SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Quinoprotein alcohol dehydrogenase-like alignments in Homo sapiens 76_38

These alignments are sequences aligned to the 0046933 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1g72a_            dadldkq..........................................................................
ENSP00000355148  pfk..............................................................................
ENSP00000348129  fk...............................................................................
ENSP00000482107  gdfn.............................................................................
ENSP00000291576  gdfn.............................................................................
ENSP00000339449  qaintk...........................................................................
ENSP00000331815  i................................................................................
ENSP00000371888  sdpv.............................................................................
ENSP00000380313  sdpv.............................................................................
ENSP00000455046  sdpv.............................................................................
ENSP00000456405  sdpv.............................................................................
ENSP00000457870  sdpv.............................................................................
ENSP00000280190  g................................................................................
ENSP00000422763  g................................................................................
ENSP00000422200  g................................................................................
ENSP00000384792  ylagc............................................................................
ENSP00000481995  a................................................................................
ENSP00000384939  tel..............................................................................
ENSP00000385059  tel..............................................................................
ENSP00000450541  tngqr............................................................................
ENSP00000320663  tel..............................................................................
ENSP00000448161  v................................................................................
ENSP00000270301  gltcdpgtghvayla..................................................................
ENSP00000426154  vah..............................................................................
ENSP00000423760  e................................................................................
ENSP00000473564  e................................................................................
ENSP00000205214  e................................................................................
ENSP00000327384  el...............................................................................
ENSP00000334314  el...............................................................................
ENSP00000262233  el...............................................................................
ENSP00000371889  lr...............................................................................
ENSP00000426725  lr...............................................................................
ENSP00000348842  qlrlewvygyrghqcrnnlyy............................................................
ENSP00000245925  psc..............................................................................
ENSP00000414851  llafgtscs........................................................................
ENSP00000442365  psc..............................................................................
ENSP00000447548  pggplrat.........................................................................
ENSP00000464789  psc..............................................................................
ENSP00000451998  ynrqqn...........................................................................
ENSP00000370039  ynrqqn...........................................................................
ENSP00000361570  gepqnylaht.......................................................................
ENSP00000468312  scr..............................................................................
ENSP00000285873  ql...............................................................................
ENSP00000378254  pp...............................................................................
ENSP00000278845  pp...............................................................................
ENSP00000293879  edlhsg...........................................................................
ENSP00000435310  qnylaht..........................................................................
ENSP00000448122  sgngranmvwrpdtgf.................................................................
ENSP00000348842  y................................................................................
ENSP00000314193  ad...............................................................................
ENSP00000447224  hkvv.............................................................................
ENSP00000447224  gplrat...........................................................................
ENSP00000293879  tvtvmgsasldellrvdigtldlassr......................................................
ENSP00000254442  ral..............................................................................
ENSP00000350187  ral..............................................................................
ENSP00000416289  .................................................................................
ENSP00000389144  hvpdtvlcdvhs.....................................................................
ENSP00000310686  hvpdtvlcdvhs.....................................................................
ENSP00000288912  ltmtwsfgwnsslpvyyireerqrvl.......................................................
ENSP00000452765  itd..............................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  kapphsitaim......................................................................
ENSP00000396295  e................................................................................
ENSP00000370039  diiyhtasvgilhnvatg...............................................................
ENSP00000451998  iiyhtasvgilhnvatg................................................................
ENSP00000464109  gre..............................................................................
ENSP00000458843  i................................................................................
ENSP00000484308  tssg.............................................................................
ENSP00000368025  ssg..............................................................................
ENSP00000260643  alqvdpstglliaaggggaaktgikngvhflqlelingrlsasllhshdtetratmnlalagdilaagqdahcqllrfqah
ENSP00000440796  .................................................................................
ENSP00000335522  r................................................................................
ENSP00000462737  gre..............................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  v................................................................................
ENSP00000401445  ststvtlpe........................................................................
ENSP00000307235  lv...............................................................................
ENSP00000256797  e................................................................................
ENSP00000413812  e................................................................................
ENSP00000370348  geveipsskatv.....................................................................
ENSP00000394097  geveipsskatv.....................................................................
ENSP00000442365  kcs..............................................................................
ENSP00000378254  rcm..............................................................................
ENSP00000433417  m................................................................................
ENSP00000278845  m................................................................................
ENSP00000364345  gkf..............................................................................
ENSP00000420608  gkfd.............................................................................
ENSP00000466100  n................................................................................
ENSP00000217964  idgeveipsskatv...................................................................
ENSP00000385988  idgeveipsskatv...................................................................
ENSP00000471331  fvvfvvsfvipcpdrp.................................................................
ENSP00000301678  fvvfvvsfvipcpdrp.................................................................
ENSP00000382814  fvvfvvsfvipcpdrp.................................................................
ENSP00000301679  fvvfvvsfvipcpdrp.................................................................
ENSP00000483191  gnakh............................................................................
ENSP00000197268  l................................................................................
ENSP00000394063  l................................................................................
ENSP00000412076  vf...............................................................................
ENSP00000409656  e................................................................................
ENSP00000421171  e................................................................................
ENSP00000398526  cl...............................................................................
ENSP00000317469  lvl..............................................................................
ENSP00000465994  qpl..............................................................................
ENSP00000364354  gkfdwrq..........................................................................
ENSP00000408325  dgalfqwdqdresmetvpftvesllessykf..................................................
ENSP00000457361  e................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  fvvfvvsfvipcpdr..................................................................
ENSP00000398433  fvvfvvsfvipcpdr..................................................................
ENSP00000407669  fvvfvvsfvipcpdrpas...............................................................
ENSP00000451998  dtmmca...........................................................................
ENSP00000432762  tgrpy............................................................................
ENSP00000433942  tgrpy............................................................................
ENSP00000482352  tgrpy............................................................................
ENSP00000403323  tgrpy............................................................................
ENSP00000477741  tgrpy............................................................................
ENSP00000355464  lclydlgiskvvkavvlpgrvtaiepiinhggasastqhlh........................................
ENSP00000355465  lclydlgiskvvkavvlpgrvtaiepiinhggasastqhlh........................................


                                                                                       10        20 
                                                                                        |         | 
d1g72a_            ............................................................-------VNTAGAWPIATGGY
ENSP00000355148  ............................................................---------------------
ENSP00000348129  ............................................................---------------------
ENSP00000482107  ............................................................---------------------
ENSP00000291576  ............................................................---------------------
ENSP00000339449  ............................................................---------------------
ENSP00000331815  ............................................................---------------------
ENSP00000371888  ............................................................---------------------
ENSP00000380313  ............................................................---------------------
ENSP00000455046  ............................................................---------------------
ENSP00000456405  ............................................................---------------------
ENSP00000457870  ............................................................---------------------
ENSP00000280190  ............................................................---------------------
ENSP00000422763  ............................................................---------------------
ENSP00000422200  ............................................................---------------------
ENSP00000384792  ............................................................---------------------
ENSP00000481995  ............................................................---------------------
ENSP00000384939  ............................................................---------------------
ENSP00000385059  ............................................................---------------------
ENSP00000450541  ............................................................---------------------
ENSP00000320663  ............................................................---------------------
ENSP00000448161  ............................................................---------------------
ENSP00000270301  ............................................................---------------------
ENSP00000426154  ............................................................---------------------
ENSP00000423760  ............................................................---------------------
ENSP00000473564  ............................................................---------------------
ENSP00000205214  ............................................................---------------------
ENSP00000327384  ............................................................---------------------
ENSP00000334314  ............................................................---------------------
ENSP00000262233  ............................................................---------------------
ENSP00000371889  ............................................................---------------------
ENSP00000426725  ............................................................---------------------
ENSP00000348842  ............................................................---------------------
ENSP00000245925  ............................................................---------------------
ENSP00000414851  ............................................................---------------------
ENSP00000442365  ............................................................---------------------
ENSP00000447548  ............................................................---------------------
ENSP00000464789  ............................................................---------------------
ENSP00000451998  ............................................................---------------------
ENSP00000370039  ............................................................---------------------
ENSP00000361570  ............................................................---------------------
ENSP00000468312  ............................................................---------------------
ENSP00000285873  ............................................................---------------------
ENSP00000378254  ............................................................---------------------
ENSP00000278845  ............................................................---------------------
ENSP00000293879  ............................................................---------------------
ENSP00000435310  ............................................................---------------------
ENSP00000448122  ............................................................---------------------
ENSP00000348842  ............................................................---------------------
ENSP00000314193  ............................................................---------------------
ENSP00000447224  ............................................................---------------------
ENSP00000447224  ............................................................---------------------
ENSP00000293879  ............................................................---------------------
ENSP00000254442  ............................................................---------------------
ENSP00000350187  ............................................................---------------------
ENSP00000416289  ............................................................---------------------
ENSP00000389144  ............................................................---------------------
ENSP00000310686  ............................................................---------------------
ENSP00000288912  ............................................................---------------------
ENSP00000452765  ............................................................---------------------
ENSP00000456709  ............................................................---------------------
ENSP00000453378  ............................................................---------------------
ENSP00000396295  ............................................................---------------------
ENSP00000370039  ............................................................---------------------
ENSP00000451998  ............................................................---------------------
ENSP00000464109  ............................................................---------------------
ENSP00000458843  ............................................................---------------------
ENSP00000484308  ............................................................---------------------
ENSP00000368025  ............................................................---------------------
ENSP00000260643  qqqgnkaekagskeqgprqrkgaapaekkcgaetqheglelrvenlqavqtdfssdplqk---------------------
ENSP00000440796  ............................................................---------------------
ENSP00000335522  ............................................................---------------------
ENSP00000462737  ............................................................---------------------
ENSP00000445814  ............................................................---------------------
ENSP00000464095  ............................................................---------------------
ENSP00000401445  ............................................................---------------------
ENSP00000307235  ............................................................---------------------
ENSP00000256797  ............................................................---------------------
ENSP00000413812  ............................................................---------------------
ENSP00000370348  ............................................................---------------------
ENSP00000394097  ............................................................---------------------
ENSP00000442365  ............................................................---------------------
ENSP00000378254  ............................................................---------------------
ENSP00000433417  ............................................................---------------------
ENSP00000278845  ............................................................---------------------
ENSP00000364345  ............................................................---------------------
ENSP00000420608  ............................................................---------------------
ENSP00000466100  ............................................................---------------------
ENSP00000217964  ............................................................---------------------
ENSP00000385988  ............................................................---------------------
ENSP00000471331  ............................................................---------------------
ENSP00000301678  ............................................................---------------------
ENSP00000382814  ............................................................---------------------
ENSP00000301679  ............................................................---------------------
ENSP00000483191  ............................................................---------------------
ENSP00000197268  ............................................................---------------------
ENSP00000394063  ............................................................---------------------
ENSP00000412076  ............................................................---------------------
ENSP00000409656  ............................................................---------------------
ENSP00000421171  ............................................................---------------------
ENSP00000398526  ............................................................---------------------
ENSP00000317469  ............................................................---------------------
ENSP00000465994  ............................................................---------------------
ENSP00000364354  ............................................................---------------------
ENSP00000408325  ............................................................---------------------
ENSP00000457361  ............................................................---------------------
ENSP00000405764  ............................................................---------------------
ENSP00000399150  ............................................................---------------------
ENSP00000398433  ............................................................---------------------
ENSP00000407669  ............................................................---------------------
ENSP00000451998  ............................................................---------------------
ENSP00000432762  ............................................................---------------------
ENSP00000433942  ............................................................---------------------
ENSP00000482352  ............................................................---------------------
ENSP00000403323  ............................................................---------------------
ENSP00000477741  ............................................................---------------------
ENSP00000355464  ............................................................---------------------
ENSP00000355465  ............................................................---------------------


                          30        40         50           60                  70                  
                           |         |          |            |                   |                  
d1g72a_            YSQHNSPLAQINKSNVKNVKAAWSFST.GVLNG...HEGAPLVI........GDM..MYVHSAFPN...............
ENSP00000355148  ---------------------------.-----...--------........---..---------...............
ENSP00000348129  ---------------------------.-----...--------........---..---------...............
ENSP00000482107  ---------------------------.-----...--------........---..---------...............
ENSP00000291576  ---------------------------.-----...--------........---..---------...............
ENSP00000339449  ---------------------------.-----...--------........---..---------...............
ENSP00000331815  ---------------------------.-----...--------........---..---------...............
ENSP00000371888  ---------------------------.-----...--------........---..---------...............
ENSP00000380313  ---------------------------.-----...--------........---..---------...............
ENSP00000455046  ---------------------------.-----...--------........---..---------...............
ENSP00000456405  ---------------------------.-----...--------........---..---------...............
ENSP00000457870  ---------------------------.-----...--------........---..---------...............
ENSP00000280190  ---------------------------.-----...--------........---..---------...............
ENSP00000422763  ---------------------------.-----...--------........---..---------...............
ENSP00000422200  ---------------------------.-----...--------........---..---------...............
ENSP00000384792  ---------------------------.-----...--------........---..---------...............
ENSP00000481995  ---------------------------.-----...--------........---..---------...............
ENSP00000384939  --------------PPEKLKLEWAYGYrGKDCR...ANVYLLPT........GKI..VYFIAS---...............
ENSP00000385059  --------------PPEKLKLEWAYGYrGKDCR...ANVYLLPT........GKI..VYFIAS---...............
ENSP00000450541  ---------------------------.-----...--------........---..AAVGTA-NG...............
ENSP00000320663  --------------PPEKLKLEWAYGYrGKDCR...ANVYLLPT........GKI..VYFIAS---...............
ENSP00000448161  ---------------------------.-----...--------........---..---------...............
ENSP00000270301  ---------------------------.-----...--------........---..----GC---...............
ENSP00000426154  ---------------------------.-----...--------........---..---------...............
ENSP00000423760  ------------------LHVRWRSDT.GKC--...VDASPLVViptfdks.STT..VYIGSH-SH...............
ENSP00000473564  ------------------LHVRWRSDT.GKC--...VDASPLVViptfdks.STT..VYIGSH-SH...............
ENSP00000205214  ------------------LHVRWRSDT.GKC--...VDASPLVViptfdks.STT..VYIGSH-SH...............
ENSP00000327384  --------------PTKRLKLEWVYGYrGRDCR...NNLYLLPT........GET..VYFIAS---...............
ENSP00000334314  --------------PTKRLKLEWVYGYrGRDCR...NNLYLLPT........GET..VYFIAS---...............
ENSP00000262233  --------------PTKRLKLEWVYGYrGRDCR...NNLYLLPT........GET..VYFIAS---...............
ENSP00000371889  ---------------------------.-----...--------........---..---------...............
ENSP00000426725  ---------------------------.-----...--------........---..---------...............
ENSP00000348842  ---------------------------.-----...-----TAG........KEV..VYFVAGV--...............
ENSP00000245925  -----------------RLKLEWVYGYrGRDCR...ANLYLLPT........GEI..VYFVAS---...............
ENSP00000414851  ---------------------------.-----...--------........---..---------...............
ENSP00000442365  -----------------RLKLEWVYGYrGRDCR...ANLYLLPT........GEI..VYFVAS---...............
ENSP00000447548  ---------------------------.-----...--------........---..---------...............
ENSP00000464789  -----------------RLKLEWVYGYrGRDCR...ANLYLLPT........GEI..VYFVAS---...............
ENSP00000451998  ---------------------------.-----...--------........---..---------...............
ENSP00000370039  ---------------------------.-----...--------........---..---------...............
ENSP00000361570  ---------------------------.-----...-----WVA........DDK..IVVGTD-TG...............
ENSP00000468312  ------------------LKLEWVYGYrGRDCR...ANLYLLPT........GEI..VYFVAS---...............
ENSP00000285873  ---------------------------.-----...--------........---..--VSSCFGG...............
ENSP00000378254  ---------------PETLSLDWVYGYrGRDSR...SNLFVLRS........GEV..VYFIAC---...............
ENSP00000278845  ---------------PETLSLDWVYGYrGRDSR...SNLFVLRS........GEV..VYFIAC---...............
ENSP00000293879  ---------------------------.-----...--------........---..---------...............
ENSP00000435310  ---------------------------.-----...-----WVA........DDK..IVVGTD-TG...............
ENSP00000448122  ---------------------------.-----...--------........---..-FAYTC-GR...............
ENSP00000348842  ---------------------------.-----...--------........---..---------...............
ENSP00000314193  ---------------------------.-----...--------........---..---------...............
ENSP00000447224  ---------------------------.-----...--------........---..--YSAS-GS...............
ENSP00000447224  ---------------------------.-----...--------........---..---------...............
ENSP00000293879  ---------------------------.-----...--------........---..---------...............
ENSP00000254442  ---------------------------.-----...--------........---..---------...............
ENSP00000350187  ---------------------------.-----...--------........---..---------...............
ENSP00000416289  ---------------------------.-----...--------........---..---------...............
ENSP00000389144  ---------------------------.-----...-------H........DGV..VIAGYT-SG...............
ENSP00000310686  ---------------------------.-----...-------H........DGV..VIAGYT-SG...............
ENSP00000288912  ---------------------------.-----...--------........---..LYVCAH---...............
ENSP00000452765  ---------------------------.-----...--------........DQR..TIVTGSQEG...............
ENSP00000456709  ---------------------------.-----...--------........---..---------...............
ENSP00000453378  ---------------------------.-----...-----ITD........DQR..TIVTGSQEG...............
ENSP00000396295  ---------------------------.-----...--------........---..---------...............
ENSP00000370039  ---------------------------.-----...--------........---..---------...............
ENSP00000451998  ---------------------------.-----...--------........---..---------...............
ENSP00000464109  ---------------------------.-----...--------........---..---------...............
ENSP00000458843  ---------------------------.-----...--------........---..---------...............
ENSP00000484308  ---------------------------.-----...--------........---..---------...............
ENSP00000368025  ---------------------------.-----...--------........---..---------...............
ENSP00000260643  ---------------------------.-----...--------........---..---------...............
ENSP00000440796  ---------------------------.-----...--------........---..---------...............
ENSP00000335522  ---------------------------.-----...--------........---..---------...............
ENSP00000462737  ---------------------------.-----...--------........---..---------...............
ENSP00000445814  ---------------------------.-----...--------........---..---------...............
ENSP00000464095  ---------------------------.-----...--------........---..---------...............
ENSP00000401445  ---------------------------.-----...--------........---..---------...............
ENSP00000307235  ---------------------------.-----...--------........---..-IISTL-DG...............
ENSP00000256797  ---------------------------.-----...--------........---..---------...............
ENSP00000413812  ---------------------------.-----...--------........---..---------...............
ENSP00000370348  ---------------------------.-----...--------........---..---------...............
ENSP00000394097  ---------------------------.-----...--------........---..---------...............
ENSP00000442365  ---------------------------.-----...--------........---..---------...............
ENSP00000378254  ---------------------------.-----...--------........---..---------...............
ENSP00000433417  ---------------------------.-----...--------........---..---------...............
ENSP00000278845  ---------------------------.-----...--------........---..---------...............
ENSP00000364345  ---------------------------.-----...--------........---..---------...............
ENSP00000420608  ---------------------------.-----...--------........---..---------...............
ENSP00000466100  ---------------------------.-----...--------........---..---------...............
ENSP00000217964  ---------------------------.-----...--------........---..---------...............
ENSP00000385988  ---------------------------.-----...--------........---..---------...............
ENSP00000471331  -----------------ASQRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscvdegfs
ENSP00000301678  -----------------ASQRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscvdegfs
ENSP00000382814  -----------------ASQRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscvdegfs
ENSP00000301679  -----------------ASQRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscvdegfs
ENSP00000483191  ---------------------------.-----...--------........---..---------...............
ENSP00000197268  -----------IPCPPRDLHSTWSRHL.GSQGG...GDLSPLELadvngdglRDVllSFVMSR-NGsavgvsrpaa.....
ENSP00000394063  -----------IPCPPRDLHSTWSRHL.GSQGG...GDLSPLELadvngdglRDVllSFVMSR-NGsavgvsrpaa.....
ENSP00000412076  ---------------------------.-----...--------........---..---------...............
ENSP00000409656  ------------------LHVRWRSDT.GKC--...VDASPLVV........---..---------...............
ENSP00000421171  ------------------LHVRWRSDT.GKC--...VDASPLVV........---..---------...............
ENSP00000398526  ---------------------------.-----...--------........---..---------...............
ENSP00000317469  ---------------------------.-----...--------........---..---------...............
ENSP00000465994  ---------------------------.-----...--------........---..---------...............
ENSP00000364354  ---------------------------.-----...--------........---..---------...............
ENSP00000408325  ---------------------------.-----...--------........---..---------...............
ENSP00000457361  ---------------------------.-----...--------........---..---------...............
ENSP00000405764  ---------------------------.-----...--------........---..---------...............
ENSP00000399150  ----------------PASQRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscvdegfs
ENSP00000398433  ----------------PASQRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscvdegfs
ENSP00000407669  -------------------QRMWRIDY.SAAVI...YDFLAVDDingdri..QDV..LFLYKNT-Nssnnfsrscv.....
ENSP00000451998  ---------------------------.-----...--------........---..---------...............
ENSP00000432762  ------------YYNPDTGVTTWESPF.EAAEGaasPATSPASV........DSH..VSLETEWGQywdeesr........
ENSP00000433942  ------------YYNPDTGVTTWESPF.EAAEGaasPATSPASV........DSH..VSLETEWGQywdeesr........
ENSP00000482352  ------------YYNPDTGVTTWESPF.EAAEGaasPATSPASV........DSH..VSLETEWGQywdeesr........
ENSP00000403323  ------------YYNPDTGVTTWESPF.EAAEGaasPATSPASV........DSH..VSLETEWGQywdeesr........
ENSP00000477741  ------------YYNPDTGVTTWESPF.EAAEGaasPATSPASV........DSH..VSLETEWGQywdeesr........
ENSP00000355464  ---------------------------.-----...--------........---..---------...............
ENSP00000355465  ---------------------------.-----...--------........---..---------...............


                            80        90                                                            
                             |         |                                                            
d1g72a_            ....NTYALNLNDPGKIVWQHKP..........................................................
ENSP00000355148  ....-------------------..........................................................
ENSP00000348129  ....-------------------..........................................................
ENSP00000482107  ....-------------------..........................................................
ENSP00000291576  ....-------------------..........................................................
ENSP00000339449  ....-------------------..........................................................
ENSP00000331815  ....-------------------..........................................................
ENSP00000371888  ....-------------------..........................................................
ENSP00000380313  ....-------------------..........................................................
ENSP00000455046  ....-------------------..........................................................
ENSP00000456405  ....-------------------..........................................................
ENSP00000457870  ....-------------------..........................................................
ENSP00000280190  ....-------------------..........................................................
ENSP00000422763  ....-------------------..........................................................
ENSP00000422200  ....-------------------..........................................................
ENSP00000384792  ....VVVILDPKEN-K-------..........................................................
ENSP00000481995  ....-------------------..........................................................
ENSP00000384939  ....VVVLFNYEER---------..........................................................
ENSP00000385059  ....VVVLFNYEER---------..........................................................
ENSP00000450541  ....TVYLLDLRTW---------..........................................................
ENSP00000320663  ....VVVLFNYEER---------..........................................................
ENSP00000448161  ....-------------------..........................................................
ENSP00000270301  ....VVVILDPKEN-K-------..........................................................
ENSP00000426154  ....-------------------..........................................................
ENSP00000423760  ....RMKAVDFYS-GKVKWEQIL..........................................................
ENSP00000473564  ....RMKAVDFYS-GKVKWEQIL..........................................................
ENSP00000205214  ....RMKAVDFYS-GKVKWEQIL..........................................................
ENSP00000327384  ....VVVLYNVEEQ---------..........................................................
ENSP00000334314  ....VVVLYNVEEQ---------..........................................................
ENSP00000262233  ....VVVLYNVEEQ---------..........................................................
ENSP00000371889  ....-------------------..........................................................
ENSP00000426725  ....-------------------..........................................................
ENSP00000348842  ....----------GVVYNTREH..........................................................
ENSP00000245925  ....VAVLYSVEEQ---------..........................................................
ENSP00000414851  ....-VVLYDPLK----------..........................................................
ENSP00000442365  ....VAVLYSVEEQ---------..........................................................
ENSP00000447548  ....-------------------..........................................................
ENSP00000464789  ....VAVLYSVEEQ---------..........................................................
ENSP00000451998  ....-------------------..........................................................
ENSP00000370039  ....-------------------..........................................................
ENSP00000361570  ....KLFLFES---GDQRWETSImvkeptngsksldviqesesliefppvssplpsyeqmvaasshsqmsmpqvfaiaays
ENSP00000468312  ....VAVLYSVEEQ---------..........................................................
ENSP00000285873  ....ELLQWDLT--QSWRRKYTL..........................................................
ENSP00000378254  ....VVVLYR------------Pgggpggpg..................................................
ENSP00000278845  ....VVVLYR------------Pgggpggpg..................................................
ENSP00000293879  ....-------------------..........................................................
ENSP00000435310  ....KLFLFES---GDQRWETSImvkeptngsksldviqesesliefppvssplpsyeqmvaasshsqmsmpqvfaiaays
ENSP00000448122  ....LVVVEDLHS-G--------..........................................................
ENSP00000348842  ....-------------------..........................................................
ENSP00000314193  ....-------------------..........................................................
ENSP00000447224  ....KINAWNLETA---------..........................................................
ENSP00000447224  ....-------------------..........................................................
ENSP00000293879  ....-------------------..........................................................
ENSP00000254442  ....-------------------..........................................................
ENSP00000350187  ....-------------------..........................................................
ENSP00000416289  ....-------------------..........................................................
ENSP00000389144  ....DVRVWDTRT-----WDYVA..........................................................
ENSP00000310686  ....DVRVWDTRT-----WDYVA..........................................................
ENSP00000288912  ....TAIIYNVFRN---------..........................................................
ENSP00000452765  ....QLCLWNLSH--ELKIS---..........................................................
ENSP00000456709  ....-ISVFDVKS-GSAVHKMIV..........................................................
ENSP00000453378  ....QLCLWNLSH--ELKIS---..........................................................
ENSP00000396295  ....-------------------..........................................................
ENSP00000370039  ....-------------------..........................................................
ENSP00000451998  ....-------------------..........................................................
ENSP00000464109  ....-------------------..........................................................
ENSP00000458843  ....-------------------..........................................................
ENSP00000484308  ....-------------------..........................................................
ENSP00000368025  ....-------------------..........................................................
ENSP00000260643  ....-------------------..........................................................
ENSP00000440796  ....-------------------..........................................................
ENSP00000335522  ....-------------------..........................................................
ENSP00000462737  ....-------------------..........................................................
ENSP00000445814  ....-------------------..........................................................
ENSP00000464095  ....-------------------..........................................................
ENSP00000401445  ....-------------------..........................................................
ENSP00000307235  ....RIAALDPENHGKKQWDLDV..........................................................
ENSP00000256797  ....-------------------..........................................................
ENSP00000413812  ....-------------------..........................................................
ENSP00000370348  ....-------------------..........................................................
ENSP00000394097  ....-------------------..........................................................
ENSP00000442365  ....-------------------..........................................................
ENSP00000378254  ....-------------------..........................................................
ENSP00000433417  ....-------------------..........................................................
ENSP00000278845  ....-------------------..........................................................
ENSP00000364345  ....-------------DWRQQY..........................................................
ENSP00000420608  ....--------------WRQQY..........................................................
ENSP00000466100  ....-------------------..........................................................
ENSP00000217964  ....-------------------..........................................................
ENSP00000385988  ....-------------------..........................................................
ENSP00000471331  spctFAAAVSGAN-GSTLWERPV..........................................................
ENSP00000301678  spctFAAAVSGAN-GSTLWERPV..........................................................
ENSP00000382814  spctFAAAVSGAN-GSTLWERPV..........................................................
ENSP00000301679  spctFAAAVSGAN-GSTLWERPV..........................................................
ENSP00000483191  ....-------------------..........................................................
ENSP00000197268  ....NLVCLSGMN-GSTLWSSLL..........................................................
ENSP00000394063  ....NLVCLSGMN-GSTLWSSLL..........................................................
ENSP00000412076  ....-------------------..........................................................
ENSP00000409656  ....-------------------..........................................................
ENSP00000421171  ....-------------------..........................................................
ENSP00000398526  ....-------------------..........................................................
ENSP00000317469  ....-------------------..........................................................
ENSP00000465994  ....-------------------..........................................................
ENSP00000364354  ....-----------------QY..........................................................
ENSP00000408325  ....-------------------..........................................................
ENSP00000457361  ....-------------------..........................................................
ENSP00000405764  ....-------------------..........................................................
ENSP00000399150  spctFAAAVSGAN-GSTLWERPV..........................................................
ENSP00000398433  spctFAAAVSGAN-GSTLWERPV..........................................................
ENSP00000407669  ....DEAAVSGAN-GSTLWERPV..........................................................
ENSP00000451998  ....-------------------..........................................................
ENSP00000432762  ....RVFFYNPLT-GETAWEDEAenepeeelemqpglspgspgdprpptpetdypesltsypeedyspvgsf.........
ENSP00000433942  ....RVFFYNPLT-GETAWEDEAenepeeelemqpglspgspgdprpptpetdypesltsypeedyspvgsf.........
ENSP00000482352  ....RVFFYNPLT-GETAWEDEAenepeeelemqpglspgspgdprpptpetdypesltsypeedyspvgsf.........
ENSP00000403323  ....RVFFYNPLT-GETAWEDEAenepeeelemqpglspgspgdprpptpetdypesltsypeedyspvgsf.........
ENSP00000477741  ....RVFFYNPLT-GETAWEDEAenepeeelemqpglspgspgdprpptpetdypesltsypeedyspvgsf.........
ENSP00000355464  ....-------------------..........................................................
ENSP00000355465  ....-------------------..........................................................


