SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


WD40 repeat-like alignments

These alignments are sequences aligned to the 0046612 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1erja_ h...........................................................................................
d1gotb_ seldqlrqeaeqlknqirdarkacadatlsqitnnidpvgri..................................................
d1gxra_ dyfqgamgskp.................................................................................
d1k8kc_ ayhsflve....................................................................................
d1nexb2 fvpqrttlrghmtsvitclqf.......................................................................
d1nr0a1 sefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltd..........................................
d1nr0a2 lgsidq......................................................................................
d1p22a2 grhslqrihcr.................................................................................
d1pgua1 ssislkeiippqpstqrnftthlsydpttnaiaypcgksafvrclddgd...........................................
d1pgua2 ghde........................................................................................
d1sq9a_ kvfiatanagk.................................................................................
d1u4ca_ mq..........................................................................................
d1vyhc1 kewi........................................................................................
d2gnqa_ eaaraqptpsssatqskptpvk......................................................................
d2ovrb2 wrrgelk.....................................................................................
d2pbid1 matdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfv........................................
d2ymub1 gvke........................................................................................
d3gfca_ wkkntpflydlvmthalewpsltaqwlpdvtrpegkdfsihrlvlgthtsdeqnhlviasvqlpnddaqfdashydsekgefggfgsvs...
d3jb9k_ xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxwh...................
d3jb9l_ pnlq........................................................................................
d4aowa_ eq..........................................................................................
d4bh6g_ rqiakvpyrvldapsl............................................................................
d4pswb_ plsvdeeydlwksnvplmydfvsetrltwpsltvqwlptpvqeldggfikqeliigthtsgeeenylkfaeinlpkeilsnedpqeeageey
d4yvda_ wh..........................................................................................
d5gmkn1 p...........................................................................................


                              10        20        30        40        50        60         70       
                               |         |         |         |         |         |          |       
d1erja_ ..............-YLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTS.VVCCVKFSN..DGE
d1gotb_ ..............--------------------------------------------------QMRTRRTLRGHLA.KIYAMHWGT..DSR
d1gxra_ ..............---------------AYSFHVTADGQMQPVP---FPPDALIGPGI----PRHARQINTLNHGE.VVCAVTISN..PTR
d1k8kc_ ..............---------------------------------------------------------------.---------..---
d1nexb2 ..............-----------------------EDNYVITG---ADDKMIRVYDS----INKKFLLQLSGHDG.GVWALKYA-..HGG
d1nr0a1 ..............------------------------------------------------------TEIYTEHSH.QTTVAKTSP..SGY
d1nr0a2 ..............--------------------------------------------------------VRYGHNK.AITALSSSA..DGK
d1p22a2 ..............----------------------------------------------------------SETSK.GVYCLQYD-..-DQ
d1pgua1 ..............-------------------------------------------------SKVPPVVQFTGHGSsVVTTVKFSPikGSQ
d1pgua2 ..............-----------------------------------------------------VLKTISGHNK.GITALTVN-..---
d1sq9a_ ..............-----------------------------------------------------------AHDA.DIFSVSAC-..-NS
d1u4ca_ ..............-----------------------------------------------------IVQIEQAPKD.YISDIKIIP..SKS
d1vyhc1 ..............-------------------------------------------------PRPPEKYALSGHRS.PVTRVIFHP..VFS
