SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Nitrous oxide reductase, N-terminal domain alignments in Catenulispora acidiphila DSM 44928

These alignments are sequences aligned to the 0037815 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1fwxa2                             ................................................................
gi|256393881|ref|YP_003115445.1|  tlaagaahaagaa...................................................
gi|256392473|ref|YP_003114037.1|  aagltttsltaaprasaaagg...........................................
gi|256393476|ref|YP_003115040.1|  vvnqgkimgatvspdgthvaatitdgtgamviidlrsyqvqqvigkaatgvnlaisgndvgqts

d1fwxa2                             ................................................ADGSVAPGQLDDYYGF
gi|256393881|ref|YP_003115445.1|  ................................................------APLPPGTYVY
gi|256392473|ref|YP_003114037.1|  ................................................----------LRDVLV
gi|256393476|ref|YP_003115040.1|  ptyspdgksvwvgrangytkftvkpdgtlatpvdvaipaagsaqalsg----------------

                                      20        30        40        50        60        70        80
                                       |         |         |         |         |         |         |
gi|256393881|ref|YP_003115445.1|  VANAASNSVSVIDTASQTVVATVPVGSAPTGI--------------------------------
gi|256393476|ref|YP_003115040.1|  ---------------------------------------------K------------------

                                            90       100       110         120        130       140 
                                             |         |         |           |          |         | 
gi|256393881|ref|YP_003115445.1|  -------------AASADGHRVYVTDSGSSSVSVIDTqaASGpAVVA--SIAVGRQPQSAALSP
gi|256393476|ref|YP_003115040.1|  ------------AVFSADGATVYGAVNGQNRVVAMDA..ATG.AITQ--SWTTGIAPRGMALV-

                                          150       160       170       180       190       200     
                                            |         |         |         |         |         |     
gi|256393881|ref|YP_003115445.1|  DGTRLYVGDDIA-------------------GTVSVIDTASDTVLSTIAAGPGAEGLAVSPDGS
gi|256392473|ref|YP_003114037.1|  DGTRYVVSATTA-------------------QEAEVFDTATGGVAGTFATGTYPHQNDYSADGK
gi|256393476|ref|YP_003115040.1|  -NGKLYVSNEGGRTAVAGDTTMNSYG------------------------------T-------

                                      210       220       230       240       250       260         
                                        |         |         |         |         |         |         
gi|256393881|ref|YP_003115445.1|  RVYAADTGGSS----------------------------------------VTVIDAAT...DT
gi|256392473|ref|YP_003114037.1|  YIYNSSIG--------------------ITSLPKALEWAKGSFL-------LTKVDATT...LK
gi|256393476|ref|YP_003115040.1|  ------------------------------------AVPANPETGASTTGTVSVIDTVN...PT

                                      270       280       290       300       310       320         
                                        |         |         |         |         |         |         
gi|256393881|ref|YP_003115445.1|  V.VTTVPVGQTPVGLTVSPDGSHVYVPDYGSGQVSVIDTATETVS--------------.....

                                        330       340        350       360       370       380      
                                          |         |          |         |         |         |      
gi|256393881|ref|YP_003115445.1|  .----------------.---------------------------------ATVAVG------A
gi|256393476|ref|YP_003115040.1|  .ASVGYEPDAISLTPDG.HLLVSLGRANAVAVYRFKSAQQ------------------------

                                     390       400       410       420       430       440       450
                                       |         |         |         |         |         |         |
gi|256392473|ref|YP_003114037.1|  LPYWGQTSADGQYCFVSLSKL------------GEVSVIDYATAT--EVARVPVGAFPQR----
gi|256393476|ref|YP_003115040.1|  ----------------------------------------------------------------

d1fwxa2                             HPSIL----sdik....
gi|256393881|ref|YP_003115445.1|  ---------l.......
gi|256392473|ref|YP_003114037.1|  ---------erisqmap
gi|256393476|ref|YP_003115040.1|  ---------........

