylori SJM180
NoYes   Helicobacter pylori B8
NoYes   Helicobacter pylori v225d
NoYes   Helicobacter pylori 83
NoYes   Helicobacter pylori 35A
NoYes   Helicobacter pylori P12
NoYes   Helicobacter pylori G27
NoYes   Helicobacter pylori Shi470
NoYes   Helicobacter pylori HPAG1
NoYes   Helicobacter pylori J99
NoYes   Helicobacter pylori 26695
NoYes   Helicobacter pylori 26695
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sp. M18
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum GMI1000
NoYes   Polynucleobacter necessarius subsp. necessarius STIR1
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Variovorax paradoxus EPS
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Sulfuricella denitrificans skB26
NoYes   Octadecabacter antarcticus 307
NoYes   Rickettsia canadensis str. CA410
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida 36950
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Pasteurella multocida subsp. multocida str. Pm70
NoYes   Haemophilus parasuis ZJ0906
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio sp. EJY3
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Proteus mirabilis BB2000
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Serratia marcescens FGI94
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli NA114
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli LF82
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli S88
NoYes   Escherichia coli SE15
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa PA7
NoYes   Acinetobacter sp. SH024
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii BJAB0715
NoYes   Acinetobacter baumannii TCDC-AB0715
NoYes   Acinetobacter baumannii AB307-0294
NoYes   Acinetobacter baumannii AYE
NoYes   Acinetobacter baumannii SDF
NoYes   Acinetobacter baumannii MDR-ZJ06
NoYes   Acinetobacter baumannii AB0057
NoYes   Francisella tularensis subsp. mediasiatica FSC147
NoYes   Francisella tularensis subsp. holarctica F92
NoYes   Francisella tularensis subsp. holarctica FTNF002-00
NoYes   Francisella tularensis subsp. holarctica OSU18
NoYes   Francisella tularensis subsp. holarctica LVS
NoYes   Francisella tularensis subsp. holarctica FSC200
NoYes   Francisella tularensis subsp. tularensis TIGB03
NoYes   Francisella tularensis subsp. tularensis TI0902
NoYes   Francisella tularensis subsp. tularensis NE061598
NoYes   Francisella tularensis subsp. tularensis FSC198
NoYes   Francisella tularensis subsp. tularensis SCHU S4
NoYes   Francisella cf. novicida Fx1
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Aeropyrum camini SY1 = JCM 12091
NoYes   Thermococcus litoralis DSM 5473
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Halorhabdus tiamatea SARL4B
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica), fosmids (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community lean2 (meta-genome)
NoYes   Mouse Gut Community lean3 (meta-genome)
NoYes   Mouse Gut Community ob1 (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]