d2gnqa_ ..............-------------------------------------------------PNYALKFTLAGHTK.AVSSVKFSP..NGE
d2ovrb2 ..............-----------------------------------------------------SPKVLKGHDDhVITCLQFC-..-GN
d2pbid1 ..............---------------------------------------------------MKTRRTLKGHGN.KVLCMDWCK..DKR
d2ymub1 ..............------------------------------------------------------RNRLEAHSS.SVRGVAFSP..DGQ
d3gfca_ ..............---------------------------------------------------------------.---------..---
d3jb9k_ ..............-------------------------------------------------APWTLMRVISGHLG.WVRCVDVEP..GNQ
d3jb9l_ ..............---------------------------------------------------------MFGHTA.EVLVARFDP..SGS
d4aowa_ ..............---------------------------------------------------MTLRGTLKGHNG.WVTQIATTPq.FPD
d4bh6g_ ..............-----------------------------------------------------------ADDF.YYSLIDWS-..STD
d4pswb_ qsslpaprsnirit---------------------------------------------------------------.---------..---
d4yvda_ ..............-------------------------------------------------PPWKLYRVISGHLG.WVRCIAVEP..GNQ
d5gmkn1 ..............---------------------------------------------------KKVIRNYPGHPE.GTTALKFLPk.TGH


           80         90               100       110       120       130              140           
            |          |                 |         |         |         |                |           
d1erja_ YLATGC.NKTTQVYRVS........DGSLVARLSDDSAANKDPENLNTSSSPSSDLYIRSVCFSP.......DGKFLATGAE....DRLIRI
d1gotb_ LLLSASqDGKLIIWDSY........TTNKVHAIPLRSSW------------------VMTCAYAP.......SGNYVACGGL....DNICSI
d1gxra_ HVYTGG.KGCVKVWDIShpg.....NKSPVSQLDCLNRDNY----------------IRSCKLLP.......DGCTLIVGGE....ASTLSI
d1k8kc_ ------.----------........-------------P------------------ISCHAWNK.......DRTQIAICPN....NHEVHI
d1nexb2 ILVSGStDRTVRVWDIK........KGCCTHVFEGHNST------------------VRCLDIVEyk.....NIKYIVTGSR....DNTLHV
d1nr0a1 YCASGDvHGNVRIWDTTqt......THILKTTIPVFSGP------------------VKDISWDS.......ESKRIAAVGEgrerFGHVFL
d1nr0a2 TLFSADaEGHINSWDIS........TGISNRVFPDVHATM-----------------ITGIKTTS.......KGD-LFTVSW....DDHLKV
d1p22a2 KIVSGLrDNTIKIWDKN........TLECKRILTGHTGS------------------VLCLQYD-.......-ERVIITGSS....DSTVRV
d1pgua1 YLCSGDeSGKVIVWGWTfdkesnsvEVNVKSEFQVLAGP------------------ISDISWDF.......EGRRLCVVGEgr..DNFGVF
d1pgua2 PLISGSyDGRIMEWSSS........S---------------------------------------.......----------....------
d1sq9a_ FTVSCSgDGYLKVWDNKlldnen..PKDKSYSHFVHKSG------------------LHHVDVLQaierdafELCLVATTSF....SGDLLF
d1u4ca_ LLLITSwDGSLTVYKFDiqak....NVDLLQSLRYKHP-------------------LLCCNFIDn......TDLQIYVGTV....QGEILK
d1vyhc1 VMVSASeDATIKVWDYE........TGDFERTLKGHTDS------------------VQDISFDH.......SGKLLASCSA....DMTIKL
d2gnqa_ WLASSSaDKLIKIWGAY........DGKFEKTISGHKLG------------------ISDVAWSS.......DSNLLVSASD....DKTLKI
d2ovrb2 RIVSGSdDNTLKVWSAV........TGKCLRTLVGHTGG------------------VWSSQMR-.......-DNIIISGST....DRTLKV
d2pbid1 RIVSSSqDGKVIVWDSF........TTNKEHAVTMPCTW------------------VMACAYAP.......SGCAIACGGL....DNKCSV
d2ymub1 TIASASdDKTVKLWN-R........NGQLLQTLTGHSSS------------------VWGVAFSP.......DGQTIASASD....DKTVKL
d3gfca_ ------.----------........-GKIEIEIKINHEGE-----------------VNRARYMPq......NPCIIATKTP....SSDVLV
d3jb9k_ WFCTGAgDRTIKIWDLA........SGVLKLTLTGHIAT------------------VRGLAVSP.......RHPYLFSCGE....DKMVKC
d3jb9l_ YFASGGmDRQILLWNVFg.......DVKNYGVLNGCKGA------------------ITDLQWSR.......DSRVVYCSSS....DTHLMS
d4aowa_ MILSASrDKTIIMWKLTrdetn...YGIPQRALRGHSHF------------------VSDVVISS.......DGQFALSGSW....DGTLRL
d4bh6g_ VLAVAL.GKSIFLTDNN........TGDVVHLCDTENE-------------------YTSLSWIG.......AGSHLAVGQA....NGLVEI
d4pswb_ ------.----------........-----AKYEHEEE-------------------ITRARYMPq......DPNIVATING....QGTTFL
d4yvda_ WFVTGSaDRTIKIWDLA........SGKLKLSLTGHIST------------------VRGVIVST.......RSPYLFSCGE....DKQVKC
d5gmkn1 LILSGGnDHTIKIWDFYh.......DYECLRDFQGHNKP------------------IKALRFTE.......DCQSFLSSSF....DRSVKI


        150                              160             170             180       190              
          |                                |               |               |         |              
d1erja_ WDIE.......................NRKIVMILQ......GHEQDIYSLDYFP.SGDK.....LVSGSGDRTVRIWDLRT..........