                                                           100           110               120      
                                                             |             |                 |      
d1g72a_            ...................................KQDASTKAVMC.CDVVD...RGLAYGA...G.....QIVKK.....
ENSP00000355148  ...................................-----ILSGHE.HAVST...CHFCVDD...T.....KLLSG.....
ENSP00000348129  ...................................-----ILSGHE.HAVST...CHFCVDD...T.....KLLSG.....
ENSP00000482107  ...................................-----------.-----...-------...-.....-----.....
ENSP00000291576  ...................................-----------.-----...-------...-.....-----.....
ENSP00000339449  ...................................--EQNFLQGHG.NNVSC...LAISRSG...E.....YIASGqvtfm
ENSP00000331815  ...................................---------HT.APVAT...MAFDPTS...T.....LLATG.....
ENSP00000371888  ...................................-----------.-----...-------...-.....ILATA.....
ENSP00000380313  ...................................-----------.-----...-------...-.....ILATA.....
ENSP00000455046  ...................................-----------.-----...-------...-.....ILATA.....
ENSP00000456405  ...................................-----------.-----...-------...-.....ILATA.....
ENSP00000457870  ...................................-----------.-----...-------...-.....ILATA.....
ENSP00000280190  ...................................---------HV.ETIFD...CKFKPDDp..N.....LLATA.....
ENSP00000422763  ...................................---------HV.ETIFD...CKFKPDDp..N.....LLATA.....
ENSP00000422200  ...................................---------HV.ETIFD...CKFKPDDp..N.....LLATA.....
ENSP00000384792  ...................................--QQHIFNTAR.KSLSA...LAFSPDG...K.....YIVTG.....
ENSP00000481995  ...................................-----------.-----...--FDPTS...T.....LLATG.....
ENSP00000384939  ...................................--TQRHYLGHT.DCVKC...LAIHPDK...I.....RIATGqiagv
ENSP00000385059  ...................................--TQRHYLGHT.DCVKC...LAIHPDK...I.....RIATGqiagv
ENSP00000450541  ...................................--QEEKSVVSG.CDGIS...ACLFLSD...D.....TLFLT.....
ENSP00000320663  ...................................--TQRHYLGHT.DCVKC...LAIHPDK...I.....RIATGqiagv
ENSP00000448161  ...................................-----------.---KC...CSWSADG...A.....RIMVA.....
ENSP00000270301  ...................................--QQHIFNTAR.KSLSA...LAFSPDG...K.....YIVTG.....
ENSP00000426154  ...................................-----------.-----...-CISVSQ...D.....YIFCG.....
ENSP00000423760  ...................................GDRIESS----.-----...ACVSKCG...N.....FIVVG.....
ENSP00000473564  ...................................GDRIESS----.-----...ACVSKCG...N.....FIVVG.....
ENSP00000205214  ...................................GDRIESS----.-----...ACVSKCG...N.....FIVVG.....
ENSP00000327384  ...................................--LQRHYAGHN.DDVKC...LAVHPDR...I.....TIATGqvagt
ENSP00000334314  ...................................--LQRHYAGHN.DDVKC...LAVHPDR...I.....TIATGqvagt
ENSP00000262233  ...................................--LQRHYAGHN.DDVKC...LAVHPDR...I.....TIATGqvagt
ENSP00000371889  ...................................-----NIDDHS.RFVNC...VRFSPDG...N.....RFATA.....
ENSP00000426725  ...................................-----NIDDHS.RFVNC...VRFSPDG...N.....RFATA.....
ENSP00000348842  ...................................--SQKFFLGHN.DDIIS...LALHPDK...T.....LVATGqv...
ENSP00000245925  ...................................--RQRHYLGHN.DDIKC...LAIHPDM...V.....TIATG.....
ENSP00000414851  ...................................RVVVTNLNGHT.ARVNC...IQWICKQ...DgspstELVSG.....
ENSP00000442365  ...................................--RQRHYLGHN.DDIKC...LAIHPDM...V.....TIATG.....
ENSP00000447548  ...................................------LSGCH.KGITA...MAWGVEE...K.....LLVIG.....
ENSP00000464789  ...................................--RQRHYLGHN.DDIKC...LAIHPDM...V.....TIATG.....
ENSP00000451998  ...................................--TQRFYLGHD.DDILC...LTIHPLK...D.....YVATGqv...
ENSP00000370039  ...................................--TQRFYLGHD.DDILC...LTIHPLK...D.....YVATGqv...
ENSP00000361570  kgfacsagpgrvllfekmeekdfyresreiripvdPQSNDPSQSDK.QDVLC...LCFSPSE...E.....TLVAS.....
ENSP00000468312  ...................................--RQRHYLGHN.DDIKC...LAIHPDM...V.....TIATG.....
ENSP00000285873  ...................................FSASSEGQNHS.RIVFN...LCPLQTE...Ddkq..LLLST.....
ENSP00000378254  ...................................GGGQRHYRGHT.DCVRC...LAVHPDG...V.....RVASGqtagv
ENSP00000278845  ...................................GGGQRHYRGHT.DCVRC...LAVHPDG...V.....RVASGqtagv
ENSP00000293879  ...................................--AQQHWSGHS.AEIST...LALSHSA...Q.....VLASA.....
ENSP00000435310  kgfacsagpgrvllfekmeekdfyresreiripvdPQSNDPSQSDK.QDVLC...LCFSPSE...E.....TLVAS.....
ENSP00000448122  ...................................--AQQHWSGHS.AEIST...LALSHSA...Q.....VLASA.....
ENSP00000348842  ...................................-------LGHD.DDILS...LTIHPVK...D.....YVATGqv...
ENSP00000314193  ...................................-----------.-----...------S...K.....YIFCV.....
ENSP00000447224  ...................................-EPVFHILGDAsDPWMC...MAVLASQ...A.....TLLTV.....
ENSP00000447224  ...................................------LSGCH.KGITA...MAWGVEE...K.....LLVIG.....
ENSP00000293879  ...................................--------LD-.-SAMA...VCFGPAAl..G.....HLLVS.....
ENSP00000254442  ...................................------LFGHT.ASITClskACASSDK...Q.....YIVSA.....
ENSP00000350187  ...................................------LFGHT.ASITClskACASSDK...Q.....YIVSA.....
ENSP00000416289  ...................................-----------.-----...-------...-.....-----.....
ENSP00000389144  ...................................PFLESEDEEDEpGMQPN...VSFVRINs..S.....LAVAA.....
ENSP00000310686  ...................................PFLESEDEEDEpGMQPN...VSFVRINs..S.....LAVAA.....
ENSP00000288912  ...................................--NQYHLQGHA.NIISC...LCVSEDR...R.....WIATAdk...
ENSP00000452765  ...................................--AKELLFGHS.ASVTC...LARARDF...Skqp..YIVSA.....
ENSP00000456709  ...................................DRQYMGVSKRK.CIVWG...VAFLSDG...-.....TIISV.....
ENSP00000453378  ...................................--AKELLFGHS.ASVTC...LARARDF...Skqp..YIVSA.....
ENSP00000396295  ...................................-----------.-----...-------...-.....-----.....
ENSP00000370039  ...................................--SQSFYQEHN.DDILC...LTVNQHP...Kfin..I----.....
ENSP00000451998  ...................................--SQSFYQEHN.DDILC...LTVNQHP...Kfin..I----.....
ENSP00000464109  ...................................-----------.-----...-------...-.....-----.....
ENSP00000458843  ...................................-----------.-----...-------...-.....-----.....
ENSP00000484308  ...................................-----------.SSITC...CFTCFDQ...G.....FLYAG.....
ENSP00000368025  ...................................-----------.SSITC...CFTCFDQ...G.....FLYAG.....
ENSP00000260643  ...................................-----------.-----...-------...-.....-----.....
ENSP00000440796  ...................................-----------.-----...-------...-.....-----.....
ENSP00000335522  ...................................-----------.-----...-------...-.....-----.....
ENSP00000462737  ...................................-----------.-----...-------...-.....-----.....
ENSP00000445814  ...................................-----------.-----...-------...-.....-----.....
ENSP00000464095  ...................................-----------.-----...-------...-.....-----.....
ENSP00000401445  ...................................-----------.-----...-------...T.....LLFVS.....
ENSP00000307235  ...................................GSGSLVSSSL-.-----...SKPEVFG...N.....KMIIP.....
ENSP00000256797  ...................................-----------.-----...-------...N.....LLLVS.....
ENSP00000413812  ...................................-----------.-----...-------...N.....LLLVS.....
ENSP00000370348  ...................................-----------.-----...-------...-.....-----.....
ENSP00000394097  ...................................-----------.-----...-------...-.....-----.....
ENSP00000442365  ...................................-----------.-----...-------...-.....-----.....
ENSP00000378254  ...................................-----------.-----...-------...-.....-----.....
ENSP00000433417  ...................................-----------.-----...-------...-.....-----.....
ENSP00000278845  ...................................-----------.-----...-------...-.....-----.....
ENSP00000364345  ...................................VGKVKFA----.----S...LEFSPGS...K.....KLVVA.....
ENSP00000420608  ...................................VGKVKFA----.----S...LEFSPGS...K.....KLVVA.....
ENSP00000466100  ...................................-----------.-----...-------...-.....-----.....
ENSP00000217964  ...................................-----------.-----...-------...-.....-----.....
ENSP00000385988  ...................................-----------.-----...-------...-.....-----.....
ENSP00000471331  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000301678  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000382814  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000301679  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000483191  ...................................-----------.-----...-------...-.....-----.....
ENSP00000197268  ...................................PEEAR------.-DITC...LELMPGSlaeT.....ICLVT.....
ENSP00000394063  ...................................PEEAR------.-DITC...LELMPGSlaeT.....ICLVT.....
ENSP00000412076  ...................................-----------.-----...------G...N.....KMIIP.....
ENSP00000409656  ...................................-----------.----I...PTFDKSS...T.....TVYIG.....
ENSP00000421171  ...................................-----------.----I...PTFDKSS...T.....TVYIG.....
ENSP00000398526  ...................................-----------.-----...-------...-.....--VLG.....
ENSP00000317469  ...................................-----------.-----...-------...-.....----G.....
ENSP00000465994  ...................................-----------.-----...-------...-.....-----.....
ENSP00000364354  ...................................VGKVKFA----.----S...LEFSPGS...K.....KLVVA.....
ENSP00000408325  ...................................-----------.-----...-------...-.....-----.....
ENSP00000457361  ...................................-----------.-----...-------...N.....LLLVS.....
ENSP00000405764  ...................................-----------.-----...-------...-.....RLAAA.....
ENSP00000399150  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000398433  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000407669  ...................................AQDVA------.-LVEC...AVPQPRG...SeapsaCILV-.....
ENSP00000451998  ...................................-----------.-----...-------...-.....-----.....
ENSP00000432762  ...................................GEPGPTSPLTT.PPGWS...CHVSQDK...Q.....MLYTNhftqe
ENSP00000433942  ...................................GEPGPTSPLTT.PPGWS...CHVSQDK...Q.....MLYTNhftqe
ENSP00000482352  ...................................GEPGPTSPLTT.PPGWS...CHVSQDK...Q.....MLYTNhftqe
ENSP00000403323  ...................................GEPGPTSPLTT.PPGWS...CHVSQDK...Q.....MLYTNhftqe
ENSP00000477741  ...................................GEPGPTSPLTT.PPGWS...CHVSQDK...Q.....MLYTNhftqe
ENSP00000355464  ...................................-----------.-----...-------...-.....-----.....
ENSP00000355465  ...................................-----------.-----...-------...-.....-----.....


                                         130             140                                     150
                                           |               |                                       |
d1g72a_            ......QANGH..........LLALDAK.....TG.KINWE.VEVCDPK.....VG........................S
ENSP00000355148  ......SYDCT..........VKLWDPV.....DG.SVVRD.FEHRP--.....-K........................A
ENSP00000348129  ......SYDCT..........VKLWDPV.....DG.SVVRD.FEHRP--.....-K........................A
ENSP00000482107  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000291576  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000339449  ......GFKAD..........IILWDYK.....NR.ELLAR.LSLH---.....-K........................G
ENSP00000331815  ......GCDGA..........VRVWDIV.....RH.YGTHH.FRGS---.....-P........................G
ENSP00000371888  ......GYDHT..........VRFWQAH.....SG.ICTRT.VQH----.....-Q........................D
ENSP00000380313  ......GYDHT..........VRFWQAH.....SG.ICTRT.VQHQ---.....-D........................S
ENSP00000455046  ......GYDHT..........VRFWQAH.....SG.ICTRT.VQHQ---.....-D........................S
ENSP00000456405  ......GYDHT..........VRFWQAH.....SG.ICTRT.VQHQ---.....-D........................S
ENSP00000457870  ......GYDHT..........VRFWQAH.....SG.ICTRT.VQHQ---.....-D........................S
ENSP00000280190  ......SFDGT..........IKVWDIN.....TL.TAVYT.SPGN---.....-E........................G
ENSP00000422763  ......SFDGT..........IKVWDIN.....TL.TAVYT.SPGN---.....-E........................G
ENSP00000422200  ......SFDGT..........IKVWDIN.....TL.TAVYT.SPGN---.....-E........................G
ENSP00000384792  ......ENGHRpa........VRIWDVE.....EK.NQVAE.MLGH---.....-K........................Y
ENSP00000481995  ......GCDGA..........VRVWDIV.....RH.YGTHH.FRGS---.....-P........................G
ENSP00000384939  ......DKDGRplqph.....VRVWDSV.....TL.STLQI.IGLGTF-.....-E........................R
ENSP00000385059  ......DKDGRplqph.....VRVWDSV.....TL.STLQI.IGLGTF-.....-E........................R
ENSP00000450541  ......AFDGL..........LELWDLQ.....HG.CRVLQ.TKAH---.....-Q........................Y
ENSP00000320663  ......DKDGRplqph.....VRVWDSV.....TL.STLQI.IGLGTF-.....-E........................R
ENSP00000448161  ......AKNK-..........IFLWNTD.....SR.SKVAD.CRGH---.....-L........................S
ENSP00000270301  ......ENGHRpa........VRIWDVE.....EK.NQVAE.MLGH---.....-K........................Y
ENSP00000426154  ......CADGT..........VRLFNPS.....NL.HFLST.LPRP---.....-HalgtdiasvteasrlfsgvanaryP
ENSP00000423760  ......CYNGL..........VYVLKSN.....SG.EKYWM.FTTE---.....-D........................A
ENSP00000473564  ......CYNGL..........VYVLKSN.....SG.EKYWM.FTTE---.....-D........................A
ENSP00000205214  ......CYNGL..........VYVLKSN.....SG.EKYWM.FTTE---.....-D........................A
ENSP00000327384  ......SKDGKqlpph.....VRIWDSV.....TL.NTLHV.IGIGFF-.....-D........................R
ENSP00000334314  ......SKDGKqlpph.....VRIWDSV.....TL.NTLHV.IGIGFF-.....-D........................R
ENSP00000262233  ......SKDGKqlpph.....VRIWDSV.....TL.NTLHV.IGIGFF-.....-D........................R
ENSP00000371889  ......SADGQ..........IYIYDGK.....TG.EKVCA.LGGSKAH.....-D........................G
ENSP00000426725  ......SADGQ..........IYIYDGK.....TG.EKVCA.LGGSKAH.....-D........................G
ENSP00000348842  ......GKEPY..........ICIWDSY.....NV.QTVSLlKDVH---.....-T........................H
ENSP00000245925  ......QVAGTtkegkplpphVRIWDSV.....SL.STLHV.LGLGVF-.....-D........................R
ENSP00000414851  ......GSDNQ..........VIHWEIE.....DN.QLLKA.VHLQGH-.....-E........................G
ENSP00000442365  ......QVAGTtkegkplpphVRIWDSV.....SL.STLHV.LGLGVF-.....-D........................R
ENSP00000447548  ......TQDGI..........MAVWDME.....EQ.HVIHM.LTGH---.....-T........................G
ENSP00000464789  ......QVAGTtkegkplpphVRIWDSV.....SL.STLHV.LGLGVF-.....-D........................R
ENSP00000451998  ......GRDPS..........IHIWDTE.....TI.KPLSI.LKGHH--.....-Q........................Y
ENSP00000370039  ......GRDPS..........IHIWDTE.....TI.KPLSI.LKGHH--.....-Q........................Y
ENSP00000361570  ......TSKNQ..........LYSITMSlteisKG.EPAHF.E-----YlmyplHS........................A
ENSP00000468312  ......QVAGTtkegkplpphVRIWDSV.....SL.STLHV.LGLGVF-.....-D........................R
ENSP00000285873  ......SMDRD..........VKCWDIA.....TL.ECSWT.LPSL---.....-G........................G
ENSP00000378254  ......DKDGKplqpv.....VHIWDSE.....TL.LKLQE.IGLGAF-.....-E........................R
ENSP00000278845  ......DKDGKplqpv.....VHIWDSE.....TL.LKLQE.IGLGAF-.....-E........................R
ENSP00000293879  ......SGRSSttahcq....IRVWDVS.....GG.LCQHL.IFPH---.....-S........................T
ENSP00000435310  ......TSKNQ..........LYSITMSlteisKG.EPAHF.E-----YlmyplHS........................A
ENSP00000448122  ......SGRSSttahcq....IRVWDVS.....GG.LCQHL.IFPH---.....-S........................T
ENSP00000348842  ......GRDAA..........IHVWDTQ.....TL.KCLSL.LKGQH--.....-Q........................R
ENSP00000314193  ......SGDF-..........VKVYSTV.....TE.ECVHI.LHGH---.....-R........................N
ENSP00000447224  ......SRDGV..........VSLWSSA.....TG.KLQGK.QHMSSIK.....-E........................E
ENSP00000447224  ......TQDGI..........MAVWDME.....EQ.HVIHM.LTGH---.....-T........................G
ENSP00000293879  ......TSSNR..........VVVLDAV.....SG.RIIRE.LPGVH--.....-P........................E
ENSP00000254442  ......SESGE..........MCLWDVS.....DG.RCIEF.TKL----.....-A........................C
ENSP00000350187  ......SESGE..........MCLWDVS.....DG.RCIEF.TKL----.....-A........................C
ENSP00000416289  ......--DGTe.........LCIWNTK.....DPsHQLLI.LRGH---.....-H........................Q
ENSP00000389144  ......YEDGF..........LNIWDLR.....TGkYPVHR.FEH----.....-D........................A
ENSP00000310686  ......YEDGF..........LNIWDLR.....TGkYPVHR.FEH----.....-D........................A
ENSP00000288912  ......GPDCL..........VIIWDSF.....TG.IPVHT.IFDSCPE.....-G........................N
ENSP00000452765  ......AENGE..........MCVWNVT.....NG.QCMEK.ATL----.....-P........................Y
ENSP00000456709  ......DSAGK..........VQFWDSA.....TG.TLVKS.HLIA---.....-N........................A
ENSP00000453378  ......AENGE..........MCVWNVT.....NG.QCMEK.ATL----.....-P........................Y
ENSP00000396295  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000370039  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000451998  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000464109  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000458843  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000484308  ......NQAGE..........IQVWSLQ.....QG.HPLHS.FQAH---.....-Q........................S
ENSP00000368025  ......NQAGE..........IQVWSLQ.....QG.HPLHS.FQAH---.....-Q........................S
ENSP00000260643  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000440796  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000335522  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000462737  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000445814  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000464095  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000401445  ......TLDGS..........LHAVSKR.....TG.SIKWT.LKEDPVLq....VP........................T
ENSP00000307235  ......SLDGA..........LFQWDQ-.....DR.ESMET.VPFT---.....-V........................E
ENSP00000256797  ......TLDGS..........LHALSKQ.....TG.DLKWT.LRDDPVIe....GP........................M
ENSP00000413812  ......TLDGS..........LHALSKQ.....TG.DLKWT.LRDDPVIe....GP........................M
ENSP00000370348  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000394097  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000442365  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000378254  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000433417  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000278845  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000364345  ......TEKNV..........IAALNSR.....TG.EILWR.HVDKGTA.....-E........................G
ENSP00000420608  ......TEKNV..........IAALNSR.....TG.EILWR.HVDKGTA.....-E........................G
ENSP00000466100  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000217964  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000385988  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000471331  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSFSG.....--........................-
ENSP00000301678  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSFSG.....--........................-
ENSP00000382814  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSFSG.....--........................-
ENSP00000301679  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSFSG.....--........................-
ENSP00000483191  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000197268  ......GTHKM..........LSAFNAT.....SG.KAIWT.LNPNYLS.....-N........................G
ENSP00000394063  ......GTHKM..........LSAFNAT.....SG.KAIWT.LNPNYLS.....-N........................G
ENSP00000412076  ......SLDGA..........LFQWDQ-.....DR.ESMET.VPFT---.....-V........................E
ENSP00000409656  ......SHSHR..........MKAVDFY.....SG.KVKWE.QILG---.....-D........................R
ENSP00000421171  ......SHSHR..........MKAVDFY.....SG.KVKWE.QILG---.....-D........................R
ENSP00000398526  ......TENKE..........LLVLDPE.....AF.TILAK.MSL----.....-P........................S
ENSP00000317469  ......TENKE..........LLVLDPE.....AF.TILAK.MSL----.....-P........................S
ENSP00000465994  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000364354  ......TEKNV..........IAALNSR.....TG.EIYVI.TVSNG--.....--........................-
ENSP00000408325  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000457361  ......TLDGS..........LHALSKQ.....TG.DLKWT.LRDDPVIe....GP........................M
ENSP00000405764  ......CRNGN..........IYILRRD.....SK.HPKYC.IELS---.....-A........................Q
ENSP00000399150  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSF--.....--........................-
ENSP00000398433  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSF--.....--........................-
ENSP00000407669  ......GRPSS..........FIAVNLF.....TG.ETLWN.HSSSF--.....--........................-
ENSP00000451998  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000432762  qwvrleDPHGK..........PYFYNPE.....DS.SVRWE.LPQ----.....--........................-
ENSP00000433942  qwvrleDPHGK..........PYFYNPE.....DS.SVRWE.LPQ----.....--........................-
ENSP00000482352  qwvrleDPHGK..........PYFYNPE.....DS.SVRWE.LPQ----.....--........................-
ENSP00000403323  qwvrleDPHGK..........PYFYNPE.....DS.SVRWE.LPQ----.....--........................-
ENSP00000477741  qwvrleDPHGK..........PYFYNPE.....DS.SVRWE.LPQ----.....--........................-
ENSP00000355464  ......-----..........-------.....--.-----.-------.....--........................-
ENSP00000355465  ......-----..........-------.....--.-----.-------.....--........................-