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0037815 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Xenopus laevis - African clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Adineta vaga
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Capitella sp. I
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Drosophila persimilis 1.3
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Rhodnius prolixus 22
NoYes   Echinococcus multilocularis
NoYes   Taenia solium - Pork tapeworm
NoYes   Acropora digitifera v1.0
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Proterospongia sp. ATCC 50818
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Coniophora puteana
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora crassa OR74A
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Coccidioides immitis RS
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Pichia stipitis CBS 6054
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Kluyveromyces waltii
NoYes   Selaginella moellendorffii
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Malus domestica v196 - Apple
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza nivara 22
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Musa balbisiana - Balbis banana
NoYes   Chlorella vulgaris
NoYes   Bathycoccus prasinos
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Leishmania mexicana 2.4
NoYes   Trypanosoma congolense 2.4
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora capsici
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Paramecium tetraurelia
NoYes   Cryptosporidium parvum Iowa II
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acaryochloris marina MBIC11017
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia sp. KTR9
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium chubuense NBB4
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus gobiensis I-0
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Clostridium cellulolyticum H10
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Clostridium phytofermentans ISDg
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Carnobacterium sp. WN1359
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Bacillus selenitireducens MLS10
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Bacillus sp. JS
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium limicola DSM 245
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Paludibacter propionicigenes WB4
NoYes   Bacteroides sp. CF50
NoYes   Prevotella denticola F0289
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Gramella forsetii KT0803
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Geobacillus sp. JF8
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Thermosipho africanus TCF52B
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Collimonas fungivorans Ter331
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Novosphingobium sp. PP1Y
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingomonas wittichii RW1
NoYes   Maricaulis maris MCS10
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio splendidus LGP32
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella violacea DSS12
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Hahella chejuensis KCTC 2396
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Nitrosococcus halophilus Nc4
NoYes   Legionella longbeachae NSW150
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Halyomorpha halys symbiont
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Buchnera aphidicola BCc
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   secondary endosymbiont of Ctenarytaina eucalypti
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Candidatus Blochmannia floridanus
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella conradii HZ254
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta concilii GP6
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Ferroglobus placidus DSM 10642
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Aspergillus fumigatus A1163
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem/NITR202
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium pseudotuberculosis FRC41
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Chthonomonas calidirosea T49
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium pasteurianum BC1
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Enterococcus faecium NRRL B-2354
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus polymyxa E681
NoYes   Geobacillus sp. C56-T3
NoYes   Geobacillus sp. Y4.1MC1
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Staphylococcus aureus Bmb9393
NoYes   Staphylococcus aureus M1
NoYes   Staphylococcus aureus 08BA02176
NoYes   Staphylococcus aureus ST228/18412
NoYes   Staphylococcus aureus ST228/18341
NoYes   Staphylococcus aureus ST228/16125
NoYes   Staphylococcus aureus ST228/16035
NoYes   Staphylococcus aureus ST228/15532
NoYes   Staphylococcus aureus ST228/10497
NoYes   Staphylococcus aureus ST228/10388
NoYes   Staphylococcus aureus 04-02981
NoYes   Staphylococcus aureus subsp. aureus 6850
NoYes   Staphylococcus aureus subsp. aureus SA957
NoYes   Staphylococcus aureus subsp. aureus CN1
NoYes   Staphylococcus aureus subsp. aureus SA40
NoYes   Staphylococcus aureus subsp. aureus 11819-97
NoYes   Staphylococcus aureus subsp. aureus M013
NoYes   Staphylococcus aureus subsp. aureus HO 5096 0412
NoYes   Staphylococcus aureus subsp. aureus VC40
NoYes   Staphylococcus aureus subsp. aureus T0131
NoYes   Staphylococcus aureus subsp. aureus LGA251
NoYes   Staphylococcus aureus subsp. aureus ECT-R 2
NoYes   Staphylococcus aureus subsp. aureus JKD6159
NoYes   Staphylococcus aureus subsp. aureus ED133
NoYes   Staphylococcus aureus subsp. aureus ED98
NoYes   Staphylococcus aureus subsp. aureus TW20
NoYes   Staphylococcus aureus subsp. aureus 55/2053
NoYes   Staphylococcus aureus subsp. aureus TCH60
NoYes   Staphylococcus aureus subsp. aureus str. JKD6008
NoYes   Staphylococcus aureus subsp. aureus 71193
NoYes   Staphylococcus aureus subsp. aureus S0385
NoYes   Staphylococcus aureus subsp. aureus str. Newman
NoYes   Staphylococcus aureus subsp. aureus Mu3
NoYes   Staphylococcus aureus subsp. aureus USA300_TCH1516
NoYes   Staphylococcus aureus subsp. aureus USA300_FPR3757
NoYes   Staphylococcus aureus subsp. aureus JH9
NoYes   Staphylococcus aureus subsp. aureus MSSA476
NoYes   Staphylococcus aureus subsp. aureus MRSA252
NoYes   Staphylococcus aureus subsp. aureus MW2
NoYes   Staphylococcus aureus subsp. aureus N315
NoYes   Staphylococcus aureus subsp. aureus Mu50
NoYes   Staphylococcus aureus subsp. aureus COL
NoYes   Staphylococcus aureus subsp. aureus NCTC 8325
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Acidithiobacillus ferrooxidans ATCC 23270
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Neisseria gonorrhoeae TCDC-NG08107
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Polynucleobacter necessarius subsp. necessarius STIR1
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Bordetella pertussis CS
NoYes   Bordetella parapertussis 18323
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Nitrosomonas sp. AL212
NoYes   Sulfuricella denitrificans skB26
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium tropici CIAT 899
NoYes   Mesorhizobium australicum WSM2073
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Buchnera aphidicola str. Bp (Baizongia pistaciae)
NoYes   Buchnera aphidicola str. Ua (Uroleucon ambrosiae)
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Candidatus Moranella endobia PCVAL
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   secondary endosymbiont of Heteropsylla cubana Thao2000
NoYes   Candidatus Blochmannia chromaiodes str. 640
NoYes   Candidatus Blochmannia vafer str. BVAF
NoYes   Candidatus Blochmannia pennsylvanicus str. BPEN
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli str. K-12 substr. MDS42
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter baumannii TYTH-1
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii ATCC 19606
NoYes   Acinetobacter baumannii SDF
NoYes   Acinetobacter lwoffii SH145
NoYes   Methylophaga sp. JAM7
NoYes   Cycloclasticus zancles 7-ME
NoYes   Methanosarcina mazei Tuc01
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Natronococcus occultus SP4
NoYes   Natronomonas moolapensis 8.8.11
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Phoenix dactylifera - Date palm
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   1_050719N (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Core Eukaryotic Genes 458 (CEGMA)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]