d1gotb_ YNLKtreg...................NVRVSRELA......GHTGYLSCCRFL-.DDNQ.....IVTSSGDTTCALWDIET..........
d1gxra_ WDLAap.....................TPRIKAELT......SSAPACYALAISP.DSKV.....CFSCCSDGNIAVWDLHN..........
d1k8kc_ YEKSgn.....................KWVQVHELK......EHNGQVTGVDWAP.DSNR.....IVTCGTDRNAYVWTLKGrt........
d1nexb2 WKLPkessvpdhgeehdyplvfhtpeeNPYFVGVLR......GHMASVRTVSGH-.-GNI.....VVSGSYDNTLIVWDVAQ..........
d1nr0a1 FD--.......................TGTSNGNLT......GQARAMNSVDFKPsRPFR.....IISGSDDNTVAIFEGPP..........
d1nr0a2 VPAGgsgv...................D----SSKAvan...KLSSQPLGLAVSA.DGDI.....AVAACY-KHIAIYS---..........
d1p22a2 WDVN.......................TGEMLNTLI......HHCEAVLHLRFN-.-NGM.....MVTCSKDRSIAVWDMASptd.......
d1pgua1 ISWD.......................SGNSLGEVS......GHSQRINACHLKQsRPMR.....SMTVGDDGSVVFYQGPP..........
d1pgua2 ----.......................-MHQ-----......DHSNLIVSLDNS-.KAQE.....YSSISWDDTLKVNGITKhefgsqpkva
d1sq9a_ YRITrede...................TKKVIFEKLdlldsdMKKHSFWALKWGA.SNDRllshrLVATDVKGTTYIWKFHPfadesnsltl
d1u4ca_ VDLI.......................GSPSFQALT......NNEANLGICRICKyGDDK.....LIAASWDGLIEVIDPRNygdgviav..
d1vyhc1 WDFQ.......................GFECIRTMH......GHDHNVSSVSIMP.NGDH.....IVSASRDKTIKMWEVQT..........
d2gnqa_ WDVS.......................SGKCLKTLK......GHSNYVFCCNFNP.QSNL.....IVSGSFDESVRIWDVKT..........
d2ovrb2 WNAE.......................TGECIHTLY......GHTSTVRCMHLH-.-EKR.....VVSGSRDATLRVWDIET..........
d2pbid1 YPLTfdknen.................MAAK----Kksva..MHTNYLSACSFTN.SDMQ.....ILTASGDGTCALWDVES..........
d2ymub1 WN-R.......................NGQLLQTLT......GHSSSVRGVAFSP.DGQT.....IASASDDKTVKLWNRN-..........
d3gfca_ FDYTkhpskpdp...............SGECNPDLRlr....GHQKEGYGLSWNPnLSGH.....LLSASDDHTICLWDISAvpkegkv...
d3jb9k_ WDLE.......................TNKVIRHYH......GHLSGVYALKLHP.TLDV.....LVTAGRDAVARVWDMRT..........
d3jb9l_ WDAV.......................SGQKIRKHK......GHAGVVNALDVLKvGSEL.....LTSVSDDCTMKVWDSRS..........
d4aowa_ WDLT.......................TGTTTRRFV......GHTKDVLSVAFSS.DNRQ.....IVSGSRDKTIKLWNTL-..........
d4bh6g_ YDVM.......................KRKCIRTLS......GHIDRVACLSWN-.-NHV.....LTSGSRDHRILHRDVRM..........
d4pswb_ YS-R.......................SEGLQSTLK......FHKDNGYALSFSTlVKGR.....LLSGSDDHTVALWEVGSggdp......
d4yvda_ WDLE.......................YNKVIRHYH......GHLSAVYGLDLHP.TIDV.....LVTCSRDSTARIWDVRT..........
d5gmkn1 WDTE.......................TGKVKTRLH......-LNSTPADVESRPtNPHE.....FIVGLSNSKILHYDDRVsen.......