                                   160         170           180          190                       
                                     |           |             |            |                       
d1g72a_            TLTQAPFV.........AKDT..VLMGCSGAELG....VRGAVNAFDLK...TGELKWRA.....................
ENSP00000355148  PVVECSIT.........GDSS..RVIAASY----....-DKTVRAWDL-...--------.....................
ENSP00000348129  PVVECSIT.........GDSS..RVIAASY----....-DKTVRAWDL-...--------.....................
ENSP00000482107  NLTAAAFH.........KKSH..LLVTGFA----....-SGIFHLHEL-...--------.....................
ENSP00000291576  NLTAAAFH.........KKSH..LLVTGFA----....-SGIFHLHEL-...--------.....................
ENSP00000339449  KIEALAFS.........PNDL..YLVSLGGPD--....-DGSVVVWSIA...KRDAICGSpaaglnvgnatnvifsrcrde
ENSP00000331815  VVHLVAFH.........PDPTrlLLFSSAT----....-DAAIRVWSL-...--------.....................
ENSP00000371888  SVNALEVT.........PDRS..MIAAAG-----....-YQHIRMYDL-...--------.....................
ENSP00000380313  QVNALEVT.........PDRS..MIAAAG-----....-YQHIRMYDL-...--------.....................
ENSP00000455046  QVNALEVT.........PDRS..MIAAAG-----....-YQHIRMYDL-...--------.....................
ENSP00000456405  QVNALEVT.........PDRS..MIAAAG-----....-YQHIRMYDL-...--------.....................
ENSP00000457870  QVNALEVT.........PDRS..MIAAAG-----....-YQHIRMYDL-...--------.....................
ENSP00000280190  VIYSLSWA.........PGGLn.CIAGGTS----....-RNGAFIWNV-...--------.....................
ENSP00000422763  VIYSLSWA.........PGGLn.CIAGGTS----....-RNGAFIWNV-...--------.....................
ENSP00000422200  VIYSLSWA.........PGGLn.CIAGGTS----....-RNGAFIWNV-...--------.....................
ENSP00000384792  GVACVAFS.........PNMK..HIVSMGYQH--....-DMVLNVWDWK...KDIVVASNkvscrvialsfsedssy....
ENSP00000481995  VVHLVAFH.........PDPTrlLLFSSAT----....-DAAIRVWSL-...--------.....................
ENSP00000384939  GVGCLDFSka.......DSGV..HLCIIDDSN--....-EHMLTVWDWQkkaKGAEIKTTnevvlavefhptdant.....
ENSP00000385059  GVGCLDFSka.......DSGV..HLCIIDDSN--....-EHMLTVWDWQkkaKGAEIKTTnevvlavefhptdant.....
ENSP00000450541  QITGCCLS.........PDCR..LLATVCL----....-GGCLKLWDT-...--------.....................
ENSP00000320663  GVGCLDFSka.......DSGV..HLCIIDDSN--....-EHMLTVWDWQkkaKGAEIKTTnevvlavefhptdant.....
ENSP00000448161  WVHGVMFS.........PDGS..SFLTSSD----....-DQTIRLWET-...--------.....................
ENSP00000270301  GVACVAFS.........PNMK..HIVSMGYQH--....-DMVLNVWDWK...KDIVVASNkvscrvialsfsedssy....
ENSP00000426154  DTIALTFD.........PTNQ..WLSCVYN----....-DHSIYVWDVR...DPKKVGKVysalyhsscvwsvevypevkd
ENSP00000423760  VKSSATMD.........PTTG..LIYIGSH----....-DQHAYALDIY...RKKCVWKSkcggtvfsspclnliphh...
ENSP00000473564  VKSSATMD.........PTTG..LIYIGSH----....-DQHAYALDIY...RKKCVWKSkcggtvfsspclnliphh...
ENSP00000205214  VKSSATMD.........PTTG..LIYIGSH----....-DQHAYALDIY...RKKCVWKSkcggtvfsspclnliphh...
ENSP00000327384  AVTCIAFSks.......NGGT..NLCAVDDSN--....-DHVLSVWDWQ...KEEKLADVkcsneavfaadfhptdtni..
ENSP00000334314  AVTCIAFSks.......NGGT..NLCAVDDSN--....-DHVLSVWDWQ...KEEKLADVkcsneavfaadfhptdtni..
ENSP00000262233  AVTCIAFSks.......NGGT..NLCAVDDSN--....-DHVLSVWDWQ...KEEKLADVkcsneavfaadfhptdtni..
ENSP00000371889  GIYAISWS.........PDST..HLLSASG----....-DKTSKIWDV-...--------.....................
ENSP00000426725  GIYAISWS.........PDST..HLLSASG----....-DKTSKIWDV-...--------.....................
ENSP00000348842  GVACLAFD.........SDGQ..RLASVGLDA--....-KNTVCIWDW-...--------.....................
ENSP00000245925  AVCCVGFSks.......NGGN..LLCAVDESN--....-DHMLSVWDWA...KETKVVDVkcsneavlvatfhptdptvli
ENSP00000414851  PVYAVHAVyqrrtsdp.ALCT..LIVSAAA----....-DSAVRLWSK-...KGPEVMCLqtlnfgngfalalclsflpnt
ENSP00000442365  AVCCVGFSks.......NGGN..LLCAVDESN--....-DHMLSVWDWA...KETKVVDVkcsneavlvatfhptdptvli
ENSP00000447548  EVRCVKIF.........AKGT..LANSASK----....-DYTLHLWNL-...--------.....................
ENSP00000464789  AVCCVGFSks.......NGGN..LLCAVDESN--....-DHMLSVWDWA...KETKVVDVkcsneavlvatfhptdptvli
ENSP00000451998  GVSAVDFS.........ADGK..RLASVGIDD--....-SHTVVLWDWK...KGEKLSIArgskdkifvvkmnpyvpdkli
ENSP00000370039  GVSAVDFS.........ADGK..RLASVGIDD--....-SHTVVLWDWK...KGEKLSIArgskdkifvvkmnpyvpdkli
ENSP00000361570  PITGLATC.........IRKP..LIATCSL----....-DRSIRLWNYE...TNTLELFKeyqeeaysislhpsghf....
ENSP00000468312  AVCCVGFSks.......NGGN..LLCAVDESN--....-DHMLSVWDWA...KETKVVDVkcsneavlvatfhptdptv..
ENSP00000285873  FAYSLAFS.........SVDIg.SLAIGVG----....-DGMIRVWNT-...--------.....................
ENSP00000378254  GVGALAFS.........AADQgaFLCVVDDSN--....-EHMLSVWDCS...RGMKLAEIkstndsvlavgfnprdssc..
ENSP00000278845  GVGALAFS.........AADQgaFLCVVDDSN--....-EHMLSVWDCS...RGMKLAEIkstndsvlavgfnprdssc..
ENSP00000293879  TVLALAFS.........PDDR..LLVTLGDHD--....-GRTLALWGT-...--------.....................
ENSP00000435310  PITGLATC.........IRKP..LIATCSL----....-DRSIRLWNYE...TNTLELFKeyqeeaysislhpsghf....
ENSP00000448122  TVLALAFS.........PDDR..LLVTLGDHD--....-GRTLALWGT-...--------.....................
ENSP00000348842  GVCALDFS.........ADGK..CLVSVGLDD--....-FHSIVFWDWK...KGEKIATTrghkdkifvvkcnphhvdklv
ENSP00000314193  LVTGIQLN.........PNNHl.QLYSCSL----....-DGTIKLWDYI...DGILIKTFivgcklhalftlaqaedsvfv
ENSP00000447224  TPTCAVSV.........QKQG..KLVTGFS----....-NGSISLVSSK...GDRLLEKLpdavrflvvsedes.......
ENSP00000447224  EVRCVKIF.........AKGT..LANSASK----....-DYTLHLWNL-...--------.....................
ENSP00000293879  PCPSLTLS.........EDAR..FLLIAA-----....-GRTIKVWDY-...--------.....................
ENSP00000254442  THTGIQFYqfsvgnq..REGR..LLCHGH-----....-YPEILVVDAT...SLEVLYSLvskispdwissmsiirshrtq
ENSP00000350187  THTGIQFYqfsvgnq..REGR..LLCHGH-----....-YPEILVVDAT...SLEVLYSLvskispdwissmsiirshrtq
ENSP00000416289  PITAMAFG.........NKVNp.LLICSAS----....-LDYVIMWNL-...--------.....................
ENSP00000389144  RIQALALS.........QDDA..TVATAS-----....-AFDVVMLSP-...NEEGYWQIaaefevpklvqyleivpetrr
ENSP00000310686  RIQALALS.........QDDA..TVATAS-----....-AFDVVMLSP-...NEEGYWQIaaefevpklvqyleivpetrr
ENSP00000288912  GIMAMAMT.........HDAK..YLATISDAE--....-VQKVCIWKW-...--------.....................
ENSP00000452765  RHTAICYYhcsfr....MTGEg.WLLCCGE----....-YQDVLIIDA-...--------.....................
ENSP00000456709  DVQSIAVA.........DQED..SFVVGTA----....-EGTVFHFQL-...--------.....................
ENSP00000453378  RHTAICYYhcsfr....MTGEg.WLLCCGE----....-YQDVLIIDA-...--------.....................
ENSP00000396295  --------.........----..-----------....-----------...--------.....................
ENSP00000370039  --------.........----..-VATGQVGDSAdmsaTAPSIHIWDA-...--------.....................
ENSP00000451998  --------.........----..-VATGQVGDSAdmsaTAPSIHIWDA-...--------.....................
ENSP00000464109  -NWTVAFA.........PDGS..YFAWSQG----....-HRTVKLVPW-...--------.....................
ENSP00000458843  -VWGVAFL.........SDGT..IISVDS-----....-AGKVQFWDSA...TGTLVKSHlianadvqsiavadqeds...
ENSP00000484308  GVICIRSR.........PEAH..TLLTAGS----....-DSLIKEWNLT...SGSLLRRLelgeelyrlqfidsitffcqt
ENSP00000368025  GVICIRSR.........PEAH..TLLTAGS----....-DSLIKEWNLT...SGSLLRRLelgeelyrlqfidsitffcqt
ENSP00000260643  --------.........----..-----------....-----------...--------.....................
ENSP00000440796  --------.........----..-----------....-----------...--------.....................
ENSP00000335522  --------.........----..-----------....-----------...--------.....................
ENSP00000462737  -NWTVAFA.........PDGS..YFAWSQG----....-HRTVKLVPW-...--------.....................
ENSP00000445814  --------.........----..-----------....-----------...--------.....................
ENSP00000464095  --------.........----..-----------....-----------...--------.....................
ENSP00000401445  HVEEPAFL.........PD--..-----PN----....-DGSLYTLGSK...NNEGLTKLpftipelvqaspcrssdgi..
ENSP00000307235  SLLESSYK.........FGDD..VVLVGGK----....-SLTTYGLSA-...--------.....................
ENSP00000256797  YVTEMAFL.........----..---SDPA----....-DGSLYILGT-...--------.....................
ENSP00000413812  YVTEMAFL.........----..---SDPA----....-DGSLYILGT-...--------.....................
ENSP00000370348  --------.........----..-----------....-----------...--------.....................
ENSP00000394097  --------.........----..-----------....-----------...--------.....................
ENSP00000442365  --------.........----..-----------....-----------...--------.....................
ENSP00000378254  --------.........----..-----------....-----------...--------.....................
ENSP00000433417  --------.........----..-----------....-----------...--------.....................
ENSP00000278845  --------.........----..-----------....-----------...--------.....................
ENSP00000364345  AVDAMLLH.........GQD-..VITVSNG----....-GRIMRSWETN...IGGLNWEItldsgsfqalglvglqesvr.
ENSP00000420608  AVDAMLLH.........GQD-..VITVSNG----....-GRIMRSWETN...IGGLNWEItldsgsfqalglvglqesvr.
ENSP00000466100  --------.........----..-----------....-DHMLSVWDW-...--------.....................
ENSP00000217964  --------.........----..-----------....-----------...--------.....................
ENSP00000385988  --------.........----..-----------....-----------...--------.....................
ENSP00000471331  --NASILSpllqvpdvdGDGApdLLVLTQERE--....-EVSGHLYSGS...TGHQIGLRgslgvdgesgfllhvtrtgah
ENSP00000301678  --NASILSpllqvpdvdGDGApdLLVLTQERE--....-EVSGHLYSGS...TGHQIGLRgslgvdgesgfllhvtrtgah
ENSP00000382814  --NASILSpllqvpdvdGDGApdLLVLTQERE--....-EVSGHLYSGS...TGHQIGLRgslgvdgesgfllhvtrtgah
ENSP00000301679  --NASILSpllqvpdvdGDGApdLLVLTQERE--....-EVSGHLYSGS...TGHQIGLRgslgvdgesgfllhvtrtgah
ENSP00000483191  --------.........----..-----------....-----------...--------.....................
ENSP00000197268  TLAAPVVVlpdld....EDGVr.DLVVLAIGELQ....PDLCFLLVSGR...TGNPVGRPvkynivgvgnligpqvyittn
ENSP00000394063  TLAAPVVVlpdld....EDGVr.DLVVLAIGELQ....PDLCFLLVSGR...TGNPVGRPvkynivgvgnligpqvyittn
ENSP00000412076  SLLESSYK.........FGDD..VVLVGGK----....-SLTTYGLSA-...--------.....................
ENSP00000409656  IESSACVS.........KCGN..FIVVG------....-----------...--------.....................
ENSP00000421171  IESSACVS.........KCGN..FIVVG------....-----------...--------.....................
ENSP00000398526  VPVFLEVSgq.......FDVEf.RLAAACR----....-NGNIYILRRD...SKHPKYCIelsaqpvglirvhkv......
ENSP00000317469  VPVFLEVSgq.......FDVEf.RLAAACR----....-NGNIYILRRD...SKHPKYCIelsaqpvglirvhkv......
ENSP00000465994  --------.........----..-----------....-----------...--------.....................
ENSP00000364354  --------.........----..-----------....-GRIMRSWETN...IGGLNWEItldsgsfqalglvglqesvr.
ENSP00000408325  --------.........-GDD..VVLVGGK----....-SLTTYGLSA-...--------.....................
ENSP00000457361  YVTEMAFLsdp......ADGS..LYILG------....-----------...--------.....................
ENSP00000405764  PVGLIRV-.........--HK..VLVVGST----....-QDSLHGFT-H...KGKKLWTVqmpaailtmnlleqhsrglqa
ENSP00000399150  SG------.........----..-----------....-----------...--------.....................
ENSP00000398433  SG------.........----..-----------....-----------...--------.....................
ENSP00000407669  SG------.........----..-----------....-----------...--------.....................
ENSP00000451998  --------.........----..-----------....-----------...--------.....................
ENSP00000432762  --------.........----..-----------....-----------...--------.....................
ENSP00000433942  --------.........----..-----------....-----------...--------.....................
ENSP00000482352  --------.........----..-----------....-----------...--------.....................
ENSP00000403323  --------.........----..-----------....-----------...--------.....................
ENSP00000477741  --------.........----..-----------....-----------...--------.....................
ENSP00000355464  --------.........----..-----------....-----------...--------.....................
ENSP00000355465  --------.........----..-----------....-----------...--------.....................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  m................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  snqaclppss.......................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  tcgkshiyfwtleggslskrqglfekhekpkyvlcvtfleggd......................................
ENSP00000414851  dvtwktgqvergrawkppaslalcsrscdsmvscyasilckalwkeklhtfwhhnrisflpsafrpipi............
ENSP00000442365  tcgkshiyfwtleggslskrqglfekhekpkyvlcvtfleggd......................................
ENSP00000447548  .................................................................................
ENSP00000464789  tcgkshiyfwtleggslskrqglfekhekpkyvlcvtfleggd......................................
ENSP00000451998  tagikhmkfwrkagggligrkgyigtlgkndtmmcavygwteemafsgtstgdvciwrdiflvktvkahdgpvfsmhalek
ENSP00000370039  tagikhmkfwrkagggligrkgyigtlgkndtmmcavygwteemafsgtstgdvciwrdiflvktvkahdgpvfsmhalek
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  tvgikhikfwqqagggftskrgtfgsvgkletmmcvsygrmedlvfsgaatgdifiwkdilllktvkahdgpvfamyaldk
ENSP00000314193  ivnkekpdifqlvsvklpksssqeveakelsfvldyinqspkciafgnegvyvaavrefylsvyffkkkttsrftlsssrn
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  edtvvalsvtgilkvwivtseisdmqdtepifee...............................................
ENSP00000350187  edtvvalsvtgilkvwivtseisdmqdtepifee...............................................
ENSP00000416289  .................................................................................
ENSP00000389144  yp...............................................................................
ENSP00000310686  yp...............................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  ahsfslhrlpcfyslfnvcgsapqqlrrvccgnnwfr............................................
ENSP00000368025  ahsfslhrlpcfyslfnvcgsapqqlrrvccgnnwfr............................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  yilfpcasslcgcsvkglyekvtgsggpfksdphwesmlnattrrmls.................................
ENSP00000301678  yilfpcasslcgcsvkglyekvtgsggpfksdphwesmlnattrrmls.................................
ENSP00000382814  yilfpcasslcgcsvkglyekvtgsggpfksdphwesmlnattrrmls.................................
ENSP00000301679  yilfpcasslcgcsvkglyekvtgsggpfksdphwesmlnattrrmls.................................
ENSP00000483191  .................................................................................
ENSP00000197268  gavy.............................................................................
ENSP00000394063  gavy.............................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                200       210       
                                                                                  |         |       
d1g72a_            ........................................................FATGSDDSVRLAKDFNSANPHY...
ENSP00000355148  ........................................................----------------------...
ENSP00000348129  ........................................................----------------------...
ENSP00000482107  ........................................................----------------------...
ENSP00000291576  ........................................................----------------------...
ENSP00000339449  ........................................................FMTAGNGTIRVWELDLPNRKIWpte
ENSP00000331815  ........................................................----------------------...
ENSP00000371888  ........................................................----------------------...
ENSP00000380313  ........................................................----------------------...
ENSP00000455046  ........................................................----------------------...
ENSP00000456405  ........................................................----------------------...
ENSP00000457870  ........................................................----------------------...
ENSP00000280190  ........................................................----------------------...
ENSP00000422763  ........................................................----------------------...
ENSP00000422200  ........................................................----------------------...
ENSP00000384792  ........................................................FVTVGNRHVRFWFLEVSTETKVtst
ENSP00000481995  ........................................................----------------------...
ENSP00000384939  ........................................................IITCGKSHIFFWTW--------...
ENSP00000385059  ........................................................IITCGKSHIFFWTW--------...
ENSP00000450541  ........................................................----------------------...
ENSP00000320663  ........................................................IITCGKSHIFFWTW--------...
ENSP00000448161  ........................................................----------------------...
ENSP00000270301  ........................................................FVTVGNRHVRFWFLEVSTETKVtst
ENSP00000426154  ........................................................FITCSSDNTIRLWNTESSGVHG...
ENSP00000423760  ........................................................LYFATLG---------------...
ENSP00000473564  ........................................................LYFATLG---------------...
ENSP00000205214  ........................................................LYFATLG---------------...
ENSP00000327384  ........................................................IVTCGKSHLYFWTLEGSS----...
ENSP00000334314  ........................................................IVTCGKSHLYFWTLEGSS----...
ENSP00000262233  ........................................................IVTCGKSHLYFWTLEGSS----...
ENSP00000371889  ........................................................----------------------...
ENSP00000426725  ........................................................----------------------...
ENSP00000348842  ........................................................----------------------...
ENSP00000245925  ........................................................VVTGDSG---------------...
ENSP00000414851  ........................................................LACGNDD---------------...
ENSP00000442365  ........................................................VVTGDSG---------------...
ENSP00000447548  ........................................................----------------------...
ENSP00000464789  ........................................................VVTGDSG---------------...
ENSP00000451998  gfvtggkdgivalwddsferclktyaikraalapgskglllednpsiraislghghILVGTKN---------------...
ENSP00000370039  gfvtggkdgivalwddsferclktyaikraalapgskglllednpsiraislghghILVGTKN---------------...
ENSP00000361570  ........................................................IVVGFADKLRLMNLLI------...
ENSP00000468312  ........................................................LITCGKSHIYFWTL--------...
ENSP00000285873  ........................................................----------------------...
ENSP00000378254  ........................................................IVTSGKSHVHFWNWSGGVGVP-...
ENSP00000278845  ........................................................IVTSGKSHVHFWNWSGGVGVP-...
ENSP00000293879  ........................................................----------------------...
ENSP00000435310  ........................................................IVVGFADKLRLMNLLI------...
ENSP00000448122  ........................................................----------------------...
ENSP00000348842  gfvtggkdgivelwddmferclktyaikrsalstsskglllednpsiraitlghghILVGTKN---------------...
ENSP00000314193  .....................................kkhaknnftcvachptedcIASGHMD---------------...
ENSP00000447224  ........................................................LLAAGFG---------------...
ENSP00000447224  ........................................................----------------------...
ENSP00000293879  ........................................................----------------------...
ENSP00000254442  ........................................................E--------------------Skpi
ENSP00000350187  ........................................................E--------------------Skpi
ENSP00000416289  ........................................................----------------------...
ENSP00000389144  ........................................................VAVAAAG---------------...
ENSP00000310686  ........................................................VAVAAAG---------------...
ENSP00000288912  ........................................................----------------------...
ENSP00000452765  ........................................................----------------------...
ENSP00000456709  ........................................................----------------------...
ENSP00000453378  ........................................................----------------------...
ENSP00000396295  ........................................................----------------------...
ENSP00000370039  ........................................................----------------------...
ENSP00000451998  ........................................................----------------------...
ENSP00000464109  ........................................................----------------------...
ENSP00000458843  ........................................................FVVGTAE---------------...
ENSP00000484308  ........................................................ILCTTED---------------...
ENSP00000368025  ........................................................ILCTTED---------------...
ENSP00000260643  ........................................................----------------------...
ENSP00000440796  ........................................................----------------------...
ENSP00000335522  ........................................................----------------------...
ENSP00000462737  ........................................................----------------------...
ENSP00000445814  ........................................................----------------------...
ENSP00000464095  ........................................................----------------------...
ENSP00000401445  ........................................................LYMGKKQDIWYVIDL-------...
ENSP00000307235  ........................................................----------------------...
ENSP00000256797  ........................................................----------------------...
ENSP00000413812  ........................................................----------------------...
ENSP00000370348  ........................................................----------------------...
ENSP00000394097  ........................................................----------------------...
ENSP00000442365  ........................................................----------------------...
ENSP00000378254  ........................................................----------------------...
ENSP00000433417  ........................................................----------------------...
ENSP00000278845  ........................................................----------------------...
ENSP00000364345  ........................................................YIAVLKK---------------...
ENSP00000420608  ........................................................YIAVLKK---------------...
ENSP00000466100  ........................................................----------------------...
ENSP00000217964  ........................................................----------------------...
ENSP00000385988  ........................................................----------------------...
ENSP00000471331  ........................................................H---------------------...
ENSP00000301678  ........................................................H---------------------...
ENSP00000382814  ........................................................H---------------------...
ENSP00000301679  ........................................................H---------------------...
ENSP00000483191  ........................................................----------------------...
ENSP00000197268  ........................................................I----------LFGF-------...
ENSP00000394063  ........................................................I----------LFGF-------...
ENSP00000412076  ........................................................----------------------...
ENSP00000409656  ........................................................----------------------...
ENSP00000421171  ........................................................----------------------...
ENSP00000398526  ........................................................LVVGSTQ---------------...
ENSP00000317469  ........................................................LVVGSTQ---------------...
ENSP00000465994  ........................................................----------------------...
ENSP00000364354  ........................................................YIAVLKK---------------...
ENSP00000408325  ........................................................----------------------...
ENSP00000457361  ........................................................----------------------...
ENSP00000405764  ........................................................VMAGLAN---------------...
ENSP00000399150  ........................................................----------------------...
ENSP00000398433  ........................................................----------------------...
ENSP00000407669  ........................................................----------------------...
ENSP00000451998  ........................................................----------------------...
ENSP00000432762  ........................................................----------------------...
ENSP00000433942  ........................................................----------------------...
ENSP00000482352  ........................................................----------------------...
ENSP00000403323  ........................................................----------------------...
ENSP00000477741  ........................................................----------------------...
ENSP00000355464  ........................................................----------------------...
ENSP00000355465  ........................................................----------------------...