                                   200             210        220        230          240       250 
                                     |               |          |          |            |         | 
d1erja_ ........................GQCSLTL...SIED...GVTTVAVSPG.DGKYIAAGSLD.RAVRVWDSETG...FLVERLDSENESGT
d1gotb_ ........................GQQTTTFt..GHTG...DVMSLSLAP-.DTRLFVSGACD.ASAKLWDVREG...MCRQTFT-------
d1gxra_ ........................QTLVRQFq..GHTD...GASCIDISN-.DGTKLWTGGLD.NTVRSWDLREG...RQLQQH--------
d1k8kc_ ........................WKPTLVIl..RINR...AARCVRWAP-.NEKKFAVGSGS.RVISICYFEQE...NDWWVCKHIKK---
d1nexb2 ........................MKCLYILs..GHTD...RIYSTIYDH-.ERKRCISASMD.TTIRIWDLENG...ELMYTLQ-------
d1nr0a1 ........................FKFKSTFg..EHTK...FVHSVRYNP-.DGSLFASTGGD.GTIVLYNGVDG...TKTGVFEDDSLKNV
d1nr0a2 ........................HGKLTEV...PISY...NSSCVALSN-.DKQFVAVGGQD.SKVHVYKL-SG...ASVSEVKTI-----
d1p22a2 ........................ITLRRVLv..GHRA...AVNVVDF---.DDKYIVSASGD.RTIKVWNTSTC...EFVRTLN-------
d1pgua1 ........................FKFSASDr..THHKqgsFVRDVEFSPD.SGEFVITVGSD.RKISCFDGKSG...EFLKYIEDDQE---
d1pgua2 sanndgftavltndddllilqsftGDIIKSV...RLNS...PGSAVSL---.SQNYVAVGLEEgNTIQVFKLSDL...EVSFDLKT------
d1sq9a_ ...............nwsptlelqGTVESPM...TPSQ...FATSVDIS--.ERGLIATGFNN.GTVQISELSTL...RPLYNFESQHSMI-
d1u4ca_ ........................KNLNSNNt..KVKN...KIFTMDT---.NSSRLIVGMNN.SQVQWFRLPLCe..DDNGTIEES-----
d1vyhc1 ........................GYCVKTFt..GHRE...WVRMVRPNQ-.DGTLIASCSND.QTVRVWVVATK...ECKAELR-------
d2gnqa_ ........................GKCLKTLp..AHSD...PVSAVHFNR-.DGSLIVSSSYD.GLCRIWDTASG...QCLKTLID------
d2ovrb2 ........................GQCLHVLm..GHVA...AVRCVQY---.DGRRVVSGAYD.FMVKVWDPETE...TCLHTLQ-------
d2pbid1 ........................GQLLQSFh..GHGA...DVLCLDLAPSeTGNTFVSGGCD.KKAMVWDMRSG...QCVQAFE-------
d2ymub1 ........................GQLLQTLt..GHSS...SVWGVAFSP-.DGQTIASASDD.KTVKLWN-RNG...QLLQTLT-------
d3gfca_ ........................VDAKTIFt..GHTA...VVEDVSWHLL.HESLFGSVADD.QKLMIWDTRSNntsKPSHSVD-------
d3jb9k_ ........................RQNVHVLs..GHKS...TVASLAVQE-.FDPQVVTGSMD.STIRLWDLAAG...KTLTTLT-------
d3jb9l_ ........................KDCIKTI...EEKY...PLTAVAIAQ-.QGTQVFIGGID.GAIKIWDLRNN...HCSHVLK-------
d4aowa_ ........................GVCKYTVqdeSHSE...WVSCVRFSPNsSNPIIVSCGWD.KLVKVWNLANC...KLKTNHI-------
d4bh6g_ ........................PDPFFETie.SHTQ...EVCGLKWNV-.ADNKLASGGND.NVVHVYEGTSK...SPILTFD-------
d4pswb_ ........................TKPVRTWnd.LHSD...IINDNKWHNF.NKDLFGTVSED.SLLKINDVRANn..TTIDTV--------
d4yvda_ ........................KASVHTLs..GHTN...AVATVRCQA-.AEPQIITGSHD.TTIRLWDLVAG...KTRVTLT-------
d5gmkn1 ........................QGLVQTYd..HHLS...SILALKYFP-.DGSKFISSSED.KTVRIWENQIN...VPIKQISD------


              260                            270            280             290       300           
                |                              |              |               |         |           
d1erja_ GHKDSVYSVVFTR.D....................GQSVVSGSL..DRS...VKLWNL......QNANNKSDSKTPNSGTCEVTYI.G....
d1gotb_ GHESDINAICFFP.N....................GNAFATGSD..DAT...CRLFDL......R------------ADQELMTYS.H....
d1gxra_ DFTSQIFSLGYCP.T....................GEWLAVGME..SSN...VEVLHV......-------------NKPDKYQLH.L....
d1k8kc_ PIRSTVLSLDWHP.N....................SVLLAAGSC..DFK...CRIFSAyikeveERPAPTPWGSKMPFGELMFESS.S....