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  cqtgqlkrivmsigvddddsffylgtttgdilkmnprtklltdvgpakdkfslgvsairclkmggllvgsgagllvfcksp
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  vplvgrsgilgelhnnifcgvacgrgrmagstfcvsysgllcqfnekrvlekwinlkvslssclcvsqelifcgctdgivr
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  vplvgrsgilgelhnnifcgvacgrgrmagstfcvsysgllcqfnekrvlekwinlkvslssclcvsqelifcgctdgivr
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  .................................................................................
ENSP00000464789  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  ycqncqsisfcaftqrsllvvcskywrvfdagdysllcsgpsengqtwtggdfvssdkviiwtengqsyiyklpasclpas
ENSP00000350187  ycqncqsisfcaftqrsllvvcskywrvfdagdysllcsgpsengqtwtggdfvssdkviiwtengqsyiyklpasclpas
ENSP00000416289  .................................................................................
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  gykpikkiqlqggitsitlrgeghqflvgteeshiyrvsftdfketliatchfdavedivfpfgtaelfatcak.......
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  ifqahslhylanlpkphylgvdvaqglepsflfhrkaeavypdtvaltfdpihqwlscvykdhsiyiwdvkdinrvgkvws
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  ifqahslhylanlpkphylgvdvaqglepsflfhrkaeavypdtvaltfdpihqwlscvykdhsiyiwdvkdinrvgkvws
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  .................................................................................
ENSP00000464789  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  dsfrsdvgkavenlippvqhilldrkdkellicppvtrffygcreyfhklliqgdssgrlniwnisdtadkqgseeglamt
ENSP00000350187  dsfrsdvgkavenlippvqhilldrkdkellicppvtrffygcreyfhklliqgdssgrlniwnisdtadkqgseeglamt
ENSP00000416289  .................................................................................
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                                    
                                                                                                    
d1g72a_            ...................................................................GQFglgt.......
ENSP00000355148  ...................................................................---...........
ENSP00000348129  ...................................................................---...........
ENSP00000482107  ...................................................................---...........
ENSP00000291576  ...................................................................---...........
ENSP00000339449  ...................................................................KDIrvwht......
ENSP00000331815  ...................................................................---...........
ENSP00000371888  ...................................................................---...........
ENSP00000380313  ...................................................................---...........
ENSP00000455046  ...................................................................---...........
ENSP00000456405  ...................................................................---...........
ENSP00000457870  ...................................................................---...........
ENSP00000280190  ...................................................................---...........
ENSP00000422763  ...................................................................---...........
ENSP00000422200  ...................................................................---...........
ENSP00000384792  elfhssyvwnvevypefedqraclpsgsfltcssdntirfwnldsspdshwqknifsntllkvvyveNDIqhlqdmshfp.
ENSP00000481995  ...................................................................---...........
ENSP00000384939  ...................................................................---...........
ENSP00000385059  ...................................................................---...........
ENSP00000450541  ...................................................................---...........
ENSP00000320663  ...................................................................---...........
ENSP00000448161  ...................................................................KKVcknsavmlkqe
ENSP00000270301  elfhssyvwnvevypefedqraclpsgsfltcssdntirfwnldsspdshwqknifsntllkvvyveNDIqhlqdmshfp.
ENSP00000426154  ...................................................................STLhrnilssdlik
ENSP00000423760  ...................................................................GLLlavnp......
ENSP00000473564  ...................................................................GLLlavnp......
ENSP00000205214  ...................................................................GLLlavnp......
ENSP00000327384  ...................................................................--L...........
ENSP00000334314  ...................................................................--L...........
ENSP00000262233  ...................................................................--L...........
ENSP00000371889  ...................................................................---...........
ENSP00000426725  ...................................................................---...........
ENSP00000348842  ...................................................................---...........
ENSP00000245925  ...................................................................GNLyvwg.......
ENSP00000414851  ...................................................................CRIhifaqqn....
ENSP00000442365  ...................................................................GNLyvwg.......
ENSP00000447548  ...................................................................---...........
ENSP00000464789  ...................................................................GNLyvwg.......
ENSP00000451998  ...................................................................GEIlevd.......
ENSP00000370039  ...................................................................GEIlevd.......
ENSP00000361570  ...................................................................---...........
ENSP00000468312  ...................................................................---...........
ENSP00000285873  ...................................................................LSIk..........
ENSP00000378254  ...................................................................---...........
ENSP00000278845  ...................................................................---...........
ENSP00000293879  ...................................................................---...........
ENSP00000435310  ...................................................................---...........
ENSP00000448122  ...................................................................---...........
ENSP00000348842  ...................................................................GEIleid.......
ENSP00000314193  ...................................................................GKIrlwrnfy....
ENSP00000447224  ...................................................................RSVrifla......
ENSP00000447224  ...................................................................---...........
ENSP00000293879  ...................................................................---...........
ENSP00000254442  ..................................................tsislqeafdklnpcpaGII...........
ENSP00000350187  ..................................................tsislqeafdklnpcpaGII...........
ENSP00000416289  ...................................................................DECrekvl......
ENSP00000389144  ...................................................................-DLmyllka.....
ENSP00000310686  ...................................................................-DLmyllka.....
ENSP00000288912  ...................................................................TLAv..........
ENSP00000452765  ...................................................................---...........
ENSP00000456709  ...................................................................--Vpvts.......
ENSP00000453378  ...................................................................---...........
ENSP00000396295  ...................................................................---...........
ENSP00000370039  ...................................................................---...........
ENSP00000451998  ...................................................................---...........
ENSP00000464109  ...................................................................SQClqnfllhgtkn
ENSP00000458843  ...................................................................GTVfhfqlvpvts.
ENSP00000484308  ...................................................................GLLrfvsp......
ENSP00000368025  ...................................................................GLLrfvsp......
ENSP00000260643  ...................................................................---...........
ENSP00000440796  ...................................................................---...........
ENSP00000335522  ...................................................................---...........
ENSP00000462737  ...................................................................SQClqnfllhgtkn
ENSP00000445814  ...................................................................---...........
ENSP00000464095  ...................................................................---...........
ENSP00000401445  ...................................................................---...........
ENSP00000307235  ...................................................................---...........
ENSP00000256797  ...................................................................---...........
ENSP00000413812  ...................................................................---...........
ENSP00000370348  ...................................................................---...........
ENSP00000394097  ...................................................................---...........
ENSP00000442365  ...................................................................---...........
ENSP00000378254  ...................................................................---...........
ENSP00000433417  ...................................................................---...........
ENSP00000278845  ...................................................................---...........
ENSP00000364345  ...................................................................TTLalhhl......
ENSP00000420608  ...................................................................TTLalhhl......
ENSP00000466100  ...................................................................---...........
ENSP00000217964  ...................................................................---...........
ENSP00000385988  ...................................................................---...........
ENSP00000471331  ...................................................................---...........
ENSP00000301678  ...................................................................---...........
ENSP00000382814  ...................................................................---...........
ENSP00000301679  ...................................................................---...........
ENSP00000483191  ...................................................................---...........
ENSP00000197268  ...................................................................GNIqavalrdifvq
ENSP00000394063  ...................................................................GNIqavalrdifvq
ENSP00000412076  ...................................................................---...........
ENSP00000409656  ...................................................................---...........
ENSP00000421171  ...................................................................---...........
ENSP00000398526  ...................................................................DSLhgft.......
ENSP00000317469  ...................................................................DSLhgft.......
ENSP00000465994  ...................................................................---...........
ENSP00000364354  ...................................................................TTLalhhl......
ENSP00000408325  ...................................................................---...........
ENSP00000457361  ...................................................................---...........
ENSP00000405764  ...................................................................GEVriy........
ENSP00000399150  ...................................................................---...........
ENSP00000398433  ...................................................................---...........
ENSP00000407669  ...................................................................---...........
ENSP00000451998  ...................................................................---...........
ENSP00000432762  ...................................................................---...........
ENSP00000433942  ...................................................................---...........
ENSP00000482352  ...................................................................---...........
ENSP00000403323  ...................................................................---...........
ENSP00000477741  ...................................................................---...........
ENSP00000355464  ...................................................................---...........
ENSP00000355465  ...................................................................---...........


                                              220       230                 240                     
                                                |         |                   |                     
d1g72a_            ...........................KTWEGDAWKIG----..........GGTNWGWYAYDP....KLN..........
ENSP00000355148  ...........................ETGKLLWKVR-----..........YDTFIVSCKFSP....DGK..........
ENSP00000348129  ...........................ETGKLLWKVR-----..........YDTFIVSCKFSP....DGK..........
ENSP00000482107  ...........................PEFNLIHSLSI----..........SDQSIASVAINS....SGD..........
ENSP00000291576  ...........................PEFNLIHSLSI----..........SDQSIASVAINS....SGD..........
ENSP00000339449  ...........................SSNRELLRITV----..........PNMTCHGIDFMR....DGK..........
ENSP00000331815  ...........................QDRSCLAVLTA----..........HYSAVTSLAFSA....DGH..........
ENSP00000371888  ...........................NSNNPNPIISYDG--..........VNKNIASVGFHE....DGR..........
ENSP00000380313  ...........................NSNNPNPIISYDG--..........VNKNIASVGFHE....DGR..........
ENSP00000455046  ...........................NSNNPNPIISYDG--..........VNKNIASVGFHE....DGR..........
ENSP00000456405  ...........................NSNNPNPIISYDG--..........VNKNIASVGFHE....DGR..........
ENSP00000457870  ...........................NSNNPNPIISYDG--..........VNKNIASVGFHE....DGR..........
ENSP00000280190  ...........................QKGKIIQRFNEH---..........GTNGIFCIAWSHk...DSK..........
ENSP00000422763  ...........................QKGKIIQRFNEH---..........GTNGIFCIAWSHk...DSK..........
ENSP00000422200  ...........................QKGKIIQRFNEH---..........GTNGIFCIAWSHk...DSK..........
ENSP00000384792  ...........................DRGSENGTPMD----..........VKAGVRVMQVSP....DGQ..........
ENSP00000481995  ...........................QDRSCLAVLTA----..........HYSAVTSLAFSA....DGH..........
ENSP00000384939  ...........................SGNSLTRKQGIFGKYe.........KPKFVQCLAFLG....NGD..........
ENSP00000385059  ...........................SGNSLTRKQGIFGKYe.........KPKFVQCLAFLG....NGD..........
ENSP00000450541  ...........................VRGQLAFQHT-----..........YPKSLNCVAFHP....EGQ..........
ENSP00000320663  ...........................SGNSLTRKQGIFGKYe.........KPKFVQCLAFLG....NGD..........
ENSP00000448161  ....vdvvfqenevmvlavdhirrlqlI-----NGRTGQIDYl.........TEAQVSCCCLSP....HLQ..........
ENSP00000270301  ...........................DRGSENGTPMD----..........VKAGVRVMQVSP....DGQ..........
ENSP00000426154  ...........iiyvdgntqalldtelP-------------GgdkadaslldPRVGIRSVCVSP....NGQ..........
ENSP00000423760  ...........................ATGNVIWKHSC----..........GKPLFSSPQC--....CSQ..........
ENSP00000473564  ...........................ATGNVIWKHSC----..........GKPLFSSPQC--....CSQ..........
ENSP00000205214  ...........................ATGNVIWKHSC----..........GKPLFSSPQC--....CSQ..........
ENSP00000327384  ...........................NKKQGLFEKQE----..........KPKFVLCVTFSE....NGD..........
ENSP00000334314  ...........................NKKQGLFEKQE----..........KPKFVLCVTFSE....NGD..........
ENSP00000262233  ...........................NKKQGLFEKQE----..........KPKFVLCVTFSE....NGD..........
ENSP00000371889  ...........................SVNSVVSTFPMGST-..........VLDQQLGCLW--....QKD..........
ENSP00000426725  ...........................SVNSVVSTFPMGST-..........VLDQQLGCLW--....QKD..........
ENSP00000348842  ...........................RKGKLLASATG----..........HSDRIFDISWDPy...QPN..........
ENSP00000245925  ...........................KGGNRITQAVLGA--..........HDGGVFGLCALR....DGT..........
ENSP00000414851  ...........................DQFQKVLSLCG----..........HEDWIRGVEWAAfg..RDL..........
ENSP00000442365  ...........................KGGNRITQAVLGA--..........HDGGVFGLCALR....DGT..........
ENSP00000447548  ...........................LSGQEKFTIWDGGSKnp........AEPQIWNLHVDE....AHK..........
ENSP00000464789  ...........................KGGNRITQAVLGA--..........HDGGVFGLCALR....DGT..........
ENSP00000451998  ...........................KSGPITLLVQGH---..........MEGEVWGLATHP....YLP..........
ENSP00000370039  ...........................KSGPITLLVQGH---..........MEGEVWGLATHP....YLP..........
ENSP00000361570  ...........................DDIRSFKEY------..........SVRGCGECSFS-....NGG..........
ENSP00000468312  ...........................EGGSLSKRQGLFEKHe.........KPKYVLCVTFLE....GGD..........
ENSP00000285873  ...........................NNYDVKNFWQG----..........VKSKVTALCWHPt...KEG..........
ENSP00000378254  ...........................GNGTLTRKQGVFGKYk.........KPKFIPCFVFLP....DGD..........
ENSP00000278845  ...........................GNGTLTRKQGVFGKYk.........KPKFIPCFVFLP....DGD..........
ENSP00000293879  ...........................ATYDLVSSTR-----..........LPEPVHGVAFNPw...DAGeltcvgqgtv
ENSP00000435310  ...........................DDIRSFKEY------..........SVRGCGECSFS-....NGG..........
ENSP00000448122  ...........................ATYDLVSSTR-----..........LPEPVHGVAFNPw...DAGeltcvgqgtv
ENSP00000348842  ...........................KSGPMTLLVQGH---..........MEGEVWGLAAHP....LLP..........
ENSP00000314193  ...........................DDKKYTYTCLHW---..........HHDMVMDLAFSV....TGT..........
ENSP00000447224  ...........................DSRGFRRFMAMDLE-..........HEDMVETAVFGT....ENN..........
ENSP00000447224  ...........................LSGQEKFTIWDGGSKnp........AEPQIWNLHVDE....AHK..........
ENSP00000293879  ...........................ATQASPGPQVYIG--..........HSEPVQAVAFSP....DQQ..........
ENSP00000254442  ...........................DQLSVIPNSN-----..........EPLKVTASVYIP....AHG..........
ENSP00000350187  ...........................DQLSVIPNSN-----..........EPLKVTASVYIP....AHG..........
ENSP00000416289  ...........................QGLVPRGTVMGS---..........LLGKVLCLQLSL....DDH..........
ENSP00000389144  ...........................EDSARTLLYA-----..........HGPPVTCLDV--....SAN..........
ENSP00000310686  ...........................EDSARTLLYA-----..........HGPPVTCLDV--....SAN..........
ENSP00000288912  ...........................ETPACTLELPT----..........EYGVQNYVTFNP....TNNkelvsnsktr
ENSP00000452765  ...........................KTLAVVHSFRSSQ--..........FPDWINCMCIVHsmriQED..........
ENSP00000456709  ...........................NSSEKQWVRTKPFQH..........HTHDVRTVAH--....SPT..........
ENSP00000453378  ...........................KTLAVVHSFRSSQ--..........FPDWINCMCIVHsmr.IQD..........
ENSP00000396295  ...........................---------------..........------------....---..........
ENSP00000370039  ...........................MNKQTLSILRCY---..........HSKGVCSVSFSA....TGK..........
ENSP00000451998  ...........................MNKQTLSILRCY---..........HSKGVCSVSFSA....TGK..........
ENSP00000464109  vtnssslrlprqnsdggqknkprehiiDCGDIVWSLAFGSSVpekqsrc...VNIEWHRFRFGQ....DQL..........
ENSP00000458843  ...........................NSSEKQWVRTKPFQH..........HTHDVRTVAH--....SPT..........
ENSP00000484308  ...........................VTGDLLVITWPFS--..........ILDQAVDWAYDP....GKE..........
ENSP00000368025  ...........................VTGDLLVITWPFS--..........ILDQAVDWAYDP....GKE..........
ENSP00000260643  ...........................---------------..........------VVCFNH....DNT..........
ENSP00000440796  ...........................---------------..........------------....---..........
ENSP00000335522  ...........................---------------..........------------....---..........
ENSP00000462737  vtnssslrlprqnsdggqknkprehiiDCGDIVWSLAFGSSVpekqsrc...VNIEWHRFRFGQ....DQL..........
ENSP00000445814  ...........................---------------..........------------....---..........
ENSP00000464095  ...........................---------------..........------------....---..........
ENSP00000401445  ...........................LTGEKQQTLS-----..........-SAFADSLCP--....STS..........
ENSP00000307235  ...........................YSGKVRYICSAL---..........GCRQWDSDEMEQ....EED..........
ENSP00000256797  ...........................QKQQGLMKLPFTIPElv........HASPCRS-----....SDG..........
ENSP00000413812  ...........................QKQQGLMKLPFTIPElv........HASPCRS-----....SDG..........
ENSP00000370348  ...........................---------------..........------------....---..........
ENSP00000394097  ...........................---------------..........------------....---..........
ENSP00000442365  ...........................---------------..........------------....---..........
ENSP00000378254  ...........................---------------..........------------....---..........
ENSP00000433417  ...........................---------------..........------------....---..........
ENSP00000278845  ...........................---------------..........------------....---..........
ENSP00000364345  ...........................SSGHLKWVEHLPE--..........SDSIHYQMVYSY....GSG..........
ENSP00000420608  ...........................SSGHLKWVEHLPE--..........SDSIHYQMVYSY....GSG..........
ENSP00000466100  ...........................AKETKVVDVKVPE--..........DFGPVRTVAEG-....HGD..........
ENSP00000217964  ...........................---------------..........------------....---..........
ENSP00000385988  ...........................---------------..........------------....---..........
ENSP00000471331  ...........................---------------..........SSGAVRYLMHVPgna.GAD..........
ENSP00000301678  ...........................---------------..........SSGAVRYLMHVPgna.GAD..........
ENSP00000382814  ...........................---------------..........SSGAVRYLMHVPgna.GAD..........
ENSP00000301679  ...........................---------------..........SSGAVRYLMHVPgna.GAD..........
ENSP00000483191  ...........................---------------..........------------....---..........
ENSP00000197268  ............aqnrdssppslqieePEWEKRRSINLSELIdvys......DGVELLQMVKAPdsn.CSN..........
ENSP00000394063  ............aqnrdssppslqieePEWEKRRSINLSELIdvys......DGVELLQMVKAPdsn.CSN..........
ENSP00000412076  ...........................YSGKVRYICSAL---..........GCRQWDSDEMEQ....EED..........
ENSP00000409656  ...........................---------------..........------------....---..........
ENSP00000421171  ...........................---------------..........------------....---..........
ENSP00000398526  ...........................HKGKKLWTVQ-----..........MPAAILTMNLLEqhsrGLQ..........
ENSP00000317469  ...........................HKGKKLWTVQ-----..........MPAAILTMNLLEqhsrGLQ..........
ENSP00000465994  ...........................------WSRI-----..........IEDPARSAGFHP....SGS..........
ENSP00000364354  ...........................SSGHLKWVEHLPE--..........SDSIHYQMVYSY....GSG..........
ENSP00000408325  ...........................YSGKVRYICSAL---..........GCRQWDSDEMEQ....EED..........
ENSP00000457361  ...........................---------------..........------------....---..........
ENSP00000405764  ...........................RDKALLNVIH-----..........TPDAVTSLCFGRygr.EDN..........
ENSP00000399150  ...........................---------------..........------------....---..........
ENSP00000398433  ...........................---------------..........------------....---..........
ENSP00000407669  ...........................---------------..........------------....---..........
ENSP00000451998  ...........................---------------..........--------VYGW....TEE..........
ENSP00000432762  ...........................---------------..........------------....---..........
ENSP00000433942  ...........................---------------..........------------....---..........
ENSP00000482352  ...........................---------------..........------------....---..........
ENSP00000403323  ...........................---------------..........------------....---..........
ENSP00000477741  ...........................---------------..........------------....---..........
ENSP00000355464  ...........................---------------..........------------....---..........
ENSP00000355465  ...........................---------------..........------------....---..........


                                                             250                   260              
                                                               |                     |              
d1g72a_            ..........................................LFYYG.......SG.NPA....PWNETM..RP.......
ENSP00000355148  ..........................................YVVSG.......FDvDHG....ICIMDA..EN.......
ENSP00000348129  ..........................................YVVSG.......FDvDHG....ICIMDA..EN.......
ENSP00000482107  ..........................................WIAFG.......CSgLGQ....LLVWEW..QS.......
ENSP00000291576  ..........................................WIAFG.......CSgLGQ....LLVWEW..QS.......
ENSP00000339449  ..........................................SIISA.......WN.DGK....IRAFAP..ET.......
ENSP00000331815  ..........................................TMLSS.......GR.DKI....CIIWDL..QS.......
ENSP00000371888  ..........................................WMYTG.......GE.DCT....ARIWDLrsRN.......
ENSP00000380313  ..........................................WMYTG.......GE.DCT....ARIWDLrsRN.......
ENSP00000455046  ..........................................WMYTG.......GE.DCT....ARIWDLrsRN.......
ENSP00000456405  ..........................................WMYTG.......GE.DCT....ARIWDLrsRN.......
ENSP00000457870  ..........................................WMYTG.......GE.DCT....ARIWDLrsRN.......
ENSP00000280190  ..........................................RIATC.......SS.DGF....CIIRT-..ID.......
ENSP00000422763  ..........................................RIATC.......SS.DGF....CIIRT-..ID.......
ENSP00000422200  ..........................................RIATC.......SS.DGF....CIIRT-..ID.......
ENSP00000384792  ..........................................HLASG.......DR.SGN....LRIHEL..HF.......
ENSP00000481995  ..........................................TMLSS.......GR.DKI....CIIWDL..QS.......
ENSP00000384939  ..........................................-VLTG.......DS.GGV....MLIWSK..TTveptpgk
ENSP00000385059  ..........................................-VLTG.......DS.GGV....MLIWSK..TTveptpgk
ENSP00000450541  ..........................................VIATG.......SW.AGS....ISFFQV..DG.......
ENSP00000320663  ..........................................-VLTG.......DS.GGV....MLIWSK..TTveptpgk
ENSP00000448161  ..........................................YIAFG.......DE.NGA....IEILEL..VN.......
ENSP00000270301  ..........................................HLASG.......DR.SGN....LRIHEL..HF.......
ENSP00000426154  ..........................................HLASG.......DR.MGT....LRVHEL..QS.......
ENSP00000423760  ..........................................YICIG.......CV.DGN....LLCFT-..HF.......
ENSP00000473564  ..........................................YICIG.......CV.DGN....LLCFT-..HF.......
ENSP00000205214  ..........................................YICIG.......CV.DGN....LLCFT-..HF.......
ENSP00000327384  ..........................................-TITG.......DS.SGN....ILVWGK..GT.......
ENSP00000334314  ..........................................-TITG.......DS.SGN....ILVWGK..GT.......
ENSP00000262233  ..........................................-TITG.......DS.SGN....ILVWGK..GT.......
ENSP00000371889  ..........................................HLLSV.......SL.SGY....INYLDRn.NP.......
ENSP00000426725  ..........................................HLLSV.......SL.SGY....INYLDRn.NP.......
ENSP00000348842  ..........................................RVVSC.......GV.-KH....IKFWTL..CGnaltakr
ENSP00000245925  ..........................................LVSGG.......GR.DRR....VVLWG-..SD.......
ENSP00000414851  ..........................................FLASC.......SQ.DCL....IRIWKLyiK-.......
ENSP00000442365  ..........................................LVSGG.......GR.DRR....VVLWG-..SD.......
ENSP00000447548  ..........................................VVYSA.......SG.-SK....INAWNL..ET.......
ENSP00000464789  ..........................................LVSGG.......GR.DRR....VVLWG-..SD.......
ENSP00000451998  ..........................................ICATV.......SD.DKT....LRIWDL..SP.......
ENSP00000370039  ..........................................ICATV.......SD.DKT....LRIWDL..SP.......
ENSP00000361570  ..........................................HLFAA.......VN.GNV....IHVYTT..TS.......
ENSP00000468312  ..........................................-VVTG.......DS.GGN....LYVWGKg.GN.......
ENSP00000285873  ..........................................CLAFG.......TD.DGK....VGLYDT..YS.......
ENSP00000378254  ..........................................-ILTG.......DS.EGN....ILTWGR..SPsdsktpg
ENSP00000278845  ..........................................-ILTG.......DS.EGN....ILTWGR..SPsdsktpg
ENSP00000293879  ...tfwllqqrgadislqvrrepvpeavgageltslcygappLLYCG.......TS.SGQ....VCVWDT..RA.......
ENSP00000435310  ..........................................HLFAA.......VN.GNV....IHVYTT..TS.......
ENSP00000448122  ...tfwllqqrgadislqvrrepvpeavgageltslcygappLLYCG.......TS.SGQ....VCVWDT..RA.......
ENSP00000348842  ..........................................ICATV.......SD.DKT....LRIWEL..SA.......
ENSP00000314193  ..........................................SLLSG.......GR.ESV....LVEWRD..AT.......
ENSP00000447224  ..........................................LIITG.......SL.DAL....IQVWSLs.EQ.......
ENSP00000447224  ..........................................VVYSA.......SG.-SK....INAWNL..ET.......
ENSP00000293879  ..........................................QVLSA.......GD.--A....VFLWDVl.AP.......
ENSP00000254442  ..........................................RLVCG.......RE.DGS....IVIVPA..TQ.......
ENSP00000350187  ..........................................RLVCG.......RE.DGS....IVIVPA..TQ.......
ENSP00000416289  ..........................................VVAVC.......AG.-NK....IFMLDI..EQrfsvtyi
ENSP00000389144  ..........................................QVAFGvqglgwvYE.GSK....ILVYSL..EA.......
ENSP00000310686  ..........................................QVAFGvqglgwvYE.GSK....ILVYSL..EA.......
ENSP00000288912  aiyyawyeerdtlahsaplltektfnklvgkfsqsifhlnltQILSA.......TM.EGK....LVVWDIh.RP.......
ENSP00000452765  ..........................................SLLVV.......SV.AGE....LKVWDLs.SS.......
ENSP00000456709  ..........................................ALISG.......GT.DTH....LVFRPL..ME.......
ENSP00000453378  ..........................................SLLVV.......SV.AGE....LKVWDLs.SS.......
ENSP00000396295  ..........................................-----.......--.---....------..--.......
ENSP00000370039  ..........................................LLLSV.......GL.DPEht..ITIWRW..QE.......
ENSP00000451998  ..........................................LLLSV.......GL.DPEht..ITIWRW..QE.......
ENSP00000464109  ..........................................LLATG.......LN.NGR....IKIWDV..YT.......
ENSP00000458843  ..........................................ALISG.......GT.DTH....LVFRPL..ME.......
ENSP00000484308  ..........................................ELFVA.......TG.SSE....VLVFDT..TRcpcpa..
ENSP00000368025  ..........................................ELFVA.......TG.SSE....VLVFDT..TRcpcpa..
ENSP00000260643  ..........................................LLATG.......GT.DGY....VRVWKV..PS.......
ENSP00000440796  ..........................................-----.......--.---....------..--.......
ENSP00000335522  ..........................................-----.......--.---....------..--.......
ENSP00000462737  ..........................................LLATG.......LN.NGR....IKIWDV..YT.......
ENSP00000445814  ..........................................-----.......--.---....------..--.......
ENSP00000464095  ..........................................-----.......--.---....------..--.......
ENSP00000401445  ..........................................LLYLG.......RT.EYT....ITMYDT..KT.......
ENSP00000307235  ..........................................ILLLQ.......RT.QKT....VRAVGP..RS.......
ENSP00000256797  ..........................................VFYTG.......RK.QDA....WFVVDP..ES.......
ENSP00000413812  ..........................................VFYTG.......RK.QDA....WFVVDP..ES.......
ENSP00000370348  ..........................................-----.......--.---....------..--.......
ENSP00000394097  ..........................................-----.......--.---....------..--.......
ENSP00000442365  ..........................................-----.......--.---....------..--.......
ENSP00000378254  ..........................................-----.......--.---....------..--.......
ENSP00000433417  ..........................................-----.......--.---....------..--.......
ENSP00000278845  ..........................................-----.......--.---....------..--.......
ENSP00000364345  ..........................................VVWAL.......GV.VPFshvnIVKFNV..ED.......
ENSP00000420608  ..........................................VVWAL.......GV.VPFshvnIVKFNV..ED.......
ENSP00000466100  ..........................................TLYVG.......TT.RNS....ILQGSV..HT.......
ENSP00000217964  ..........................................-----.......--.---....------..--.......
ENSP00000385988  ..........................................-----.......--.---....------..--.......
ENSP00000471331  ..........................................VLLVG.......SE.--A....FVLLDG..QE.......
ENSP00000301678  ..........................................VLLVG.......SE.--A....FVLLDG..QE.......
ENSP00000382814  ..........................................VLLVG.......SE.--A....FVLLDG..QE.......
ENSP00000301679  ..........................................VLLVG.......SE.--A....FVLLDG..QE.......
ENSP00000483191  ..........................................-----.......--.--N....VHVMNI..ST.......
ENSP00000197268  ..........................................LLITT.......RQ.--S....LVLLRG..QN.......
ENSP00000394063  ..........................................LLITT.......RQ.--S....LVLLRG..QN.......
ENSP00000412076  ..........................................ILLLQ.......RT.QKT....VRAVGP..RS.......
ENSP00000409656  ..........................................-----.......--.---....------..--.......
ENSP00000421171  ..........................................-----.......--.---....------..--.......
ENSP00000398526  ..........................................AVMAG.......LA.NGE....VRIY--..RD.......
ENSP00000317469  ..........................................AVMAG.......LA.NGE....VRIY--..RD.......
ENSP00000465994  ..........................................VLAVG.......TV.TGR....WLLLDT..ET.......
ENSP00000364354  ..........................................VVWAL.......GV.VPFshvnIVKFNV..ED.......
ENSP00000408325  ..........................................ILLLQ.......RT.QKT....VRAVGP..RS.......
ENSP00000457361  ..........................................-----.......--.---....------..--.......
ENSP00000405764  ..........................................TLI--.......--.---....------..--.......
ENSP00000399150  ..........................................-----.......--.---....------..--.......
ENSP00000398433  ..........................................-----.......--.---....------..--.......
ENSP00000407669  ..........................................-----.......--.---....------..--.......
ENSP00000451998  ..........................................MAFSG.......TS.TGD....VCIW--..RD.......
ENSP00000432762  ..........................................-----.......--.---....------..--.......
ENSP00000433942  ..........................................-----.......--.---....------..--.......
ENSP00000482352  ..........................................-----.......--.---....------..--.......
ENSP00000403323  ..........................................-----.......--.---....------..--.......
ENSP00000477741  ..........................................-----.......--.---....------..--.......
ENSP00000355464  ..........................................-----.......--.---....------..--.......
ENSP00000355465  ..........................................-----.......--.---....------..--.......