d1nexb2 GHTALVGLLRLS-.-....................DKFLVSAAA..DGS...IRGWDA......N------------DYSRKFSYHhT....
d1nr0a1 AHSGSVFGLTWSP.D....................GTKIASASA..DKT...IKIWNV......A------------TLKVEKTIP.V....
d1nr0a2 VHPAEITSVAFSN.N....................GAFLVATDQ..SRK...VIPYSV......ANNF---------ELAHTNSWT.F....
d1p22a2 GHKRGIACLQYR-.-....................DRLVVSGSS..DNT...IRLWDI......E------------CGACLRVLE.G....
d1pgua1 PVQGGIFALSWL-.D....................SQKFATVGA..DAT...IRVWDV......T------------TSKCVQKWT.L....
d1pgua2 PLRAKPSYISISP.S....................ETYIAAGDV..MGK...ILLYDL......QS-----------REVKTSRWA.F....
d1sq9a_ NNSNSIRSVKFSP.Q....................GSLLAIAHD..SNSfgcITLYET......E------------FGERIGSLS.Vpths
d1u4ca_ GLKYQIRDVALLPkE....................QEGYACSSI..DGR...VAVEFF......DDQGDDY------NSSKRFAFR.C....
d1vyhc1 EHRHVVECISWAP.EssyssiseatgsetkksgkpGPFLLSGSR..DKT...IKMWDV......S------------TGMCLMTLV.G....
d2gnqa_ DDNPPVSFVKFSP.N....................GKYILAATL..DNT...LKLWDY......S------------KGKCLKTYT.G....
d2ovrb2 GHTNRVYSLQFD-.-....................GIHVVSGSL..DTS...IRVWDV......E------------TGNCIHTLT.G....
d2pbid1 THESDVNSVRYYP.S....................GDAFASGSD..DAT...CRLYDL......R------------ADREVAIYS.K....
d2ymub1 GHSSSVWGVAFSP.D....................GQTIASASD..DKT...VKLWNR......-------------NGQLLQTLT.G....
d3gfca_ AHTAEVNCLSFNPyS....................EFILATGSA..DKT...VALWDL......RN-----------LKLKLHSFE.S....
d3jb9k_ HHKKTVRALSLHP.D....................EFTFASGSS..-DN...IKHWKF......P------------EGAFMGNFE.G....
d3jb9l_ GHKDIITSLAISK.D....................GSSLLSNSM..DNT...VRIFDV......KPFAS--------AQRQLQIFE.G....
d4aowa_ GHTGYLNTVTVSP.D....................GSLCASGGK..DGQ...AMLWDL......N------------EGKHLYTLD.G....
d4bh6g_ EHKAAVKAMAWSPhK....................RGVLATGGGtaDRR...LKIWNV......N------------TSIKMSDID.S....
d4pswb_ KCPQPFNTLAFSHhS....................SNLLAAAGM..DSY...VYLYDL......RN-----------MKEPLHHMS.G....
d4yvda_ NHKKSVRAVVLHP.R....................HYTFASGSP..-DN...IKQWKF......P------------DGSFIQNLS.G....
d5gmkn1 TAQHSMPFLNVHP.S....................QNYFCAQSM..DNR...IYSFSL......KPKY---------KRHPKKIFK.G....


                           310                 320         330                              340     
                             |                   |           |                                |     
d1erja_ .........HKD.........FVLSVATTQ..........NDEYILSGS..KDRGVLFWDK.........KS..............GNPLLM
d1gotb_ .........-DNiic......GITSVSFSK..........SGRLLLAGY..DDFNCNVWDA.........LK..............ADRAGV
d1gxra_ .........HES.........CVLSLKFAY..........CGKWFVSTG..KDNLLNAWRT.........PY..............GASIFQ
d1k8kc_ .........SCG.........WVHGVCFSA..........NGSRVAWVS..HDSTVCLADA.........DK..............KMAVAT
d1nexb2 .........NLS.........AITTFYVS-..........-DNILVSGS..ENQ-FNIYNL.........RS..............GKLVHA
d1nr0a1 .........GTRied......QQLGIIWT-..........-KQALVSIS..ANGFINFVN-.........--..............------
d1nr0a2 .........HTA.........KVACVSWSP..........DNVRLATGS..LDNSVIVWNMnk.......PS..............DHPIII
d1p22a2 .........HEE.........LVRCIRFD-..........-NKRIVSGA..YDGKIKVWDLvaaldprapAG..............TLCLRT
d1pgua1 .........DKQql.......GNQQVGVVAt.........GNGRIISLS..LDGTLNFYE-.........--..............------
d1pgua2 .........RTS.........KINAISWKPaekganeeeiEEDLVATGS..LDTNIFIYSVk........RP..............MKIIKA
d1sq9a_ sqaslgefaHSS.........WVMSLSFND..........SGETLCSAG..WDGKLRFWDV.........KT..............KERITT
d1u4ca_ .........HRLnlkdtnlayPVNSIEFSP..........RHKFLYTAG..SDGIISCWNL.........QT..............RKKIKN
d1vyhc1 .........HDN.........WVRGVLFHS..........GGKFILSCA..DDKTLRVWDY.........KN..............KRCMKT
d2gnqa_ .........HKN.........EKYCIFANFsvt.......GGKWIVSGS..EDNLVYIWNL.........QT..............KEIVQK
d2ovrb2 .........HQS.........LTSGMELK-..........-DNILVSGN..ADSTVKIWDI.........KT..............GQCLQT
d2pbid1 .........-ESiif......GASSVDFSL..........SGRLLFAGY..NDYTINVWDV.........LK..............GSRVSI
d2ymub1 .........HSS.........SVRGVAFSP..........DGQTIASAS..DDKTVKLWN-.........RN..............GQLLQT
d3gfca_ .........HKD.........EIFQVQWSPh.........NETILASSG..TDRRLNVWDL.........SKigeeqspedaedgpPELLFI
d3jb9k_ .........HNA.........IVNTLSIN-..........SDNVMFSGA..DNGSMCFWDW.........KS..............GHKYQE
d3jb9l_ .........AIHgqeh.....NLLGVAWSR..........NSRFVGAGS..SDKNVYVWS-.........AT..............GDLRYV
d4aowa_ .........-GD.........IINALCFSP..........NRYWLCAAT..GPS-IKIWDL.........EG..............KIIVDE
d4bh6g_ .........-GS.........QICNMVWSK..........NTNELVTSHgySKYNLTLWDC.........NS..............MDPIAI
d4pswb_ .........HED.........AVNNLEFSTh.........VDGVVVSSG..SDNRLMMWDL.........KQigaeqtpddaedgvPELIMV
d4yvda_ .........HNA.........IINTLTVN-..........SDGVLVSGA..DNGTMHLWDW.........RT..............GYNFQR
d5gmkn1 .........HSSag.......YGISLAFSG..........DGRYICSGD..SKSRLFTWDW.........NT..............SRLLNN


             350                  360        370          380                                       
               |                    |          |            |                                       
d1erja_ LQ...GHRN...........SVISVAVANGSSLGPEY.NVFATG.SG..DCKARIWKYK--ki.............................
d1gotb_ LA...GHDN...........RVSCLG------VTDDG.MAVATG.SW..DSFLKIWN----...............................
d1gxra_ SK...E-SS...........SVLSCD------ISVDD.KYIVTG.SG..DKKATVYE----viy............................
d1k8kc_ LA...SETL...........PLLAVT------FITES.SLVAAG.HD..------------cfpvlftydsaagklsfggrldvpkqssqrg
d1nexb2 NIl..KDAD...........QIWSVN-----------.------.--..------------fkgktlvaavekdgqsfleildfs.......
d1nr0a1 --...----...........-----------------.------.--..------------pe.............................
d1nr0a2 KGa..HAMS...........SVNSVI------WL-NE.TTIVSA.GQ..DSNIKFWNV---pf.............................
d1p22a2 LV...EHSG...........RVFRLQ------FD--E.FQIVSS.SH..DDTILIWD----...............................
d1pgua1 --...----...........-----------------.------.--..------------l..............................
d1pgua2 LN...AHKD...........GVNNLL------W-ETP.STLVSS.GA..DACIKRWNV---v..............................
d1sq9a_ LN...MHCDdieieedilavD----------------.------.--..------------ehgdslaepgvfdvkflkkgwrsgmgadlne
d1u4ca_ FAk..FNED...........SVVKIA------CSDNI.LCLATS.DD..------------tfktnaaidqtielnassiyiifdye.....
d1vyhc1 LN...AHEH...........FVTSLD------FHKTA.PYVVTG.SV..DQTVKVWE----...............................
d2gnqa_ LQ...GHTD...........VVISTA------CHPTE.NIIASA.ALenDKTIKLWK----sdc............................
d2ovrb2 LQgpnKHQS...........AVTCLQ------FN--K.NFVITS.SD..DGTVKLWDLKT-gefirnlvtlesggsggvvwrirasntklvc
d2pbid1 LF...GHEN...........RVSTLR------VSPDG.TAFCSG.SW..DHTLRVW-----a..............................