                                                          270                                       
                                                            |                                       
d1g72a_            .....................................GDNKWTMT....................................
ENSP00000355148  .....................................ITTVSVIK....................................
ENSP00000348129  .....................................ITTVSVIK....................................
ENSP00000482107  .....................................ESYVLKQQ....................................
ENSP00000291576  .....................................ESYVLKQQ....................................
ENSP00000339449  .....................................GRLMYVIN....................................
ENSP00000331815  .....................................CQATRTVPvfesveaavllpeepvsqlgvkspglyfltagdqgt
ENSP00000371888  .....................................LQCQRIF-....................................
ENSP00000380313  .....................................LQCQRIF-....................................
ENSP00000455046  .....................................LQCQRIF-....................................
ENSP00000456405  .....................................LQCQRIF-....................................
ENSP00000457870  .....................................LQCQRIF-....................................
ENSP00000280190  .....................................GKVLHKY-....................................
ENSP00000422763  .....................................GKVLHKY-....................................
ENSP00000422200  .....................................GKVLHKY-....................................
ENSP00000384792  .....................................MDELVKVE....................................
ENSP00000481995  .....................................CQATRTVPvfesveaavllpeepvsqlgvkspglyfltagdqgt
ENSP00000384939  ................................gpkgvYQISKQIK....................................
ENSP00000385059  ................................gpkgvYQISKQIK....................................
ENSP00000450541  .....................................LKVTKDLG....................................
ENSP00000320663  ................................gpkgvYQISKQIK....................................
ENSP00000448161  .....................................NRIFQSRF....................................
ENSP00000270301  .....................................MDELVKVE....................................
ENSP00000426154  .....................................LSEMLKVE....................................
ENSP00000423760  .....................................GEQVWQFS....................................
ENSP00000473564  .....................................GEQVWQFS....................................
ENSP00000205214  .....................................GEQVWQFS....................................
ENSP00000327384  .....................................NRISYAVQ....................................
ENSP00000334314  .....................................NRISYAVQ....................................
ENSP00000262233  .....................................NRISYAVQ....................................
ENSP00000371889  .....................................SKPLHVIK....................................
ENSP00000426725  .....................................SKPLHVIK....................................
ENSP00000348842  gifgktgdlqtilclacakeditysgalngdiyvwkgLNLVRTIQ....................................
ENSP00000245925  .....................................YSKLQEVEvpedfgpvrtvaeghgdtlyvgttrnsilqgsvhtg
ENSP00000414851  .....................................STSLETQDddnirlkentftienesvkiafavtlet........
ENSP00000442365  .....................................YSKLQEVEvpedfgpvrtvaeghgdtlyvgttrnsilqgsvhtg
ENSP00000447548  .....................................AEPVFHIL....................................
ENSP00000464789  .....................................YSKLQEVEvpedfgpvrtvaeghgdtlyvgttrnsilqgsvhtg
ENSP00000451998  .....................................SHCMLAVR....................................
ENSP00000370039  .....................................SHCMLAVR....................................
ENSP00000361570  .....................................LENISSLK....................................
ENSP00000468312  .....................................RITQAVLG....................................
ENSP00000285873  .....................................NKPPQISS....................................
ENSP00000378254  ..............................rggaketYGIVAQAHahegsifalclrrdgtvlsgggrdrrlvqwgpglva
ENSP00000278845  ..............................rggaketYGIVAQAHahegsifalclrrdgtvlsgggrdrrlvqwgpglva
ENSP00000293879  .....................................GRCFLSWE....................................
ENSP00000435310  .....................................LENISSLK....................................
ENSP00000448122  .....................................GRCFLSWE....................................
ENSP00000348842  .....................................QHRMLAVR....................................
ENSP00000314193  .....................................EKNKEFLP....................................
ENSP00000447224  .....................................GTLLDILEgvgapvsllarggalvasaspqsssfkvwdlsdahr
ENSP00000447224  .....................................AEPVFHIL....................................
ENSP00000293879  .....................................TESDQSFPgappacktgpgagpledaasraselprqqvpkpcqa
ENSP00000254442  .....................................TAIVQLLQ....................................
ENSP00000350187  .....................................TAIVQLLQ....................................
ENSP00000416289  ........................erpdvnnrhkvppPTFLHTFS....................................
ENSP00000389144  .....................................GRRLLKLG....................................
ENSP00000310686  .....................................GRRLLKLG....................................
ENSP00000288912  .....................................PSSASTFLgfpyikpcklvhlqkegitvlttidsyivtgdikgn
ENSP00000452765  .....................................INSIQEKQdvyekeskfleslncqtirfctyterlllvvfskcw
ENSP00000456709  .....................................KVEVKNYDaalrkitfphrcliscskkrqlllfqfahhlelwrl
ENSP00000453378  .....................................INSIQEKQdvyekeskfleslncqtirfctyterlllvvfskcw
ENSP00000396295  .....................................--------....................................
ENSP00000370039  .....................................GAKIASRA....................................
ENSP00000451998  .....................................GAKIASRA....................................
ENSP00000464109  .....................................GKLLLNLV....................................
ENSP00000458843  .....................................KVEVKNYDaalrkitfphrcliscskkrqlllfqfahhlelwrl
ENSP00000484308  .....................................KYLLGTSP....................................
ENSP00000368025  .....................................KYLLGTSP....................................
ENSP00000260643  .....................................LEKVLEFK....................................
ENSP00000440796  .....................................--------....................................
ENSP00000335522  .....................................--------....................................
ENSP00000462737  .....................................GKLLLNLV....................................
ENSP00000445814  .....................................--------....................................
ENSP00000464095  .....................................--------....................................
ENSP00000401445  .....................................RELRWNATyfdyaaslpeddvdykmshfvsngdgl.........
ENSP00000307235  .....................................GNEKWNFSvghfelryipdmetragfiestfkpnenteeskiis
ENSP00000256797  .....................................GETQMTLT....................................
ENSP00000413812  .....................................GETQMTLT....................................
ENSP00000370348  .....................................--------....................................
ENSP00000394097  .....................................--------....................................
ENSP00000442365  .....................................--------....................................
ENSP00000378254  .....................................--------....................................
ENSP00000433417  .....................................--------....................................
ENSP00000278845  .....................................--------....................................
ENSP00000364345  .....................................GEIVQQV-....................................
ENSP00000420608  .....................................GEIVQQVR....................................
ENSP00000466100  .....................................GFSLLVQ-....................................
ENSP00000217964  .....................................--------....................................
ENSP00000385988  .....................................--------....................................
ENSP00000471331  .....................................LTPRWTP-....................................
ENSP00000301678  .....................................LTPRWTP-....................................
ENSP00000382814  .....................................LTPRWTP-....................................
ENSP00000301679  .....................................LTPRWTP-....................................
ENSP00000483191  .....................................GKKVKGGS....................................
ENSP00000197268  .....................................LTPYWALRlqglrsqptpgyftddqtldfllqiqdgvgmkk...
ENSP00000394063  .....................................LTPYWALRlqglrsqptpgyftddqtldfllqiqdgvgmkk...
ENSP00000412076  .....................................GNEKWNFSvghfelryipdmetragfiestfkpnenteeskiis
ENSP00000409656  .....................................--------....................................
ENSP00000421171  .....................................--------....................................
ENSP00000398526  .....................................KALLNVI-....................................
ENSP00000317469  .....................................KALLNVI-....................................
ENSP00000465994  .....................................HDLVAIHT....................................
ENSP00000364354  .....................................GEIVQQV-....................................
ENSP00000408325  .....................................GNEKWNFSvghfelryipdmetragfiestfkpnenteeskiis
ENSP00000457361  .....................................--------....................................
ENSP00000405764  .....................................--------....................................
ENSP00000399150  .....................................--------....................................
ENSP00000398433  .....................................--------....................................
ENSP00000407669  .....................................--------....................................
ENSP00000451998  .....................................IFLVKTVK....................................
ENSP00000432762  .....................................--------....................................
ENSP00000433942  .....................................--------....................................
ENSP00000482352  .....................................--------....................................
ENSP00000403323  .....................................--------....................................
ENSP00000477741  .....................................--------....................................
ENSP00000355464  .....................................--------....................................
ENSP00000355465  .....................................--------....................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  .................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  fsl..............................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  fsl..............................................................................
ENSP00000447548  .................................................................................
ENSP00000464789  fsl..............................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  lqeaeipehfgavraiaeglgsellvgttknallrgdlaqgfsp.....................................
ENSP00000278845  lqeaeipehfgavraiaeglgsellvgttknallrgdlaqgfsp.....................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000314193  .................................................................................
ENSP00000447224  srvpapfldrtgltavshngsyvyfpkigdknk................................................
ENSP00000447224  .................................................................................
ENSP00000293879  spprlgvcarppeggdgardtrnsgaprttylasckaftparvscsphsakgtcpppasggwlrlkavvgysgngranmvw
ENSP00000254442  .................................................................................
ENSP00000350187  .................................................................................
ENSP00000416289  .................................................................................
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  ikfydhtlsivnwyshlklgairtlsfsktpatppteksnyppdctlkgdlfvlrnfiigtsdaavyhlttdgtklek...
ENSP00000452765  kvydycdfsllltevsrngqffaggeviaahriliwtedghsyiyqllnrwaqmgaayktfsglsksiypadgrvlketiy
ENSP00000456709  gstvatgkngdtlplsknadhllh.........................................................
ENSP00000453378  kvydycdfsllltevsrngqffaggeviaahriliwtedghsyiyqllnsglsksiypadgrvlketiyphllcstsvqen
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  gstvatgkngdtlplsknadhllh.........................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  dveeqeaaimdi.....................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  dveeqeaaimdi.....................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  dveeqeaaimdi.....................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                       280        290                               
                                                         |          |                               
d1g72a_            ................................IWGRDLDTGMA.KWGYQKTPHDEW.........................
ENSP00000355148  ................................-----------.------------.........................
ENSP00000348129  ................................-----------.------------.........................
ENSP00000482107  ................................-----------.------------.........................
ENSP00000291576  ................................-----------.------------.........................
ENSP00000339449  ................................-----------.------------.........................
ENSP00000331815  ................................LRVWEAASGQC.VYTQAQPPGPGQelthctlahtagvvltatadhnlll
ENSP00000371888  ................................-----------.------------.........................
ENSP00000380313  ................................-----------.------------.........................
ENSP00000455046  ................................-----------.------------.........................
ENSP00000456405  ................................-----------.------------.........................
ENSP00000457870  ................................-----------.------------.........................
ENSP00000280190  ................................-----------.------------.........................
ENSP00000422763  ................................-----------.------------.........................
ENSP00000422200  ................................-----------.------------.........................
ENSP00000384792  ................................-----------.------------.........................
ENSP00000481995  ................................LRVWEAASGQC.VYTQAQPPGPGQelthctlahtagvvltatadhnlll
ENSP00000384939  ................................-----------.------------.........................
ENSP00000385059  ................................-----------.------------.........................
ENSP00000450541  ................................-----------.------------.........................
ENSP00000320663  ................................-----------.------------.........................
ENSP00000448161  ................................-----------.------------.........................
ENSP00000270301  ................................-----------.------------.........................
ENSP00000426154  ................................-----------.------------.........................
ENSP00000423760  ................................-----------.------------.........................
ENSP00000473564  ................................-----------.------------.........................
ENSP00000205214  ................................-----------.------------.........................
ENSP00000327384  ................................-----------.------------.........................
ENSP00000334314  ................................-----------.------------.........................
ENSP00000262233  ................................-----------.------------.........................
ENSP00000371889  ................................-----------.------------.........................
ENSP00000426725  ................................-----------.------------.........................
ENSP00000348842  ................................-----------.------------.........................
ENSP00000245925  ................................LVQ--------.------------.........................
ENSP00000414851  ................................VLA--------.------------.........................
ENSP00000442365  ................................LVQ--------.------------.........................
ENSP00000447548  ................................-----------.------------.........................
ENSP00000464789  ................................LVQ--------.------------.........................
ENSP00000451998  ................................-----------.------------.........................
ENSP00000370039  ................................-----------.------------.........................
ENSP00000361570  ................................-----------.------------.........................
ENSP00000468312  ................................-----------.------------.........................
ENSP00000285873  ................................-----------.------------.........................
ENSP00000378254  ................................VIQ--------.------------.........................
ENSP00000278845  ................................VIQ--------.------------.........................
ENSP00000293879  ................................-----------.------------.........................
ENSP00000435310  ................................-----------.------------.........................
ENSP00000448122  ................................-----------.------------.........................
ENSP00000348842  ................................-----------.------------.........................
ENSP00000314193  ................................-----------.------------.........................
ENSP00000447224  ................................VTIWDLAEGEE.QDSL--------.........................
ENSP00000447224  ................................-----------.------------.........................
ENSP00000293879  ..................rpdtgffaytcgrlVVVEDLHSGAQ.QHWS--------.........................
ENSP00000254442  ................................--------GEH.MLRRGWPPHRTL.........................
ENSP00000350187  ................................--------GEH.MLRRGWPPHRTL.........................
ENSP00000416289  ................................------QTQAV.RAELQ-------.........................
ENSP00000389144  ................................-----------.------------.........................
ENSP00000310686  ................................-----------.------------.........................
ENSP00000288912  ................................LFV--------.------------.........................
ENSP00000452765  phllcstsvqenksrpfvmgymnerkepfykvL-FSGEVSGRItLWHIPDVPVSKFdgspreipvtatwtlqdnfdkhdtm
ENSP00000456709  ................................LKT--------.------------.........................
ENSP00000453378  ............ksrpfvmgymnerkepfykvL-FSGEVSGRItLWHIPDVPVSKFdgspreipvtatwtlqdnfdkhdtm
ENSP00000396295  ................................-----------.------------.........................
ENSP00000370039  ................................-----------.------------.........................
ENSP00000451998  ................................-----------.------------.........................
ENSP00000464109  ................................-----------.------------.........................
ENSP00000458843  ................................LKT--------.------------.........................
ENSP00000484308  ................................-----------.------------.........................
ENSP00000368025  ................................-----------.------------.........................
ENSP00000260643  ................................-----------.------------.........................
ENSP00000440796  ................................-----------.------------.........................
ENSP00000335522  ................................-----------.------------.........................
ENSP00000462737  ................................-----------.------------.........................
ENSP00000445814  ................................-----------.------------.........................
ENSP00000464095  ................................-----------.------------.........................
ENSP00000401445  ................................VVTVDSESGDV.LWIQN-------.........................
ENSP00000307235  ................................VIKVSVADWKV.MAFSKKGGHLEW.........................
ENSP00000256797  ................................-----------.------------.........................
ENSP00000413812  ................................-----------.------------.........................
ENSP00000370348  ................................-----------.------------.........................
ENSP00000394097  ................................-----------.------------.........................
ENSP00000442365  ................................-----------.------------.........................
ENSP00000378254  ................................-----------.------------.........................
ENSP00000433417  ................................-----------.------------.........................
ENSP00000278845  ................................-----------.------------.........................
ENSP00000364345  ................................-----------.------------.........................
ENSP00000420608  ................................-----------.------------.........................
ENSP00000466100  ................................-----------.------------.........................
ENSP00000217964  ................................-----------.------------.........................
ENSP00000385988  ................................-----------.------------.........................
ENSP00000471331  ................................-----------.------------.........................
ENSP00000301678  ................................-----------.------------.........................
ENSP00000382814  ................................-----------.------------.........................
ENSP00000301679  ................................-----------.------------.........................
ENSP00000483191  ................................-----------.------------.........................
ENSP00000197268  ................................MMVVDGDSGSI.VWSYRAPC----.........................
ENSP00000394063  ................................MMVVDGDSGSI.VWSYRAPC----.........................
ENSP00000412076  ................................VIKVSVADWKV.MAFSKKGGHLEW.........................
ENSP00000409656  ................................-----------.------------.........................
ENSP00000421171  ................................-----------.------------.........................
ENSP00000398526  ................................-----------.------------.........................
ENSP00000317469  ................................-----------.------------.........................
ENSP00000465994  ................................-----------.------------.........................
ENSP00000364354  ................................-----------.------------.........................
ENSP00000408325  ................................VIKVSVADWKV.MAFSKKGGHLEW.........................
ENSP00000457361  ................................-----------.------------.........................
ENSP00000405764  ................................-----------.------------.........................
ENSP00000399150  ................................-----------.------------.........................
ENSP00000398433  ................................-----------.------------.........................
ENSP00000407669  ................................-----------.------------.........................
ENSP00000451998  ................................-----------.------------.........................
ENSP00000432762  ................................-----------.------------.........................
ENSP00000433942  ................................-----------.------------.........................
ENSP00000482352  ................................-----------.------------.........................
ENSP00000403323  ................................-----------.------------.........................
ENSP00000477741  ................................-----------.------------.........................
ENSP00000355464  ................................-----------.------------.........................
ENSP00000355465  ................................-----------.------------.........................


                                                                          300                       
                                                                            |                       
d1g72a_            .....................................................DFA.GVNQMVLT................
ENSP00000355148  .....................................................--DhHTRSITSC................
ENSP00000348129  .....................................................--DhHTRSITSC................
ENSP00000482107  .....................................................--G.HFNSMVAL................
ENSP00000291576  .....................................................--G.HFNSMVAL................
ENSP00000339449  .....................................................--NaHRIGVTAI................
ENSP00000331815  yearslrlqkqfagyseevldvrflgpedshvvvasnspclkvfelqtsacqiLHG.HTDIVLAL................
ENSP00000371888  .....................................................--Q.VNAPINCV................
ENSP00000380313  .....................................................--Q.VNAPINCV................
ENSP00000455046  .....................................................--Q.VNAPINCV................
ENSP00000456405  .....................................................--Q.VNAPINCV................
ENSP00000457870  .....................................................--Q.VNAPINCV................
ENSP00000280190  .....................................................--K.HPAAVFGC................
ENSP00000422763  .....................................................--K.HPAAVFGC................
ENSP00000422200  .....................................................--K.HPAAVFGC................
ENSP00000384792  .....................................................--A.HDAEVLCL................
ENSP00000481995  yearslrlqkqfagyseevldvrflgpedshvvvasnspclkvfelqtsacqiLHG.HTDIVLAL................
ENSP00000384939  .....................................................--A.HDGSVFTL................
ENSP00000385059  .....................................................--A.HDGSVFTL................
ENSP00000450541  .....................................................--A.PGASIRTL................
ENSP00000320663  .....................................................--A.HDGSVFTL................
ENSP00000448161  .....................................................--Q.HKKTVWHI................
ENSP00000270301  .....................................................--A.HDAEVLCL................
ENSP00000426154  .....................................................--A.HDSEILCL................
ENSP00000423760  .....................................................--T.SGPIFSSP................
ENSP00000473564  .....................................................--T.SGPIFSSP................
ENSP00000205214  .....................................................--T.SGPIFSSP................
ENSP00000327384  .....................................................--GaHEGGIFAL................
ENSP00000334314  .....................................................--GaHEGGIFAL................
ENSP00000262233  .....................................................--GaHEGGIFAL................
ENSP00000371889  .....................................................--G.HSKSIQCL................
ENSP00000426725  .....................................................--G.HSKSIQCL................
ENSP00000348842  .....................................................--GaHSAGIFSM................
ENSP00000245925  .....................................................--G.HVEELWGL................
ENSP00000414851  .....................................................--G.HENWVNAV................
ENSP00000442365  .....................................................--G.HVEELWGL................
ENSP00000447548  .....................................................--GdASDPWMCM................
ENSP00000464789  .....................................................--G.HVEELWGL................
ENSP00000451998  .....................................................--K.LKKGGRCC................
ENSP00000370039  .....................................................--K.LKKGGRCC................
ENSP00000361570  .....................................................--G.HTGKIRSI................
ENSP00000468312  .....................................................--A.HDGGVFGL................
ENSP00000285873  .....................................................--TyHKKTVYTLawgppvppmslggegd
ENSP00000378254  .....................................................--G.HTDELWGL................
ENSP00000278845  .....................................................--G.HTDELWGL................
ENSP00000293879  .....................................................--A.DDGGIGLL................
ENSP00000435310  .....................................................--G.HTGKIRSI................
ENSP00000448122  .....................................................--A.DDGGIGLL................
ENSP00000348842  .....................................................--K.LKKGGRCC................
ENSP00000314193  .....................................................--R.LGATIEHI................
ENSP00000447224  .....................................................--D.TSSEIRCL................
ENSP00000447224  .....................................................--GdASDPWMCM................
ENSP00000293879  .....................................................--G.HSAEISTL................
ENSP00000254442  .....................................................R-G.HRNKVTCL................
ENSP00000350187  .....................................................R-G.HRNKVTCL................
ENSP00000416289  .....................................................--G.HLGPVTAV................
ENSP00000389144  .....................................................--N.VLRDFTCV................
ENSP00000310686  .....................................................--N.VLRDFTCV................
ENSP00000288912  .....................................................--E.PKDAICAI................
ENSP00000452765  .........................................sqsiidyfsglkDGA.GTAVVTSS................
ENSP00000456709  .....................................................--K.GPENIICS................
ENSP00000453378  .........................................sqsiidyfsglkDGA.GTAVVTSS................
ENSP00000396295  .....................................................--G.HQGPLTCV................
ENSP00000370039  .....................................................--G.HNQRIFVA................
ENSP00000451998  .....................................................--G.HNQRIFVA................
ENSP00000464109  .....................................................--D.HTEVVRDL................
ENSP00000458843  .....................................................--K.GPENIICS................
ENSP00000484308  .....................................................--N.SQDFVQCL................
ENSP00000368025  .....................................................--N.SQDFVQCL................
ENSP00000260643  .....................................................--A.HEGEIEDL................
ENSP00000440796  .....................................................---.--------................
ENSP00000335522  .....................................................---.--------................
ENSP00000462737  .....................................................--D.HTEVVRDL................
ENSP00000445814  .....................................................---.--------................
ENSP00000464095  .....................................................---.-----RSF................
ENSP00000401445  .....................................................---.--------................
ENSP00000307235  .....................................................EYQ.FCTPIASA................
ENSP00000256797  .....................................................---.--------................
ENSP00000413812  .....................................................---.--------................
ENSP00000370348  .....................................................---.--------................
ENSP00000394097  .....................................................---.--------................
ENSP00000442365  .....................................................---.--------................
ENSP00000378254  .....................................................---.--------................
ENSP00000433417  .....................................................---.--------................
ENSP00000278845  .....................................................---.--------................
ENSP00000364345  .....................................................---.--------................
ENSP00000420608  .....................................................---.--------................
ENSP00000466100  .....................................................--G.HVEELWGL................
ENSP00000217964  .....................................................---.--------................
ENSP00000385988  .....................................................---.--------................
ENSP00000471331  .....................................................--K.AAHVLRKP................
ENSP00000301678  .....................................................--K.AAHVLRKP................
ENSP00000382814  .....................................................--K.AAHVLRKP................
ENSP00000301679  .....................................................--K.AAHVLRKP................
ENSP00000483191  .....................................................--SkLTGRVLAL................
ENSP00000197268  .....................................................---.--------................
ENSP00000394063  .....................................................---.--------................
ENSP00000412076  .....................................................EYQ.FCTPIASA................
ENSP00000409656  .....................................................---.--------................
ENSP00000421171  .....................................................---.--------................
ENSP00000398526  .....................................................--H.TPDAVTSL................
ENSP00000317469  .....................................................--H.TPDAVTSL................
ENSP00000465994  .....................................................--D.GNEQISVV................
ENSP00000364354  .....................................................---.--------................
ENSP00000408325  .....................................................EYQ.FCTPIASA................
ENSP00000457361  .....................................................---.--------................
ENSP00000405764  .....................................................---.--------................
ENSP00000399150  .....................................................---.--------................
ENSP00000398433  .....................................................---.--------................
ENSP00000407669  .....................................................---.--------................
ENSP00000451998  .....................................................--A.HDGPVFSM................
ENSP00000432762  .....................................................---.--------................
ENSP00000433942  .....................................................---.--------................
ENSP00000482352  .....................................................---.--------................
ENSP00000403323  .....................................................---.--------................
ENSP00000477741  .....................................................---.--------................
ENSP00000355464  .....................................................---.--------................
ENSP00000355465  .....................................................---.--------................