d2ymub1 LT...GHSS...........SVNGVA------FRPDG.QTIASA.SD..DKTVKLWN----...............................
d3gfca_ HG...GHTA...........KISDFS------WNPNE.PWVICSvSE..DNIMQVWQM---aeniyn.........................
d3jb9k_ LQsv.VQPGsldsea.....GIFASS------FDKTG.LRLITC.EA..DKSVKIYK----qvdnatpethpnlpwtpsnlr..........
d3jb9l_ LP...GHEG...........SVNHVD------FHPHQ.DIILSC.SS..DRTIFL------geln...........................
d4aowa_ LKqevISTSskaepp.....QCTSLA------WSADG.QTLFAG.YT..DNLVRVWQV---ti.............................
d4bh6g_ LK...GHSF...........RVLHLT------LSNDG.TTVVSG.AG..DETLRYWKL---fdk............................
d4pswb_ HA...GHRS...........SVNDFD------LNPQI.PWLVAS.AEe.ENILQVWKCS--hslpivg........................
d4yvda_ VHaa.VQPGsldses.....GIFACA------FDQSE.SRLLTA.EA..DKTIKVYR----ed.............................
d5gmkn1 IKi..PGNK...........PITQVD------WHPQEtSKVICS.GA..AGKIYVC-----d..............................


                                                                                     
                                                                                     
d1erja_ .............................................................................
d1gotb_ .............................................................................
d1gxra_ .............................................................................
d1k8kc_ ltarerfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
d1nexb2 .............................................................................
d1nr0a1 .............................................................................
d1nr0a2 .............................................................................
d1p22a2 .............................................................................
d1pgua1 .............................................................................
d1pgua2 .............................................................................
d1sq9a_ slccvcldrsirwfreag...........................................................
d1u4ca_ .............................................................................
d1vyhc1 .............................................................................
d2gnqa_ .............................................................................
d2ovrb2 avgsrngteetkllvldfdvdm.......................................................
d2pbid1 .............................................................................
d2ymub1 .............................................................................
d3gfca_ .............................................................................
d3jb9k_ .............................................................................
d3jb9l_ .............................................................................
d4aowa_ .............................................................................
d4bh6g_ .............................................................................
d4pswb_ .............................................................................
d4yvda_ .............................................................................
d5gmkn1 .............................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046612 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Ilumatobacter coccineus
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium marinum M
NoYes   Cellulomonas fimi ATCC 484
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Clostridium cellulolyticum H10
NoYes   Ruminococcus albus 7
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfotomaculum reducens MI-1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Streptococcus agalactiae A909
NoYes   Exiguobacterium sp. MH3
NoYes   Paenibacillus terrae HPL-003
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pumilus SAFR-032
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Marivirga tractuosa DSM 4126
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Maribacter sp. HTCC2170
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Polaribacter sp. MED152
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Opitutus terrae PB90-1
NoYes   Turneriella parva DSM 21527
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema denticola ATCC 35405
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Persephonella marina EX-H1
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Candidatus Nitrospira defluvii
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phymatum STM815
NoYes   Ralstonia eutropha JMP134
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Magnetococcus marinus MC-1
NoYes   Asticcacaulis excentricus CB 48
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Tistrella mobilis KA081020-065
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Rhizobium etli CIAT 652
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella clarridgeiae 73
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Saccharophagus degradans 2-40
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella loihica PV-4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella baltica OS185
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Alteromonas sp. SN2
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas mediterranea MMB-1