                                                                     310               320          
                                                                       |                 |          
d1g72a_            ..................................................DQPV........NGKMTPLLSHI.....DRN
ENSP00000355148  ..................................................CFDP........DSQ---RVASV.....SLD
ENSP00000348129  ..................................................CFDP........DSQ---RVASV.....SLD
ENSP00000482107  ..................................................AYSP........DGQ---YIVTG.....GDD
ENSP00000291576  ..................................................AYSP........DGQ---YIVTG.....GDD
ENSP00000339449  ..................................................ATTS........DCK---RVISG.....GGE
ENSP00000331815  ..................................................DVFR........KGW---LFASC.....AKD
ENSP00000371888  ..................................................CLHP........NQA---ELIVG.....DQS
ENSP00000380313  ..................................................CLHP........NQA---ELIVG.....DQS
ENSP00000455046  ..................................................CLHP........NQA---ELIVG.....DQS
ENSP00000456405  ..................................................CLHP........NQA---ELIVG.....DQS
ENSP00000457870  ..................................................CLHP........NQA---ELIVG.....DQS
ENSP00000280190  ..................................................DWSQ........NNKD--MIATG.....CED
ENSP00000422763  ..................................................DWSQ........NNKD--MIATG.....CED
ENSP00000422200  ..................................................DWSQ........NNKD--MIATG.....CED
ENSP00000384792  ..................................................EYSK........PETGLTLLASA.....SRD
ENSP00000481995  ..................................................DVFR........KGW---LFASC.....AKD
ENSP00000384939  ..................................................CQMR........NGM---LLTGG.....GKD
ENSP00000385059  ..................................................CQMR........NGM---LLTGG.....GKD
ENSP00000450541  ..................................................AFNV........PGG---VVAVG.....RLD
ENSP00000320663  ..................................................CQMR........NGM---LLTGG.....GKD
ENSP00000448161  ..................................................QFTA........DEK---TLISS.....SDD
ENSP00000270301  ..................................................EYSK........PETGLTLLASA.....SRD
ENSP00000426154  ..................................................EYSK........PDTGLKLLASA.....SRD
ENSP00000423760  ..................................................CTSP........SEQ---KIFFG.....SHD
ENSP00000473564  ..................................................CTSP........SEQ---KIFFG.....SHD
ENSP00000205214  ..................................................CTSP........SEQ---KIFFG.....SHD
ENSP00000327384  ..................................................CMLR........DGT---LVSGG.....GKD
ENSP00000334314  ..................................................CMLR........DGT---LVSGG.....GKD
ENSP00000262233  ..................................................CMLR........DGT---LVSGG.....GKD
ENSP00000371889  ..................................................TVHK........NGGKS-YIYSG.....SHD
ENSP00000426725  ..................................................TVHK........NGGKS-YIYSG.....SHD
ENSP00000348842  ..................................................YA--........CEE---GFATG.....GRD
ENSP00000245925  ..................................................ATHP........SRA---QFVTC.....GQD
ENSP00000414851  ..................................................HWQPvfykdgvlQQPV--RLLSA.....SMD
ENSP00000442365  ..................................................ATHP........SRA---QFVTC.....GQD
ENSP00000447548  ..................................................AVLA........SQA---TLLTV.....SRD
ENSP00000464789  ..................................................ATHP........SRA---QFVTC.....GQD
ENSP00000451998  ..................................................CFSP........DGK---ALAVG.....LND
ENSP00000370039  ..................................................CFSP........DGK---ALAVG.....LND
ENSP00000361570  ..................................................VWNA........DDS---KLISG.....GTD
ENSP00000468312  ..................................................CALR........DGT---LVSGG.....GRD
ENSP00000285873  rpslalyscggegivlqhnpwklsgeafdinklirdtnsikyklpvhteiSWKA........DGK---IMALG.....NED
ENSP00000378254  ..................................................CTHP........SQN---RFLTC.....GHD
ENSP00000278845  ..................................................CTHP........SQN---RFLTC.....GHD
ENSP00000293879  ..................................................LF--........SGS---RLVSG.....SST
ENSP00000435310  ..................................................VWNA........DDS---KLISG.....GTD
ENSP00000448122  ..................................................LF--........SGS---RLVSG.....SST
ENSP00000348842  ..................................................AFSP........DGK---ALAVG.....LND
ENSP00000314193  ..................................................SVSP........AGD---LFCTS.....HSD
ENSP00000447224  ..................................................EVAE........QRK---LLFTG.....LVS
ENSP00000447224  ..................................................AVLA........SQA---TLLTV.....SRD
ENSP00000293879  ..................................................ALSH........SAQ---VLASA.....SGR
ENSP00000254442  ..................................................LYPHqvsary..DQR---YLISG.....GVD
ENSP00000350187  ..................................................LYPHqvsary..DQR---YLISG.....GVD
ENSP00000416289  ..................................................EFCP........WRAG--TLISA.....SED
ENSP00000389144  ..................................................NLSD........SPPN--LMVSG.....NMD
ENSP00000310686  ..................................................NLSD........SPPN--LMVSG.....NMD
ENSP00000288912  ..................................................SCHP........YQP---LIAIG.....SIC
ENSP00000452765  ..................................................EYIP........SLD---KLICG.....CED
ENSP00000456709  ..................................................CISP........CGS---WIAYS.....TVS
ENSP00000453378  ..................................................EYIP........SLD---KLICG.....CED
ENSP00000396295  ..................................................AANQ........DGS---LILTG.....SVD
ENSP00000370039  ..................................................EFRP........DSDT--QFVSV.....GVK
ENSP00000451998  ..................................................EFRP........DSDT--QFVSV.....GVK
ENSP00000464109  ..................................................TFAP........DGSL--ILVSA.....SRD
ENSP00000458843  ..................................................CISP........CGS---WIAYS.....TVS
ENSP00000484308  ..................................................AYGHfnlgrg..LEG---LIFSG.....HQS
ENSP00000368025  ..................................................AYGHfnlgrg..LEG---LIFSG.....HQS
ENSP00000260643  ..................................................ALGP........DG----KLVTV.....GRD
ENSP00000440796  ..................................................----........-----------.....---
ENSP00000335522  ..................................................----........------LVYSG.....SAD
ENSP00000462737  ..................................................TFAP........DGSL--ILVSA.....SRD
ENSP00000445814  ..................................................----........-----------.....---
ENSP00000464095  ..................................................EVSP........DGS---FLLIN.....GIA
ENSP00000401445  ..................................................----........-----------.....---
ENSP00000307235  ..................................................WLLK........DGK--------.....---
ENSP00000256797  ..................................................-T--........EGPSTPRLYIG.....RTQ
ENSP00000413812  ..................................................-T--........EGPSTPRLYIG.....RTQ
ENSP00000370348  ..................................................----........-----------.....---
ENSP00000394097  ..................................................----........-----------.....---
ENSP00000442365  ..................................................----........-----------.....---
ENSP00000378254  ..................................................----........-----------.....---
ENSP00000433417  ..................................................----........-----------.....---
ENSP00000278845  ..................................................----........-----------.....---
ENSP00000364345  ..................................................----........-----------.....---
ENSP00000420608  ..................................................----........-----------.....---
ENSP00000466100  ..................................................ATHP........SRA---QFVTC.....GQD
ENSP00000217964  ..................................................----........-----------.....---
ENSP00000385988  ..................................................----........-----------.....---
ENSP00000471331  ..................................................IFGR........YKPD--TLAVAvengtGTD
ENSP00000301678  ..................................................IFGR........YKPD--TLAVAvengtGTD
ENSP00000382814  ..................................................IFGR........YKPD--TLAVAvengtGTD
ENSP00000301679  ..................................................IFGR........YKPD--TLAVAvengtGTD
ENSP00000483191  ..................................................SFDA........PGR---LLWAG.....DDR
ENSP00000197268  ..................................................----........-----------.....---
ENSP00000394063  ..................................................----........-----------.....---
ENSP00000412076  ..................................................WLLK........DGK--------.....---
ENSP00000409656  ..................................................----........-----------.....---
ENSP00000421171  ..................................................----........-----------.....---
ENSP00000398526  ..................................................CFGR........YGRE-------.....---
ENSP00000317469  ..................................................CFGR........YGRE-------.....---
ENSP00000465994  ..................................................SFSP........-----------.....---
ENSP00000364354  ..................................................----........-----------.....---
ENSP00000408325  ..................................................WLLK........DGK--------.....---
ENSP00000457361  ..................................................----........-----------.....---
ENSP00000405764  ..................................................----........-----------.....---
ENSP00000399150  ..................................................----........-----------.....---
ENSP00000398433  ..................................................----........-----------.....---
ENSP00000407669  ..................................................----........-----------.....---
ENSP00000451998  ..................................................HA--........LEK---GFVTG.....GKD
ENSP00000432762  ..................................................----........-----------.....---
ENSP00000433942  ..................................................----........-----------.....---
ENSP00000482352  ..................................................----........-----------.....---
ENSP00000403323  ..................................................----........-----------.....---
ENSP00000477741  ..................................................----........-----------.....---
ENSP00000355464  ..................................................----........-----------.....---
ENSP00000355465  ..................................................----........-----------.....---


                             330                                                                  34
                               |                                                                    
d1g72a_            GI......LY..TLNRE........................................................NG...NLI
ENSP00000355148  RC......IK..IWDVT........................................................SQa..TLL
ENSP00000348129  RC......IK..IWDVT........................................................SQa..TLL
ENSP00000482107  GK......VK..VWNTL........................................................SG...FCF
ENSP00000291576  GK......VK..VWNTL........................................................SG...FCF
ENSP00000339449  GE......VR..VWQIGcq......................................................TQ...KLE
ENSP00000331815  QS......VR..IWRMNkagqvmlkesflvtgsqdctvklwplpkallskntapd..................NG...PIL
ENSP00000371888  GA......IH..IWDLK........................................................TD...HNE
ENSP00000380313  GA......IH..IWDLK........................................................TD...HNE
ENSP00000455046  GA......IH..IWDLK........................................................TD...HNE
ENSP00000456405  GA......IH..IWDLK........................................................TD...HNE
ENSP00000457870  GA......IH..IWDLK........................................................TD...HNE
ENSP00000280190  TN......VR..VYYVA........................................................TSsd.QPL
ENSP00000422763  TN......VR..VYYVA........................................................TSsd.QPL
ENSP00000422200  TN......VR..VYYVA........................................................TSsd.QPL
ENSP00000384792  RL......IH..VLNVE........................................................KNy..NLE
ENSP00000481995  QS......VR..IWRMN........................................................KAgqvMCV
ENSP00000384939  RK......II..LWDHD........................................................-L...NPE
ENSP00000385059  RK......II..LWDHD........................................................-L...NPE
ENSP00000450541  SM......VE..LWAWR........................................................EG...ARL
ENSP00000320663  RK......II..LWDHD........................................................-L...NPE
ENSP00000448161  AE......IQ..VWNWQ........................................................LD...KCI
ENSP00000270301  RL......IH..VLNVE........................................................KNy..NLE
ENSP00000426154  RL......IH..VLDAG........................................................REy..SLQ
ENSP00000423760  CF......IY..CCNMK........................................................-G...HLQ
ENSP00000473564  CF......IY..CCNMK........................................................-G...HLQ
ENSP00000205214  CF......IY..CCNMK........................................................-G...HLQ
ENSP00000327384  RK......LI..SWSGN........................................................-Y...QKL
ENSP00000334314  RK......LI..SWSGN........................................................-Y...QKL
ENSP00000262233  RK......LI..SWSGN........................................................-Y...QKL
ENSP00000371889  GH......IN..YWDSE........................................................TGe..NDS
ENSP00000426725  GH......IN..YWDSE........................................................TGe..NDS
ENSP00000348842  GC......IR..LWDTD........................................................-F...KPI
ENSP00000245925  KL......VH..LWSSD........................................................SH...QPL
ENSP00000414851  KT......MI..LWAPD........................................................EE...SGV
ENSP00000442365  KL......VH..LWSSD........................................................SH...QPL
ENSP00000447548  GV......VS..LWSSA........................................................TG...KLQ
ENSP00000464789  KL......VH..LWSSD........................................................SH...QPL
ENSP00000451998  GS......FL..MANAD........................................................TL...EDL
ENSP00000370039  GS......FL..MANAD........................................................TL...EDL
ENSP00000361570  GA......VY..EWNLS........................................................TG...KRE
ENSP00000468312  RR......VV..LWGSD........................................................-Y...SKL
ENSP00000285873  GS......IE..IFQIP........................................................NL...KLI
ENSP00000378254  RQ......LC..LWDGE........................................................SH...ALA
ENSP00000278845  RQ......LC..LWDGE........................................................SH...ALA
ENSP00000293879  GR......LR..LWAVGavselrckgsgassvfmehelvldgavvsasfddsvdmgvvgttagtlwfvswa..EG...TST
ENSP00000435310  GA......VY..EWNLS........................................................TG...KRE
ENSP00000448122  GR......LR..LWAVGavselrckgsgarsssvfmehelvldgavvsasfddsvdmgvvgttagtlwfvswaEG...TST
ENSP00000348842  GS......FL..VVNAD........................................................TV...EDM
ENSP00000314193  NK......II..IIHRNleasaviqglvkdrsiftglmidprtkalvlngkpghl..................Q-...---
ENSP00000447224  GV......VL..VFPLN........................................................SR...QDV
ENSP00000447224  GV......VS..LWSSA........................................................TG...KLQ
ENSP00000293879  SSttahcqIR..VWDVS........................................................GG...LCQ
ENSP00000254442  FS......VI..IWDIF........................................................SG...EMK
ENSP00000350187  FS......VI..IWDIF........................................................SG...EMK
ENSP00000416289  RG......FK..VWDHC........................................................TG...SLI
ENSP00000389144  GR......VR..IHDLR........................................................SG...NIA
ENSP00000310686  GR......VR..IHDLR........................................................SG...NIA
ENSP00000288912  GM......IK..VWNYE........................................................NK...QYL
ENSP00000452765  GT......II..ITQALnaakarlleggslvk.........................................DS...PPH
ENSP00000456709  RFf.....LY..RLNYEhdni....................................................SL...KRV
ENSP00000453378  GT......II..ITQALnaakarlleggslvk.........................................DS...PPH
ENSP00000396295  CQ......AK..LVSAT........................................................TG...KVV
ENSP00000370039  H-......VK..FWTLAgralls..................................................KK...GLL
ENSP00000451998  H-......VK..FWTLAgralls..................................................KK...GLL
ENSP00000464109  KT......LR..VWDLKd.......................................................DG...NMM
ENSP00000458843  RFf.....LY..RLNYEhdni....................................................SL...KRV
ENSP00000484308  GV......IR..VLSQH........................................................SC...ARL
ENSP00000368025  GV......IR..VLSQH........................................................SC...ARL
ENSP00000260643  LK......AS..VW---........................................................--...---
ENSP00000440796  --......--..-FDAR........................................................TS...ESV
ENSP00000335522  RT......VK..CWLAD........................................................TG...ECV
ENSP00000462737  KT......LR..VWDL-........................................................--...---
ENSP00000445814  --......--..-----........................................................--...---
ENSP00000464095  GY......LH..LLAMK........................................................TK...ELI
ENSP00000401445  --......--..-----........................................................--...---
ENSP00000307235  --......--..-----........................................................--...---
ENSP00000256797  YT......VT..MHDPR........................................................AP...ALR
ENSP00000413812  YT......VT..MHDPR........................................................AP...ALR
ENSP00000370348  --......--..-----........................................................--...---
ENSP00000394097  --......--..-----........................................................--...---
ENSP00000442365  --......--..-----........................................................--...---
ENSP00000378254  --......--..-----........................................................--...---
ENSP00000433417  --......--..-----........................................................--...---
ENSP00000278845  --......--..-----........................................................--...---
ENSP00000364345  --......--..-----........................................................--...---
ENSP00000420608  --......--..-----........................................................--...---
ENSP00000466100  KL......VH..LWSSD........................................................SH...QPL
ENSP00000217964  --......--..-----........................................................--...---
ENSP00000385988  --......--..-----........................................................--...---
ENSP00000471331  RQ......IL..FLDLG........................................................TG...AVL
ENSP00000301678  RQ......IL..FLDLG........................................................TG...AVL
ENSP00000382814  RQ......IL..FLDLG........................................................TG...AVL
ENSP00000301679  RQ......IL..FLDLG........................................................TG...AVL
ENSP00000483191  GS......VFsfLFDMA........................................................TG...KLT
ENSP00000197268  --......--..-----........................................................--...---
ENSP00000394063  --......--..-----........................................................--...---
ENSP00000412076  --......--..-----........................................................--...---
ENSP00000409656  --......--..-----........................................................--...---
ENSP00000421171  --......--..-----........................................................--...---
ENSP00000398526  --......--..-----........................................................--...---
ENSP00000317469  --......--..-----........................................................--...---
ENSP00000465994  --......--..-----........................................................--...---
ENSP00000364354  --......--..-----........................................................--...---
ENSP00000408325  --......--..-----........................................................--...---
ENSP00000457361  --......--..-----........................................................--...---
ENSP00000405764  --......--..-----........................................................--...---
ENSP00000399150  --......--..-----........................................................--...---
ENSP00000398433  --......--..-----........................................................--...---
ENSP00000407669  --......--..-----........................................................--...---
ENSP00000451998  GI......VA..LWDDS........................................................FE...RCL
ENSP00000432762  --......--..-----........................................................--...---
ENSP00000433942  --......--..-----........................................................--...---
ENSP00000482352  --......--..-----........................................................--...---
ENSP00000403323  --......--..-----........................................................--...---
ENSP00000477741  --......--..-----........................................................--...---
ENSP00000355464  --......--..-----........................................................--...---
ENSP00000355465  --......--..-----........................................................--...---


                   0           350                                                                  
                   |             |                                                                  
d1g72a_            VAEKVD....PAVNVFKKV..............................................................
ENSP00000355148  TITK--....---------..............................................................
ENSP00000348129  TITK--....---------..............................................................
ENSP00000482107  VTFT--....---------..............................................................
ENSP00000291576  VTFT--....---------..............................................................
ENSP00000339449  EALK--....---------..............................................................
ENSP00000331815  LQAQ--....---------..............................................................
ENSP00000371888  QLIP--....---------..............................................................
ENSP00000380313  QLIP--....---------..............................................................
ENSP00000455046  QLIP--....---------..............................................................
ENSP00000456405  QLIP--....---------..............................................................
ENSP00000457870  QLIP--....---------..............................................................
ENSP00000280190  KVFS--....---------..............................................................
ENSP00000422763  KVFS--....---------..............................................................
ENSP00000422200  KVFS--....---------..............................................................
ENSP00000384792  QTLD--....---------..............................................................
ENSP00000481995  AQGS--....---------..............................................................
ENSP00000384939  REIEVP....DQYGTIRAVaegkadqflvgtsrnfilrgtfn.......................................
ENSP00000385059  REIEVP....DQYGTIRAVaegkadqflvgtsrnfilrgtfn.......................................
ENSP00000450541  AAFP--....---------..............................................................
ENSP00000320663  REIEVP....DQYGTIRAVaegkadqflvgtsrnfilrgtfn.......................................
ENSP00000448161  FLR---....---------..............................................................
ENSP00000270301  QTLD--....---------..............................................................
ENSP00000426154  QTLD--....---------..............................................................
ENSP00000423760  WKFE--....---------..............................................................
ENSP00000473564  WKFE--....---------..............................................................
ENSP00000205214  WKFE--....---------..............................................................
ENSP00000327384  RKTEIP....EQFGPIRTVaegkgdviligttrnfvlq...........................................
ENSP00000334314  RKTEIP....EQFGPIRTVaegkgdviligttrnfvlq...........................................
ENSP00000262233  RKTEIP....EQFGPIRTVaegkgdviligttrnfvlq...........................................
ENSP00000371889  FAGK--....---------..............................................................
ENSP00000426725  FAGK--....---------..............................................................
ENSP00000348842  TKIDLR....ETEQGYKGLsirsvcwkadrllagtqdseifevivrer.................................
ENSP00000245925  WSRI--....---------..............................................................
ENSP00000414851  WLEQ--....VRVGEVGGNtlgfydcqfnedgsmiiahafhgalhlwkqntv.............................
ENSP00000442365  WSRI--....---------..............................................................
ENSP00000447548  GKQHMSsikeETPTCAVSVqkqgklvtgfsngsislvsskgdrlleklpdavrflvvsedesllaagfgrsvrifladsrg
ENSP00000464789  WSRI--....---------..............................................................
ENSP00000451998  VSFH--....---------..............................................................
ENSP00000370039  VSFH--....---------..............................................................
ENSP00000361570  TECV--....---------..............................................................
ENSP00000468312  QEVEVP....EDFGPVRTVaeghgdtlyvgttrnsilqgsvh.......................................
ENSP00000285873  CTIQ--....---------..............................................................
ENSP00000378254  WSID--....---------..............................................................
ENSP00000278845  WSID--....---------..............................................................
ENSP00000293879  RLIS--....---------..............................................................
ENSP00000435310  TECV--....---------..............................................................
ENSP00000448122  RLIS--....---------..............................................................
ENSP00000348842  VSFH--....---------..............................................................
ENSP00000314193  ------....---------..............................................................
ENSP00000447224  ICIP--....---------..............................................................
ENSP00000447224  GKQHMS....---------..............................................................
ENSP00000293879  HLIF--....---------..............................................................
ENSP00000254442  HIFC--....---------..............................................................
ENSP00000350187  HIFC--....---------..............................................................
ENSP00000416289  YSSS--....---------..............................................................
ENSP00000389144  LSLS--....---------..............................................................
ENSP00000310686  LSLS--....---------..............................................................
ENSP00000288912  FSRV--....---------..............................................................
ENSP00000452765  KVLK--....---------..............................................................
ENSP00000456709  SKMP--....---------..............................................................
ENSP00000453378  KVLK--....---------..............................................................
ENSP00000396295  GVFRP-....---------..............................................................
ENSP00000370039  STLE--....---------..............................................................
ENSP00000451998  STLE--....---------..............................................................
ENSP00000464109  KVLR--....---------..............................................................
ENSP00000458843  SKMP--....---------..............................................................
ENSP00000484308  EKF---....---------..............................................................
ENSP00000368025  EKF---....---------..............................................................
ENSP00000260643  ------....---------..............................................................
ENSP00000440796  LSV---....---------..............................................................
ENSP00000335522  RTFT--....---------..............................................................
ENSP00000462737  ------....---------..............................................................
ENSP00000445814  ------....---------..............................................................
ENSP00000464095  GSMK--....---------..............................................................
ENSP00000401445  ------....---------..............................................................
ENSP00000307235  ------....---------..............................................................
ENSP00000256797  WNTT--....---------..............................................................
ENSP00000413812  WNTT--....---------..............................................................
ENSP00000370348  --LR--....---------..............................................................
ENSP00000394097  --LR--....---------..............................................................
ENSP00000442365  ------....---------..............................................................
ENSP00000378254  ------....---------..............................................................
ENSP00000433417  ------....---------..............................................................
ENSP00000278845  ------....---------..............................................................
ENSP00000364345  ------....---------..............................................................
ENSP00000420608  ------....---------..............................................................
ENSP00000466100  WSRI--....---------..............................................................
ENSP00000217964  --LR--....---------..............................................................
ENSP00000385988  --LR--....---------..............................................................
ENSP00000471331  CSLA--....---------..............................................................
ENSP00000301678  CSLA--....---------..............................................................
ENSP00000382814  CSLA--....---------..............................................................
ENSP00000301679  CSLA--....---------..............................................................
ENSP00000483191  KAKRLV....---------..............................................................
ENSP00000197268  ------....---------..............................................................
ENSP00000394063  ------....---------..............................................................
ENSP00000412076  ------....---------..............................................................
ENSP00000409656  ------....---------..............................................................
ENSP00000421171  ------....---------..............................................................
ENSP00000398526  ------....---------..............................................................
ENSP00000317469  ------....---------..............................................................
ENSP00000465994  ------....---------..............................................................
ENSP00000364354  ------....---------..............................................................
ENSP00000408325  ------....---------..............................................................
ENSP00000457361  ------....---------..............................................................
ENSP00000405764  ------....---------..............................................................
ENSP00000399150  ------....---------..............................................................
ENSP00000398433  ------....---------..............................................................
ENSP00000407669  ------....---------..............................................................
ENSP00000451998  KTYA--....---------..............................................................
ENSP00000432762  ------....---------..............................................................
ENSP00000433942  ------....---------..............................................................
ENSP00000482352  ------....---------..............................................................
ENSP00000403323  ------....---------..............................................................
ENSP00000477741  ------....---------..............................................................
ENSP00000355464  ------....--------Pslrwlfgvaavvtdvgqillvdlclddlscnqneveasdl......................
ENSP00000355465  ------....--------Pslrwlfgvaavvtdvgqillvdlclddlscnqneveasdl......................