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Providencia stuartii MRSN 2154
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Methylophaga sp. JAM1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Cenarchaeum symbiosum A
NoYes   Fervidicoccus fontis Kam940
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Thermococcus barophilus MP
NoYes   Methanobrevibacter ruminantium M1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. PCC 7002
NoYes   Prochlorococcus marinus str. NATL1A
NoYes   Prochlorococcus marinus str. MIT 9301
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus subsp. marinus str. CCMP1375
NoYes   Prochlorococcus marinus subsp. pastoris str. CCMP1986
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Prochlorococcus marinus str. MIT 9211
NoYes   Prochlorococcus marinus str. MIT 9312
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Prochlorococcus marinus str. NATL2A
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Bifidobacterium asteroides PRL2011
NoYes   Actinomyces graevenitzii C83
NoYes   Actinomyces viscosus C505
NoYes   Chthonomonas calidirosea T49
NoYes   Thermus thermophilus HB8
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Streptococcus iniae SF1
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Paenibacillus polymyxa CR1
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Chlorobium phaeobacteroides BS1
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Helicobacter cinaedi ATCC BAA-847
NoYes   Borrelia garinii NMJW1
NoYes   Borrelia garinii BgVir
NoYes   Borrelia afzelii HLJ01
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi CA382
NoYes   Borrelia burgdorferi JD1
NoYes   Borrelia burgdorferi N40
NoYes   Borrelia burgdorferi ZS7
NoYes   Borrelia miyamotoi LB-2001
NoYes   Treponema pedis str. T A4
NoYes   Thermotoga maritima MSB8
NoYes   Arcobacter butzleri 7h1h
NoYes   Arcobacter butzleri ED-1
NoYes   Campylobacter jejuni Waterborne C.jejuni Outbreak
NoYes   Campylobacter jejuni RM1221
NoYes   Campylobacter jejuni subsp. jejuni 00-2544
NoYes   Campylobacter jejuni subsp. jejuni 00-2538
NoYes   Campylobacter jejuni subsp. jejuni 00-2426
NoYes   Campylobacter jejuni subsp. jejuni 00-2425
NoYes   Campylobacter jejuni subsp. jejuni PT14
NoYes   Campylobacter jejuni subsp. jejuni ICDCCJ07001
NoYes   Campylobacter jejuni subsp. jejuni S3
NoYes   Campylobacter jejuni subsp. jejuni M1
NoYes   Campylobacter jejuni subsp. jejuni IA3902
NoYes   Campylobacter jejuni subsp. jejuni 81116
NoYes   Campylobacter jejuni subsp. jejuni 81-176
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
NoYes   Campylobacter coli 76339
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Helicobacter cetorum MIT 99-5656
NoYes   Helicobacter pylori BM012S
NoYes   Helicobacter pylori BM012A
NoYes   Helicobacter pylori SouthAfrica20
NoYes   Helicobacter pylori UM298
NoYes   Helicobacter pylori UM066
NoYes   Helicobacter pylori UM037
NoYes   Helicobacter pylori UM299
NoYes   Helicobacter pylori UM032
NoYes   Helicobacter pylori OK310
NoYes   Helicobacter pylori OK113
NoYes   Helicobacter pylori Rif2
NoYes   Helicobacter pylori Rif1
NoYes   Helicobacter pylori HUP-B14
NoYes   Helicobacter pylori PeCan18
NoYes   Helicobacter pylori Shi169
NoYes   Helicobacter pylori Shi112
NoYes   Helicobacter pylori Shi417
NoYes   Helicobacter pylori XZ274
NoYes   Helicobacter pylori Aklavik117
NoYes   Helicobacter pylori SNT49
NoYes   Helicobacter pylori Puno135
NoYes   Helicobacter pylori Puno120
NoYes   Helicobacter pylori ELS37
NoYes   Helicobacter pylori Gambia94/24
NoYes   Helicobacter pylori SouthAfrica7
NoYes   Helicobacter pylori India7
NoYes   Helicobacter pylori Lithuania75
NoYes   Helicobacter pylori 2017
NoYes   Helicobacter pylori 2018
NoYes   Helicobacter pylori 908
NoYes   Helicobacter pylori F57
NoYes   Helicobacter pylori F30
NoYes   Helicobacter pylori F16
NoYes   Helicobacter pylori Sat464
NoYes   Helicobacter pylori Cuz20
NoYes   Helicobacter pylori PeCan4
NoYes   Helicobacter pylori SJM180
NoYes   Helicobacter pylori B8
NoYes   Helicobacter pylori 52
NoYes   Helicobacter pylori v225d
NoYes   Helicobacter pylori 83
NoYes   Helicobacter pylori 35A
NoYes   Helicobacter pylori P12
NoYes   Helicobacter pylori G27
NoYes   Helicobacter pylori Shi470
NoYes   Helicobacter pylori HPAG1
NoYes   Helicobacter pylori 51
NoYes   Helicobacter pylori F32
NoYes   Helicobacter pylori 26695
NoYes   Helicobacter pylori 26695
NoYes   Desulfobacula toluolica Tol2
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans H24
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Bartonella vinsonii subsp. berkhoffii str. Winnie
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Idiomarina loihiensis GSL 199
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS223
NoYes   Shewanella sp. MR-7
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Thioflavicoccus mobilis 8321
NoYes   Dickeya dadantii 3937
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter lwoffii SH145
NoYes   Methylophaga sp. JAM7
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Guillardia theta
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Core Eukaryotic Genes 458 (CEGMA)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]