                             360       370       380                                                
                               |         |         |                                                
d1g72a_            .......DLKTGTPVRDPEFATRMDHKGTNICPSA...........MG.................................
ENSP00000355148  .......----------------------------...........-A.................................
ENSP00000348129  .......----------------------------...........-A.................................
ENSP00000482107  .......----------------------------...........-E.................................
ENSP00000291576  .......----------------------------...........-E.................................
ENSP00000339449  .......----------------------------...........-E.................................
ENSP00000331815  .......-------------------------TTQ...........RC.................................
ENSP00000371888  .......----------------------------...........-E.................................
ENSP00000380313  .......----------------------------...........-E.................................
ENSP00000455046  .......----------------------------...........-E.................................
ENSP00000456405  .......----------------------------...........-E.................................
ENSP00000457870  .......----------------------------...........-E.................................
ENSP00000280190  .......----------------------------...........-G.................................
ENSP00000422763  .......----------------------------...........-G.................................
ENSP00000422200  .......----------------------------...........-G.................................
ENSP00000384792  .......----------------------------...........-D.................................
ENSP00000481995  .......----------------------------...........-G.................................
ENSP00000384939  .......DGFQIEVQ--------------------...........-G.................................
ENSP00000385059  .......DGFQIEVQ--------------------...........-G.................................
ENSP00000450541  .......----------------------------...........-A.................................
ENSP00000320663  .......DGFQIEVQ--------------------...........-G.................................
ENSP00000448161  .......----------------------------...........-G.................................
ENSP00000270301  .......----------------------------...........-D.................................
ENSP00000426154  .......----------------------------...........-E.................................
ENSP00000423760  .......----------------------------...........-T.................................
ENSP00000473564  .......----------------------------...........-T.................................
ENSP00000205214  .......----------------------------...........-T.................................
ENSP00000327384  .......GTLSGDFT-----------------PIT...........QG.................................
ENSP00000334314  .......GTLSGDFT-----------------PIT...........QG.................................
ENSP00000262233  .......GTLSGDFT-----------------PIT...........QG.................................
ENSP00000371889  .......----------------------------...........-G.................................
ENSP00000426725  .......----------------------------...........-G.................................
ENSP00000348842  .......DKPMLILQ--------------------...........-G.................................
ENSP00000245925  .......----------------------------...........-I.................................
ENSP00000414851  .......NPREWTPE-----------------IVI...........SG.................................
ENSP00000442365  .......----------------------------...........-I.................................
ENSP00000447548  frrfmamDL--------------------------...........-E.................................
ENSP00000464789  .......----------------------------...........-I.................................
ENSP00000451998  .......----------------------------...........-H.................................
ENSP00000370039  .......----------------------------...........-H.................................
ENSP00000361570  .......----------------------------...........-L.................................
ENSP00000468312  .......TGFSLLVQ--------------------...........-G.................................
ENSP00000285873  .......----------------------------...........-Q.................................
ENSP00000378254  .......----------------------------...........-L.................................
ENSP00000278845  .......----------------------------...........-L.................................
ENSP00000293879  .......----------------------------...........-G.................................
ENSP00000435310  .......----------------------------...........-L.................................
ENSP00000448122  .......----------------------------...........-G.................................
ENSP00000348842  .......----------------------------...........-H.................................
ENSP00000314193  .......----------------------------...........-Fyslqsdkqlynldiiqqeyindygliqieltka
ENSP00000447224  .......---------------------------P...........PE.................................
ENSP00000447224  .......----------------------------...........-S.................................
ENSP00000293879  .......----------------------------...........-P.................................
ENSP00000254442  .......----------------------------...........-V.................................
ENSP00000350187  .......----------------------------...........-V.................................
ENSP00000416289  .......----------------------------...........-V.................................
ENSP00000389144  .......----------------------------...........-A.................................
ENSP00000310686  .......----------------------------...........-A.................................
ENSP00000288912  .......----------------------------...........-F.................................
ENSP00000452765  .......----------------------------...........-G.................................
ENSP00000456709  .......----------------------------...........-A.................................
ENSP00000453378  .......----------------------------...........-G.................................
ENSP00000396295  .......--------------------------ETvasqpslgegeES.................................
ENSP00000370039  .......----------------------------...........-D.................................
ENSP00000451998  .......----------------------------...........-D.................................
ENSP00000464109  .......----------------------------...........-G.................................
ENSP00000458843  .......----------------------------...........-A.................................
ENSP00000484308  .......----------------------------...........-M.................................
ENSP00000368025  .......----------------------------...........-M.................................
ENSP00000260643  .......----------------------------...........-Q.................................
ENSP00000440796  .......----------------------------...........-E.................................
ENSP00000335522  .......----------------------------...........-A.................................
ENSP00000462737  .......----------------------------...........--.................................
ENSP00000445814  .......----------------------------...........--.................................
ENSP00000464095  .......----------------------------...........-I.................................
ENSP00000401445  .......----------------------------...........--.................................
ENSP00000307235  .......----------------------------...........--.................................
ENSP00000256797  .......----------------------------...........-Y.................................
ENSP00000413812  .......----------------------------...........-Y.................................
ENSP00000370348  .......----------------------------...........-G.................................
ENSP00000394097  .......----------------------------...........-G.................................
ENSP00000442365  .......----------------------------...........-G.................................
ENSP00000378254  .......----------------------------...........-G.................................
ENSP00000433417  .......----------------------------...........-G.................................
ENSP00000278845  .......----------------------------...........-G.................................
ENSP00000364345  .......----------------------------...........--.................................
ENSP00000420608  .......----------------------------...........--.................................
ENSP00000466100  .......----------------------------...........--.................................
ENSP00000217964  .......----------------------------...........-G.................................
ENSP00000385988  .......----------------------------...........-G.................................
ENSP00000471331  .......----------------------------...........--.................................
ENSP00000301678  .......----------------------------...........--.................................
ENSP00000382814  .......----------------------------...........--.................................
ENSP00000301679  .......----------------------------...........--.................................
ENSP00000483191  .......----------------------------...........-V.................................
ENSP00000197268  .......----------------------------...........--.................................
ENSP00000394063  .......----------------------------...........--.................................
ENSP00000412076  .......----------------------------...........--.................................
ENSP00000409656  .......----------------------------...........--.................................
ENSP00000421171  .......----------------------------...........--.................................
ENSP00000398526  .......----------------------------...........--.................................
ENSP00000317469  .......----------------------------...........--.................................
ENSP00000465994  .......----------------------------...........--.................................
ENSP00000364354  .......----------------------------...........--.................................
ENSP00000408325  .......----------------------------...........--.................................
ENSP00000457361  .......----------------------------...........--.................................
ENSP00000405764  .......----------------------------...........--.................................
ENSP00000399150  .......----------------------------...........--.................................
ENSP00000398433  .......----------------------------...........--.................................
ENSP00000407669  .......----------------------------...........--.................................
ENSP00000451998  .......----------------------------...........--.................................
ENSP00000432762  .......----------------------------...........--.................................
ENSP00000433942  .......----------------------------...........--.................................
ENSP00000482352  .......----------------------------...........--.................................
ENSP00000403323  .......----------------------------...........--.................................
ENSP00000477741  .......----------------------------...........--.................................
ENSP00000355464  .......EVLTGIPAEVPHIRESVMRQGRHLCFQL...........VS.................................
ENSP00000355465  .......EVLTGIPAEVPHIRESVMRQGRHLCFQL...........VS.................................


                                                                       390                          
                                                                         |                          
d1g72a_            ...............................................FHN..QGVDSYDP.......ESR...........
ENSP00000355148  ...............................................HSNa.ISNCCFTF.......SGH...........
ENSP00000348129  ...............................................HSNa.ISNCCFTF.......SGH...........
ENSP00000482107  ...............................................HSSg.VTGVTFTA.......TGY...........
ENSP00000291576  ...............................................HSSg.VTGVTFTA.......TGY...........
ENSP00000339449  ...............................................HKSs.VSCIRVKR.......NNE...........
ENSP00000331815  ...............................................HDKd.INSVAIAP.......NDK...........
ENSP00000371888  ...............................................PEVs.ITSAHIDP.......DAS...........
ENSP00000380313  ...............................................PEVs.ITSAHIDP.......DAS...........
ENSP00000455046  ...............................................PEVs.ITSAHIDP.......DAS...........
ENSP00000456405  ...............................................PEVs.ITSAHIDP.......DAS...........
ENSP00000457870  ...............................................PEVs.ITSAHIDP.......DAS...........
ENSP00000280190  ...............................................HTAk.VFHVKWSPl......REG...........
ENSP00000422763  ...............................................HTAk.VFHVKWSPl......REG...........
ENSP00000422200  ...............................................HTAk.VFHVKWSPl......REG...........
ENSP00000384792  ...............................................HSSs.ITAIKFAG.......NRDiqmiscgadks
ENSP00000481995  ...............................................HTHs.VGTVCCSRl......KES...........
ENSP00000384939  ...............................................HTDe.LWGLATHP.......FKD...........
ENSP00000385059  ...............................................HTDe.LWGLATHP.......FKD...........
ENSP00000450541  ...............................................HHGf.VAAALFLH.......AGC...........
ENSP00000320663  ...............................................HTDe.LWGLATHP.......FKD...........
ENSP00000448161  ...............................................HQEt.VKDFRLL-.......KNS...........
ENSP00000270301  ...............................................HSSs.ITAIKFAG.......NRDiqmiscgadks
ENSP00000426154  ...............................................HSSs.ITAVKFAAs......DGQvrmiscgadks
ENSP00000423760  ...............................................TSRvyATPFAFHNyngs...NEM...........
ENSP00000473564  ...............................................TSRvyATPFAFHNyngs...NEM...........
ENSP00000205214  ...............................................TSRvyATPFAFHNyngs...NEM...........
ENSP00000327384  ...............................................HTDe.LWGLAIHA.......SKS...........
ENSP00000334314  ...............................................HTDe.LWGLAIHA.......SKS...........
ENSP00000262233  ...............................................HTDe.LWGLAIHA.......SKS...........
ENSP00000371889  ...............................................HTNq.VSRMTVD-.......ESG...........
ENSP00000426725  ...............................................HTNq.VSRMTVD-.......ESG...........
ENSP00000348842  ...............................................HCEgeLWALALHP.......KKP...........
ENSP00000245925  ...............................................EDP..ARSAGFHP.......SGS...........
ENSP00000414851  ...............................................HFDg.VQDLVWDP.......EGE...........
ENSP00000442365  ...............................................EDP..ARSAGFHP.......SGS...........
ENSP00000447548  ...............................................HEDm.VETAVFGT.......ENN...........
ENSP00000464789  ...............................................EDP..ARSAGFHP.......SGS...........
ENSP00000451998  ...............................................RKDm.ISDIRFSPg......SGK...........
ENSP00000370039  ...............................................RKDm.ISDIRFSPg......SGK...........
ENSP00000361570  ...............................................KSCs.YNCVTVSP.......DAK...........
ENSP00000468312  ...............................................HVEe.LWGLATHP.......SRA...........
ENSP00000285873  ...............................................HHKl.VNTISWHH.......EHGsqpelsy....
ENSP00000378254  ...............................................KET..GLCADFHP.......SGA...........
ENSP00000278845  ...............................................KET..GLCADFHP.......SGA...........
ENSP00000293879  ...............................................HRSk.VNEVVFSP.......GES...........
ENSP00000435310  ...............................................KSCs.YNCVTVSP.......DAK...........
ENSP00000448122  ...............................................HRSk.VNEVVFSP.......GES...........
ENSP00000348842  ...............................................RKEm.ISDIKFSKd......TGK...........
ENSP00000314193  afgcfgnwlatveqrqeketelelqmklwmynkktqgfilntkinmpHEDc.ITALCFCNaeks...EQP...........
ENSP00000447224  ...............................................ARKa.INCMSLSK.......CED...........
ENSP00000447224  ...............................................IKEetPTCAVSVQ.......KQG...........
ENSP00000293879  ...............................................HSTt.VLALAFSP.......DDR...........
ENSP00000254442  ...............................................HGGe.ITQLLVPPencsar.VQH...........
ENSP00000350187  ...............................................HGGe.ITQLLVPPencsar.VQH...........
ENSP00000416289  ...............................................LSAypLLSLFIDA.......ESR...........
ENSP00000389144  ...............................................HQLr.VSAVQM--.......DDW...........
ENSP00000310686  ...............................................HQLr.VSAVQM--.......DDW...........
ENSP00000288912  ...............................................EKGlgVQSLTYNP.......EGA...........
ENSP00000452765  ...............................................HHQs.VTSLLYPHglsskl.DQS...........
ENSP00000456709  ...............................................FLRs.ALQILFSE.......DST...........
ENSP00000453378  ...............................................HHQs.VTSLLYPHglsskl.DQS...........
ENSP00000396295  ...............................................ESNs.VESLGFCS.......VMP...........
ENSP00000370039  ...............................................ARMqtMLAIAFG-.......ANN...........
ENSP00000451998  ...............................................ARMqtMLAIAFG-.......ANN...........
ENSP00000464109  ...............................................HQNw.VYSCAFSP.......DSS...........
ENSP00000458843  ...............................................FLRs.ALQILFSE.......DST...........
ENSP00000484308  ...............................................HFGa.VLALSTLSggifggqGNS...........
ENSP00000368025  ...............................................HFGa.VLALSTLSggifggqGNS...........
ENSP00000260643  ...............................................KDQl.VTQLHWQE.......NGP...........
ENSP00000440796  ...............................................HGQp.VESVLLFP.......SGG...........
ENSP00000335522  ...............................................HRRn.VSALKY--.......HAG...........
ENSP00000462737  ...............................................---..--------.......---...........
ENSP00000445814  ...............................................---..--------.......---...........
ENSP00000464095  ...............................................NGR..VAASTFSS.......DSK...........
ENSP00000401445  ...............................................---..--------.......---...........
ENSP00000307235  ...............................................---..--------.......---...........
ENSP00000256797  ...............................................RRYs.APPMDGSPgk.....YMS...........
ENSP00000413812  ...............................................RRYs.APPMDGSPgk.....YMS...........
ENSP00000370348  ...............................................HESe.VFICAWNP.......VSD...........
ENSP00000394097  ...............................................HESe.VFICAWNP.......VSD...........
ENSP00000442365  ...............................................HSSf.ITHLDWAQ.......DSS...........
ENSP00000378254  ...............................................HSSf.ITHLDWSK.......DGN...........
ENSP00000433417  ...............................................HSSf.ITHLDWSK.......DGN...........
ENSP00000278845  ...............................................HSSf.ITHLDWSK.......DGN...........
ENSP00000364345  ...............................................---..--------.......---...........
ENSP00000420608  ...............................................---..--------.......---...........
ENSP00000466100  ...............................................---..--------.......---...........
ENSP00000217964  ...............................................HESe.VFICAWNP.......VSD...........
ENSP00000385988  ...............................................HESe.VFICAWNP.......VSD...........
ENSP00000471331  ...............................................---..--------.......---...........
ENSP00000301678  ...............................................---..--------.......---...........
ENSP00000382814  ...............................................---..--------.......---...........
ENSP00000301679  ...............................................---..--------.......---...........
ENSP00000483191  ...............................................HEGspVTSISARSwvsrearDPS...........
ENSP00000197268  ...............................................---..--------.......---...........
ENSP00000394063  ...............................................---..--------.......---...........
ENSP00000412076  ...............................................---..--------.......---...........
ENSP00000409656  ...............................................---..--------.......---...........
ENSP00000421171  ...............................................---..--------.......---...........
ENSP00000398526  ...............................................---..--------.......---...........
ENSP00000317469  ...............................................---..--------.......---...........
ENSP00000465994  ...............................................---..--------.......---...........
ENSP00000364354  ...............................................---..--------.......---...........
ENSP00000408325  ...............................................---..--------.......---...........
ENSP00000457361  ...............................................---..--------.......---...........
ENSP00000405764  ...............................................---..--------.......---...........
ENSP00000399150  ...............................................---..--------.......---...........
ENSP00000398433  ...............................................---..--------.......---...........
ENSP00000407669  ...............................................---..--------.......---...........
ENSP00000451998  ...............................................---..--------.......---...........
ENSP00000432762  ...............................................---..--------.......---...........
ENSP00000433942  ...............................................---..--------.......---...........
ENSP00000482352  ...............................................---..--------.......---...........
ENSP00000403323  ...............................................---..--------.......---...........
ENSP00000477741  ...............................................---..--------.......---...........
ENSP00000355464  ...............................................PTGtaVSTLSYIS.......RTN...........
ENSP00000355465  ...............................................PTGtaVSTLSYIS.......RTN...........


                                                       400         410        420       430         
                                                         |           |          |         |         
d1g72a_            .....................................TLYAGLN..HICMDWEPFMLP.YRAGQFFVGATLAMYPGPN...
ENSP00000355148  .....................................FLCTSSW..D-----------.-------------------...
ENSP00000348129  .....................................FLCTSSW..D-----------.-------------------...
ENSP00000482107  .....................................VVVTSSM..D-----------.-------------------...
ENSP00000291576  .....................................VVVTSSM..D-----------.-------------------...
ENSP00000339449  .....................................ECVTAST..DGTCIIWDLVRL.RRNQMILANTLFQCVCYHPee.
ENSP00000331815  .....................................LLATGSQ..D-----------.-------------------...
ENSP00000371888  .....................................YMAAVNS..T-----------.-------------------...
ENSP00000380313  .....................................YMAAVNS..T-----------.-------------------...
ENSP00000455046  .....................................YMAAVNS..T-----------.-------------------...
ENSP00000456405  .....................................YMAAVNS..T-----------.-------------------...
ENSP00000457870  .....................................YMAAVNS..T-----------.-------------------...
ENSP00000280190  .....................................ILCSGSD..D-----------.-------------------...
ENSP00000422763  .....................................ILCSGSD..D-----------.-------------------...
ENSP00000422200  .....................................ILCSGSD..D-----------.-------------------...
ENSP00000384792  iyfrsaqqgsdglhfvrthhvaekttlydmdiditqkYVAVACQ..D-----------.-------------------...
ENSP00000481995  .....................................FLVTGSQ..D-----------.-------------------...
ENSP00000384939  .....................................LLLTCAQ..DRQVCLWNSMEH.RLEWTRLVDEPGHCADFHP...
ENSP00000385059  .....................................LLLTCAQ..DRQVCLWNSMEH.RLEWTRLVDEPGHCADFHP...
ENSP00000450541  .....................................QLLTAGE..D-----------.-------------------...
ENSP00000320663  .....................................LLLTCAQ..DRQVCLWNSMEH.RLEWTRLVDEPGHCADFHP...
ENSP00000448161  .....................................RLLSWSF..D-----------.-------------------...
ENSP00000270301  iyfrsaqqgsdglhfvrthhvaekttlydmdiditqkYVAVACQ..D-----------.-------------------...
ENSP00000426154  iyfrtaqksgdgvqftrthhvvrkttlydmdvepswkYTAIGCQ..D-----------.-------------------...
ENSP00000423760  .....................................LLAAAST..D-----------.-------------------...
ENSP00000473564  .....................................LLAAAST..D-----------.-------------------...
ENSP00000205214  .....................................LLAAAST..D-----------.-------------------...
ENSP00000327384  .....................................QFLTCGH..D-----------.-------------------...
ENSP00000334314  .....................................QFLTCGH..D-----------.-------------------...
ENSP00000262233  .....................................QFLTCGH..D-----------.-------------------...
ENSP00000371889  .....................................QLISCSM..DDTVRYTSLMLR.DYSGQGVVKLDVQPKCVAVgpg
ENSP00000426725  .....................................QLISCSM..DDTVRYTSLMLR.DYSGQGVVKLDVQPKCVAVgpg
ENSP00000348842  .....................................LAVTGSD..D-----------.-------------------...
ENSP00000245925  .....................................VLAVGTV..T-----------.-------------------...
ENSP00000414851  .....................................FIITVGT..DQTTRLFAPWKR.KDQSQVTWHEIARPQIHGYd..
ENSP00000442365  .....................................VLAVGTV..T-----------.-------------------...
ENSP00000447548  .....................................LIITGSL..DALIQVWDLSDA.HRSRVPAPFLDRTGLTAVSh..
ENSP00000464789  .....................................VLAVGTV..T-----------.-------------------...
ENSP00000451998  .....................................YLAVASH..D-----------.-------------------...
ENSP00000370039  .....................................YLAVASH..D-----------.-------------------...
ENSP00000361570  .....................................IIFAVGS..D-----------.-------------------...
ENSP00000468312  .....................................QFVTCGQ..D-----------.-------------------...
ENSP00000285873  .....................................LMASGSN..N-----------.-------------------...
ENSP00000378254  .....................................VVAVGLN..T-----------.-------------------...
ENSP00000278845  .....................................VVAVGLN..T-----------.-------------------...
ENSP00000293879  .....................................HCATCSE..D-----------.-------------------...
ENSP00000435310  .....................................IIFAVGS..D-----------.-------------------...
ENSP00000448122  .....................................HCATCSE..D-----------.-------------------...
ENSP00000348842  .....................................YLAVASH..D-----------.-------------------...
ENSP00000314193  .....................................TLVTASK..D-----------.-------------------...
ENSP00000447224  .....................................RLAIAYD..NI----------.-------------------...
ENSP00000447224  .....................................KLVTGFS..N-----------.-------------------...
ENSP00000293879  .....................................LLVTLGDhdG-----------.-------------------...
ENSP00000254442  .....................................CICSVAS..D-----------.-------------------...
ENSP00000350187  .....................................CICSVAS..D-----------.-------------------...
ENSP00000416289  .....................................QLVTGCA..D-----------.-------------------...
ENSP00000389144  .....................................KIVSGGE..E-----------.-------------------...
ENSP00000310686  .....................................KIVSGGE..E-----------.-------------------...
ENSP00000288912  .....................................LLGAGFT..E-----------.-------------------...
ENSP00000452765  .....................................WMLSGDL..D-----------.-------------------...
ENSP00000456709  .....................................KLFVASN..Q-----------.-------------------...
ENSP00000453378  .....................................WMLSGDL..D-----------.-------------------...
ENSP00000396295  .....................................LAAVGYL..D-----------.-------------------...
ENSP00000370039  .....................................LTFTGTI..SGDVCVWKDHILcRIVARAHNGPVFAMYTTLR...
ENSP00000451998  .....................................LTFTGTI..SGDVCVWKDHILcRIVARAHNGPVFAMYTTLR...
ENSP00000464109  .....................................MLCSVGA..S-----------.-------------------...
ENSP00000458843  .....................................KLFVASN..Q-----------.-------------------...
ENSP00000484308  .....................................LLCSYGM..DDYVHLS-----.-------------------...
ENSP00000368025  .....................................LLCSYGM..DDYVHLS-----.-------------------...
ENSP00000260643  .....................................TFSSTPY..RYQACRFGQVPD.QPAGLRLFTVQIPHKRLRQ...
ENSP00000440796  .....................................LLVSAGG..------------.-------------------...
ENSP00000335522  .....................................TLFTGSG..D-----------.-------------------...
ENSP00000462737  .....................................-------..------------.-------------------...
ENSP00000445814  .....................................-------..------------.-------------------...
ENSP00000464095  .....................................KVYASSG..D-----------.-------------------...
ENSP00000401445  .....................................-------..------------.-------------------...
ENSP00000307235  .....................................-------..------------.-------------------...
ENSP00000256797  .....................................HLASCGM..------------.-------------------...
ENSP00000413812  .....................................HLASCGM..------------.-------------------...
ENSP00000370348  .....................................LLASGSG..D-----------.-------------------...
ENSP00000394097  .....................................LLASGSG..D-----------.-------------------...
ENSP00000442365  .....................................CFVTNSG..D-----------.-------------------...
ENSP00000378254  .....................................FIMSNSG..D-----------.-------------------...
ENSP00000433417  .....................................FIMSNSG..D-----------.-------------------...
ENSP00000278845  .....................................FIMSNSG..D-----------.-------------------...
ENSP00000364345  .....................................-------..------------.-------------------...
ENSP00000420608  .....................................-------..------------.-------------------...
ENSP00000466100  .....................................-------..------------.-------------------...
ENSP00000217964  .....................................LLASGSG..D-----------.-------------------...
ENSP00000385988  .....................................LLASGSG..D-----------.-------------------...
ENSP00000471331  .....................................-------..------------.-------------------...
ENSP00000301678  .....................................-------..------------.-------------------...
ENSP00000382814  .....................................-------..------------.-------------------...
ENSP00000301679  .....................................-------..------------.-------------------...
ENSP00000483191  .....................................LLINACL..------------.-------------------...
ENSP00000197268  .....................................-------..------------.-------------------...
ENSP00000394063  .....................................-------..------------.-------------------...
ENSP00000412076  .....................................-------..------------.-------------------...
ENSP00000409656  .....................................-------..------------.-------------------...
ENSP00000421171  .....................................-------..------------.-------------------...
ENSP00000398526  .....................................-------..------------.-------------------...
ENSP00000317469  .....................................-------..------------.-------------------...
ENSP00000465994  .....................................-------..------------.-------------------...
ENSP00000364354  .....................................-------..------------.-------------------...
ENSP00000408325  .....................................-------..------------.-------------------...
ENSP00000457361  .....................................-------..------------.-------------------...
ENSP00000405764  .....................................-------..------------.-------------------...
ENSP00000399150  .....................................-------..------------.-------------------...
ENSP00000398433  .....................................-------..------------.-------------------...
ENSP00000407669  .....................................-------..------------.-------------------...
ENSP00000451998  .....................................-------..------------.-------------------...
ENSP00000432762  .....................................-------..------------.-------------------...
ENSP00000433942  .....................................-------..------------.-------------------...
ENSP00000482352  .....................................-------..------------.-------------------...
ENSP00000403323  .....................................-------..------------.-------------------...
ENSP00000477741  .....................................-------..------------.-------------------...
ENSP00000355464  .....................................QLAVGFS..D-----------.-------------------...
ENSP00000355465  .....................................QLAVGFS..D-----------.-------------------...


                     440                                                                            
                       |                                                                            
d1g72a_            .GPTKKEM.........................................................................
ENSP00000355148  .-------.........................................................................
ENSP00000348129  .-------.........................................................................
ENSP00000482107  .-------.........................................................................
ENSP00000291576  .-------.........................................................................
ENSP00000339449  .FQIITSGtd.......................................................................
ENSP00000331815  .-------.........................................................................
ENSP00000371888  .-------.........................................................................
ENSP00000380313  .-------.........................................................................
ENSP00000455046  .-------.........................................................................
ENSP00000456405  .-------.........................................................................
ENSP00000457870  .-------.........................................................................
ENSP00000280190  .-------.........................................................................
ENSP00000422763  .-------.........................................................................
ENSP00000422200  .-------.........................................................................
ENSP00000384792  .-------.........................................................................
ENSP00000481995  .-------.........................................................................
ENSP00000384939  .SGTVVAIgths.....................................................................
ENSP00000385059  .SGTVVAIgths.....................................................................
ENSP00000450541  .-------.........................................................................
ENSP00000320663  .SGTVVAIgths.....................................................................
ENSP00000448161  .-------.........................................................................
ENSP00000270301  .-------.........................................................................
ENSP00000426154  .-------.........................................................................
ENSP00000423760  .-------.........................................................................
ENSP00000473564  .-------.........................................................................
ENSP00000205214  .-------.........................................................................
ENSP00000327384  .-------.........................................................................
ENSP00000334314  .-------.........................................................................
ENSP00000262233  .-------.........................................................................
ENSP00000371889  gYAVVVCI.........................................................................
ENSP00000426725  gYAVVVCI.........................................................................
ENSP00000348842  .-------.........................................................................
ENSP00000245925  .-------.........................................................................
ENSP00000414851  .LKCLAMInrfqfvsgadekvlrvfsaprnfvenfcaitgqslnhvlcnqdsdlpegatvpalglsnkavfqgdiasqpsd
ENSP00000442365  .-------.........................................................................
ENSP00000447548  .NGSYVYFpkigdk...................................................................
ENSP00000464789  .-------.........................................................................
ENSP00000451998  .-------.........................................................................
ENSP00000370039  .-------.........................................................................
ENSP00000361570  .-------.........................................................................
ENSP00000468312  .-------.........................................................................
ENSP00000285873  .-------.........................................................................
ENSP00000378254  .-------.........................................................................
ENSP00000278845  .-------.........................................................................
ENSP00000293879  .-------.........................................................................
ENSP00000435310  .-------.........................................................................
ENSP00000448122  .-------.........................................................................
ENSP00000348842  .-------.........................................................................
ENSP00000314193  .-------.........................................................................
ENSP00000447224  .------Vlvlditsgdpcpvidgprytfytqlpetlssvailtdyrvvysmtn...........................
ENSP00000447224  .-------.........................................................................
ENSP00000293879  .-------.........................................................................
ENSP00000254442  .-------.........................................................................
ENSP00000350187  .-------.........................................................................
ENSP00000416289  .-------.........................................................................
ENSP00000389144  .-------.........................................................................
ENSP00000310686  .-------.........................................................................
ENSP00000288912  .-------.........................................................................
ENSP00000452765  .-------.........................................................................
ENSP00000456709  .-------.........................................................................
ENSP00000453378  .-------.........................................................................
ENSP00000396295  .-------.........................................................................
ENSP00000370039  .DGLIVTGgkerpskeggavklwdqel......................................................
ENSP00000451998  .DGLIVTGgkerpskeggavklwdqel......................................................
ENSP00000464109  .-------.........................................................................
ENSP00000458843  .-------.........................................................................
ENSP00000484308  .------Eavldgvkvqlrplasilsschlthlillpksvgaitet...................................
ENSP00000368025  .------Eavldgvkvqlrplasilsschlthlillpksvgaitet...................................
ENSP00000260643  .PPP----.........................................................................
ENSP00000440796  .-------.........................................................................
ENSP00000335522  .-------.........................................................................
ENSP00000462737  .-------.........................................................................
ENSP00000445814  .-------.........................................................................
ENSP00000464095  .-------.........................................................................
ENSP00000401445  .-------.........................................................................
ENSP00000307235  .-------.........................................................................
ENSP00000256797  .-------.........................................................................
ENSP00000413812  .-------.........................................................................
ENSP00000370348  .-------.........................................................................
ENSP00000394097  .-------.........................................................................
ENSP00000442365  .-------.........................................................................
ENSP00000378254  .-------.........................................................................
ENSP00000433417  .-------.........................................................................
ENSP00000278845  .-------.........................................................................
ENSP00000364345  .-------.........................................................................
ENSP00000420608  .-------.........................................................................
ENSP00000466100  .-------.........................................................................
ENSP00000217964  .-------.........................................................................
ENSP00000385988  .-------.........................................................................
ENSP00000471331  .-------.........................................................................
ENSP00000301678  .-------.........................................................................
ENSP00000382814  .-------.........................................................................
ENSP00000301679  .-------.........................................................................
ENSP00000483191  .-------.........................................................................
ENSP00000197268  .-------.........................................................................
ENSP00000394063  .-------.........................................................................
ENSP00000412076  .-------.........................................................................
ENSP00000409656  .-------.........................................................................
ENSP00000421171  .-------.........................................................................
ENSP00000398526  .-------.........................................................................
ENSP00000317469  .-------.........................................................................
ENSP00000465994  .-------.........................................................................
ENSP00000364354  .-------.........................................................................
ENSP00000408325  .-------.........................................................................
ENSP00000457361  .-------.........................................................................
ENSP00000405764  .-------.........................................................................
ENSP00000399150  .-------.........................................................................
ENSP00000398433  .-------.........................................................................
ENSP00000407669  .-------.........................................................................
ENSP00000451998  .-------.........................................................................
ENSP00000432762  .-------.........................................................................
ENSP00000433942  .-------.........................................................................
ENSP00000482352  .-------.........................................................................
ENSP00000403323  .-------.........................................................................
ENSP00000477741  .-------.........................................................................
ENSP00000355464  .-------.........................................................................
ENSP00000355465  .-------.........................................................................


                                                                                                    
                                                                                                    
d1g72a_            .........................................................................GQIRAF..
ENSP00000355148  .........................................................................KNLKIW..
ENSP00000348129  .........................................................................KNLKIW..
ENSP00000482107  .........................................................................GTVRAF..
ENSP00000291576  .........................................................................GTVRAF..
ENSP00000339449  .........................................................................RKIAYW..
ENSP00000331815  .........................................................................RTAKLW..
ENSP00000371888  .........................................................................GNCYVW..
ENSP00000380313  .........................................................................GNCYVW..
ENSP00000455046  .........................................................................GNCYVW..
ENSP00000456405  .........................................................................GNCYVW..
ENSP00000457870  .........................................................................GNCYVW..
ENSP00000280190  .........................................................................GTVRIW..
ENSP00000422763  .........................................................................GTVRIW..
ENSP00000422200  .........................................................................GTVRIW..
ENSP00000384792  .........................................................................RNVRVY..
ENSP00000481995  .........................................................................CTVKLW..
ENSP00000384939  .........................................................................GRWFVL..
ENSP00000385059  .........................................................................GRWFVL..
ENSP00000450541  .........................................................................GKVQVW..
ENSP00000320663  .........................................................................GRWFVL..
ENSP00000448161  .........................................................................GTVKVW..
ENSP00000270301  .........................................................................RNVRVY..
ENSP00000426154  .........................................................................RNIRIF..
ENSP00000423760  .........................................................................GKVWIL..
ENSP00000473564  .........................................................................GKVWIL..
ENSP00000205214  .........................................................................GKVWIL..
ENSP00000327384  .........................................................................KHATLW..
ENSP00000334314  .........................................................................KHATLW..
ENSP00000262233  .........................................................................KHATLW..
ENSP00000371889  .........................................................................GQIVL-..
ENSP00000426725  .........................................................................GQIVL-..
ENSP00000348842  .........................................................................RSVRLW..
ENSP00000245925  .........................................................................GRWLLL..
ENSP00000414851  eeelltstgfeyqqvafqpsiltepptedhllqntlwpevqklyghgyeifcvtcnssktllasackaakkehAAIILW..
ENSP00000442365  .........................................................................GRWLLL..
ENSP00000447548  .........................................................................NKVTIW..
ENSP00000464789  .........................................................................GRWLLL..
ENSP00000451998  .........................................................................SFIDIY..
ENSP00000370039  .........................................................................SFIDIY..
ENSP00000361570  .........................................................................HTLK--..
ENSP00000468312  .........................................................................KLVHLW..
ENSP00000285873  .........................................................................AVIYVH..
ENSP00000378254  .........................................................................GRWLVL..
ENSP00000278845  .........................................................................GRWLVL..
ENSP00000293879  .........................................................................GSVRVW..
ENSP00000435310  .........................................................................HTLK--..
ENSP00000448122  .........................................................................GSVRVW..
ENSP00000348842  .........................................................................NFVDIY..
ENSP00000314193  .........................................................................GYFKVWil
ENSP00000447224  .........................................................................GDLFLY..
ENSP00000447224  .........................................................................GSISLV..
ENSP00000293879  .........................................................................RTLALW..
ENSP00000254442  .........................................................................HSVGLL..
ENSP00000350187  .........................................................................HSVGLL..
ENSP00000416289  .........................................................................GQLWIF..
ENSP00000389144  .........................................................................GLVSVW..
ENSP00000310686  .........................................................................GLVSVW..
ENSP00000288912  .........................................................................GTVYIL..
ENSP00000452765  .........................................................................SCVILW..
ENSP00000456709  .........................................................................GALHIV..
ENSP00000453378  .........................................................................SCVILW..
ENSP00000396295  .........................................................................GTLAIY..
ENSP00000370039  .........................................................................RRCRAF..
ENSP00000451998  .........................................................................RRCRAF..
ENSP00000464109  .........................................................................------..
ENSP00000458843  .........................................................................GALHIV..
ENSP00000484308  .........................................................................NCLRLW..
ENSP00000368025  .........................................................................NCLRLW..
ENSP00000260643  .........................................................................CYLTAW..
ENSP00000440796  .........................................................................RYVKVW..
ENSP00000335522  .........................................................................ACARAF..
ENSP00000462737  .........................................................................------..
ENSP00000445814  .........................................................................------..
ENSP00000464095  .........................................................................GEVYVW..
ENSP00000401445  .........................................................................------..
ENSP00000307235  .........................................................................------..
ENSP00000256797  .........................................................................GLLLTV..
ENSP00000413812  .........................................................................GLLLTV..
ENSP00000370348  .........................................................................STARIW..
ENSP00000394097  .........................................................................STARIW..
ENSP00000442365  .........................................................................YEILYW..
ENSP00000378254  .........................................................................YEILYW..
ENSP00000433417  .........................................................................YEILYW..
ENSP00000278845  .........................................................................YEILYW..
ENSP00000364345  .........................................................................------..
ENSP00000420608  .........................................................................------..
ENSP00000466100  .........................................................................------..
ENSP00000217964  .........................................................................STARIW..
ENSP00000385988  .........................................................................STARIW..
ENSP00000471331  .........................................................................------..
ENSP00000301678  .........................................................................------..
ENSP00000382814  .........................................................................------..
ENSP00000301679  .........................................................................------..
ENSP00000483191  .........................................................................NKLLLY..
ENSP00000197268  .........................................................................------..
ENSP00000394063  .........................................................................------..
ENSP00000412076  .........................................................................------..
ENSP00000409656  .........................................................................------..
ENSP00000421171  .........................................................................------..
ENSP00000398526  .........................................................................------..
ENSP00000317469  .........................................................................------..
ENSP00000465994  .........................................................................------..
ENSP00000364354  .........................................................................------..
ENSP00000408325  .........................................................................------..
ENSP00000457361  .........................................................................------..
ENSP00000405764  .........................................................................------..
ENSP00000399150  .........................................................................------..
ENSP00000398433  .........................................................................------..
ENSP00000407669  .........................................................................------..
ENSP00000451998  .........................................................................------..
ENSP00000432762  .........................................................................------..
ENSP00000433942  .........................................................................------..
ENSP00000482352  .........................................................................------..
ENSP00000403323  .........................................................................------..
ENSP00000477741  .........................................................................------..
ENSP00000355464  .........................................................................GYLALW..
ENSP00000355465  .........................................................................GYLALW..


                     450                            460                                             
                       |                              |                                             
d1g72a_            ....DLTT............G.........KAKWTKW.....E......................................
ENSP00000355148  ....NVHT............Gefrncg...ACVTLMQg....H......................................
ENSP00000348129  ....NVHT............Gefrncg...ACVTLMQg....H......................................
ENSP00000482107  ....DLHR............Y.........RNFRTFTsp...R......................................
ENSP00000291576  ....DLHR............Y.........RNFRTFTsp...R......................................
ENSP00000339449  ....EVFD............G.........TVIRELEgs...L......................................
ENSP00000331815  ....ALPQ............C.........QLLGVFSg....H......................................
ENSP00000371888  ....NLTG............Gigdevtql.IPKTKIPa....H......................................
ENSP00000380313  ....NLTG............Gigdevtql.IPKTKIPa....H......................................
ENSP00000455046  ....NLTG............Gigdevtql.IPKTKIPa....H......................................
ENSP00000456405  ....NLTG............Gigdevtql.IPKTKIPa....H......................................
ENSP00000457870  ....NLTG............Gigdevtql.IPKTKIPa....H......................................
ENSP00000280190  ....DYTQ............D.........ACINILNg....H......................................
ENSP00000422763  ....DYTQ............D.........ACINILNg....H......................................
ENSP00000422200  ....DYTQ............D.........ACINILNg....H......................................
ENSP00000384792  ....NTVN............G.........KQKKCYKgsqg.D......................................
ENSP00000481995  ....PLPKallskntapdn.Gpill.....QAQTTQRc....H......................................
ENSP00000384939  ....DAET............R.........DLVSIHTd....G......................................
ENSP00000385059  ....DAET............R.........DLVSIHTd....G......................................
ENSP00000450541  ....SGSL............G.........RPRGHLGsl...S......................................
ENSP00000320663  ....DAET............R.........DLVSIHTd....G......................................
ENSP00000448161  ....NIIT............G.........NKEKDFVc....H......................................
ENSP00000270301  ....NTVN............G.........KQKKCYKgsqg.D......................................
ENSP00000426154  ....NISS............G.........KQKKLFKgsqg.E......................................
ENSP00000423760  ....ESQS............G.........QLQSVYEl....P......................................
ENSP00000473564  ....ESQS............G.........QLQSVYEl....P......................................
ENSP00000205214  ....ESQS............G.........QLQSVYEl....P......................................
ENSP00000327384  ....DAVG............H.........RPVWDKI.....I......................................
ENSP00000334314  ....DAVG............H.........RPVWDKI.....I......................................
ENSP00000262233  ....DAVG............H.........RPVWDKI.....I......................................
ENSP00000371889  ....-LKD............Q.........RKCFSIDn....P......................................
ENSP00000426725  ....-LKD............Q.........RKCFSIDn....P......................................
ENSP00000348842  ....SLAD............H.........ALIARCN.....M......................................
ENSP00000245925  ....DTET............H.........DLVAIHTd....G......................................
ENSP00000414851  ....NTTS............W.........KQVQNLVf....H......................................
ENSP00000442365  ....DTET............H.........DLVAIHTd....G......................................
ENSP00000447548  ....DLAE............G.........EEQDSLDt....Sseirclevaeqrkllftglvsgvvlvfplnsrqdvici
ENSP00000464789  ....DTET............H.........DLVAIHTd....G......................................
ENSP00000451998  ....NVMS............S.........KRVGICKg....A......................................
ENSP00000370039  ....NVMS............S.........KRVGICKg....A......................................
ENSP00000361570  ....EIAD............S.........LILREISa....F......................................
ENSP00000468312  ....SSDS............H.........QPLWSRI.....I......................................
ENSP00000285873  ....NLKTviesspespvtiT.........EPYRTLSg....H......................................
ENSP00000378254  ....DTET............R.........EIVSDVId....G......................................
ENSP00000278845  ....DTET............R.........EIVSDVId....G......................................
ENSP00000293879  ....ALAS............M.........ELVIQFQv....L......................................
ENSP00000435310  ....EIAD............S.........LILREISa....F......................................
ENSP00000448122  ....ALAS............M.........ELVIQFQv....L......................................
ENSP00000348842  ....NVLT............S.........KRVGICKg....A......................................
ENSP00000314193  tddsDIYK............K.........AVGWTCDfvgsyH......................................
ENSP00000447224  ....ECAT............S.........KAFPLET.....H......................................
ENSP00000447224  ....SSKG............D.........RLLEKLP.....-......................................
ENSP00000293879  ....GTAT............Y.........DLVSSTR.....L......................................
ENSP00000254442  ....SLRE............K.........KCIMLASr....H......................................
ENSP00000350187  ....SLRE............K.........KCIMLASr....H......................................
ENSP00000416289  ....SLMD............G.........HHYRRVAr....Vdlrkktetfstrrvksglcsqpeesqlpstsalgkgeq
ENSP00000389144  ....DYRM............N.........QKLWEVY.....S......................................
ENSP00000310686  ....DYRM............N.........QKLWEVY.....S......................................
ENSP00000288912  ....DAMS............Len.......ESPEPFKy....S......................................
ENSP00000452765  ....DIFT............E.........EILHKFFl....E......................................
ENSP00000456709  ....QLSG............Gsf.......KHLHAFQp....Q......................................
ENSP00000453378  ....DIFT............E.........EILHKFFl....E......................................
ENSP00000396295  ....DLAT............Q.........TLRHQCQ.....H......................................
ENSP00000370039  ....RLET............G.........QATDCVRs....Vcrgkgkilvgtrnaeiievgeknaacnilvnghv....
ENSP00000451998  ....RLET............G.........QATDCVRs....Vcrgkgkilvgtrnaeiievgeknaacnilvnghv....
ENSP00000464109  ....----............-.........-------.....-......................................
ENSP00000458843  ....QLSG............Gsf.......KHLHAFQp....Q......................................
ENSP00000484308  ....KFHD............FlssgsqnglKFIETLPl....H......................................
ENSP00000368025  ....KFHD............FlssgsqnglKFIETLPl....H......................................
ENSP00000260643  ....DGSN............F.........LPLRTKSc....G......................................
ENSP00000440796  ....DMLK............Gg........QLLVSLKn....H......................................
ENSP00000335522  ....DAQS............G.........ELRRVFRg....H......................................
ENSP00000462737  ....----............-.........-------.....-......................................
ENSP00000445814  ....----............-.........-------.....-......................................
ENSP00000464095  ....DVNS............R.........KCLNRFVde...G......................................
ENSP00000401445  ....----............-.........-------.....-......................................
ENSP00000307235  ....----............-.........-------.....-......................................
ENSP00000256797  ....DPGS............G.........TVLWTQD.....L......................................
ENSP00000413812  ....DPGS............G.........TVLWTQD.....L......................................
ENSP00000370348  ....NLNE............Nsngg.....STQLVLR.....H......................................
ENSP00000394097  ....NLNE............Nsngg.....STQLVLR.....H......................................
ENSP00000442365  ....DPAT............C.........KQITSADa....Vrnmewatatcvlgfgvfgiwsegad.............
ENSP00000378254  ....DVAG............Gck.......QLKNRYE.....Srdrewatytcvlgfhvygvwpdgsd.............
ENSP00000433417  ....DVAG............Gck.......QLKNRYE.....Srdrewatytcvlgfhvygvwpdgsd.............
ENSP00000278845  ....DVAG............Gck.......QLKNRYE.....Srdrewatytcvlgfhvygvwpdgsd.............
ENSP00000364345  ....----............-.........-------.....-......................................
ENSP00000420608  ....----............-.........-------.....-......................................
ENSP00000466100  ....----............-.........-------.....-......................................
ENSP00000217964  ....NLNE............Nsngg.....STQLVLR.....H......................................
ENSP00000385988  ....NLNE............Nsngg.....STQLVLR.....H......................................
ENSP00000471331  ....----............-.........-------.....-......................................
ENSP00000301678  ....----............-.........-------.....-......................................
ENSP00000382814  ....----............-.........-------.....-......................................
ENSP00000301679  ....----............-.........-------.....-......................................
ENSP00000483191  ....RVVD............Negtl.....QLKRSFPieq..S......................................
ENSP00000197268  ....----............-.........-------.....-......................................
ENSP00000394063  ....----............-.........-------.....-......................................
ENSP00000412076  ....----............-.........-------.....-......................................
ENSP00000409656  ....----............-.........-------.....-......................................
ENSP00000421171  ....----............-.........-------.....-......................................
ENSP00000398526  ....----............-.........-------.....-......................................
ENSP00000317469  ....----............-.........-------.....-......................................
ENSP00000465994  ....----............-.........-------.....-......................................
ENSP00000364354  ....----............-.........-------.....-......................................
ENSP00000408325  ....----............-.........-------.....-......................................
ENSP00000457361  ....----............-.........-------.....-......................................
ENSP00000405764  ....----............-.........-------.....-......................................
ENSP00000399150  ....----............-.........-------.....-......................................
ENSP00000398433  ....----............-.........-------.....-......................................
ENSP00000407669  ....----............-.........-------.....-......................................
ENSP00000451998  ....----............-.........-------.....-......................................
ENSP00000432762  ....----............-.........-------.....-......................................
ENSP00000433942  ....----............-.........-------.....-......................................
ENSP00000482352  ....----............-.........-------.....-......................................
ENSP00000403323  ....----............-.........-------.....-......................................
ENSP00000477741  ....----............-.........-------.....-......................................
ENSP00000355464  ....NMKS............M.........KREYYIQles..G......................................
ENSP00000355465  ....NMKS............M.........KREYYIQles..G......................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  .................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  pppearkaincmslskcedrlaiaydnivlvlditsgdpcpvidgprytfytqlpetlssvailtdyrvvysmtngdlfly
ENSP00000464789  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  .................................................................................
ENSP00000350187  .................................................................................
ENSP00000416289  vevtfpvlrlapcdlslipnsacgclssentrcvwigssvglfvfnlanleveaalyykdfqslsillagscalrnrtadq
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  .................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  ecatskafpleth....................................................................
ENSP00000464789  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  .................................................................................
ENSP00000350187  .................................................................................
ENSP00000416289  kvlcllaslfggkiavleinpaalvraqqcpsmgqslsvpasscvlptsplylgiakekstkaaseqrraarnvmkdqrlv
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                                    
                                                                                                    
d1g72a_            ...............................................................K...........FAAWGG
ENSP00000355148  ...............................................................E...........GSVSSC
ENSP00000348129  ...............................................................E...........GSVSSC
ENSP00000482107  ...............................................................P...........TQFSCV
ENSP00000291576  ...............................................................P...........TQFSCV
ENSP00000339449  ...............................................................S...........GSINGM
ENSP00000331815  ...............................................................R...........RGLWCV
ENSP00000371888  ...............................................................T...........RYALQC
ENSP00000380313  ...............................................................T...........RYALQC
ENSP00000455046  ...............................................................T...........RYALQC
ENSP00000456405  ...............................................................T...........RYALQC
ENSP00000457870  ...............................................................T...........RYALQC
ENSP00000280190  ...............................................................T...........APVRGL
ENSP00000422763  ...............................................................T...........APVRGL
ENSP00000422200  ...............................................................T...........APVRGL
ENSP00000384792  ...............................................................E...........GSLLKV
ENSP00000481995  ...............................................................D...........KDINSV
ENSP00000384939  ...............................................................N...........EQLSVM
ENSP00000385059  ...............................................................N...........EQLSVM
ENSP00000450541  ...............................................................L...........SPALSV
ENSP00000320663  ...............................................................N...........EQLSVM
ENSP00000448161  ...............................................................Q...........GTVLSC
ENSP00000270301  ...............................................................E...........GSLLKV
ENSP00000426154  ...............................................................D...........GTLIKV
ENSP00000423760  ...............................................................G...........EVFSSP
ENSP00000473564  ...............................................................G...........EVFSSP
ENSP00000205214  ...............................................................G...........EVFSSP
ENSP00000327384  ...............................................................E...........DPAQSS
ENSP00000334314  ...............................................................E...........DPAQSS
ENSP00000262233  ...............................................................E...........DPAQSS
ENSP00000371889  ...............................................................G...........YEPEVV
ENSP00000426725  ...............................................................G...........YEPEVV
ENSP00000348842  ...............................................................E...........EAVRSV
ENSP00000245925  ...............................................................N...........EQISVV
ENSP00000414851  ...............................................................S...........LTVTQM
ENSP00000442365  ...............................................................N...........EQISVV
ENSP00000447548  ...............................................................R...........SRVACV
ENSP00000464789  ...............................................................N...........EQISVV
ENSP00000451998  ...............................................................T...........SYITHI
ENSP00000370039  ...............................................................T...........SYITHI
ENSP00000361570  ...............................................................D...........VTYTAI
ENSP00000468312  ...............................................................E...........DPARSA
ENSP00000285873  ...............................................................T...........AKITSV
ENSP00000378254  ...............................................................N...........EQLSVV
ENSP00000278845  ...............................................................N...........EQLSVV
ENSP00000293879  ...............................................................N...........QSCLCL
ENSP00000435310  ...............................................................D...........VTYTAI
ENSP00000448122  ...............................................................N...........QSCLCL
ENSP00000348842  ...............................................................S...........SYITHI
ENSP00000314193  ...............................................................K...........YQATNC
ENSP00000447224  ...............................................................R...........SRVACV
ENSP00000447224  ...............................................................-...........DAVRFL
ENSP00000293879  ...............................................................P...........EPVHGV
ENSP00000254442  ...............................................................L...........FPIQVI
ENSP00000350187  ...............................................................L...........FPIQVI
ENSP00000416289  fhskvrssgyasaphvtmfspktniksegkgssrsrsscareaypvecavptkpgpqvaaaptC...........TRVCCI
ENSP00000389144  ...............................................................G...........HPVQHI
ENSP00000310686  ...............................................................G...........HPVQHI
ENSP00000288912  ...............................................................R...........TSVTHI
ENSP00000452765  ...............................................................A...........GPVTSL
ENSP00000456709  ...............................................................S...........GTVEAM
ENSP00000453378  ...............................................................A...........GPVTSL
ENSP00000396295  ...............................................................Q...........SGIVQL
ENSP00000370039  ...............................................................D...........GPIWGL
ENSP00000451998  ...............................................................D...........GPIWGL
ENSP00000464109  ...............................................................-...........------
ENSP00000458843  ...............................................................S...........GTVEAM
ENSP00000484308  ...............................................................L...........CAITSF
ENSP00000368025  ...............................................................L...........CAITSF
ENSP00000260643  ...............................................................H...........EVVSCL
ENSP00000440796  ...............................................................H...........KTVTCL
ENSP00000335522  ...............................................................T...........FIINCI
ENSP00000462737  ...............................................................-...........------
ENSP00000445814  ...............................................................-...........------
ENSP00000464095  ...............................................................S...........LYGLSI
ENSP00000401445  ...............................................................-...........------
ENSP00000307235  ...............................................................-...........------
ENSP00000256797  ...............................................................G...........VPVMGV
ENSP00000413812  ...............................................................G...........VPVMGV
ENSP00000370348  ...............................................................CiregghdvpsnKDVTSL
ENSP00000394097  ...............................................................CiregghdvpsnKDVTSL
ENSP00000442365  ...............................................................G...........TDINAV
ENSP00000378254  ...............................................................G...........TDINSL
ENSP00000433417  ...............................................................G...........TDINSL
ENSP00000278845  ...............................................................G...........TDINSL
ENSP00000364345  ...............................................................-...........------
ENSP00000420608  ...............................................................-...........------
ENSP00000466100  ...............................................................-...........------
ENSP00000217964  ...............................................................CiregghdvpsnKDVTSL
ENSP00000385988  ...............................................................CiregghdvpsnKDVTSL
ENSP00000471331  ...............................................................-...........------
ENSP00000301678  ...............................................................-...........------
ENSP00000382814  ...............................................................-...........------
ENSP00000301679  ...............................................................-...........------
ENSP00000483191  ...............................................................S...........HPVRSI
ENSP00000197268  ...............................................................-...........------
ENSP00000394063  ...............................................................-...........------
ENSP00000412076  ...............................................................-...........------
ENSP00000409656  ...............................................................-...........------
ENSP00000421171  ...............................................................-...........------
ENSP00000398526  ...............................................................-...........------
ENSP00000317469  ...............................................................-...........------
ENSP00000465994  ...............................................................-...........------
ENSP00000364354  ...............................................................-...........------
ENSP00000408325  ...............................................................-...........------
ENSP00000457361  ...............................................................-...........------
ENSP00000405764  ...............................................................-...........------
ENSP00000399150  ...............................................................-...........------
ENSP00000398433  ...............................................................-...........------
ENSP00000407669  ...............................................................-...........------
ENSP00000451998  ...............................................................-...........------
ENSP00000432762  ...............................................................-...........------
ENSP00000433942  ...............................................................-...........------
ENSP00000482352  ...............................................................-...........------
ENSP00000403323  ...............................................................-...........------
ENSP00000477741  ...............................................................-...........------
ENSP00000355464  ...............................................................Q...........VPVYAV
ENSP00000355465  ...............................................................Q...........VPVYAV


                    470                                                                             
                      |                                                                             
d1g72a_            ...TLYT......KG..................................................................
ENSP00000355148  ...HFAR......DS..................................................................
ENSP00000348129  ...HFAR......DS..................................................................
ENSP00000482107  ...AVDA......SG..................................................................
ENSP00000291576  ...AVDA......SG..................................................................
ENSP00000339449  ...DITQ......EG..................................................................
ENSP00000331815  ...QFSP......MD..................................................................
ENSP00000371888  ...RFSP......DS..................................................................
ENSP00000380313  ...RFSP......DS..................................................................
ENSP00000455046  ...RFSP......DS..................................................................
ENSP00000456405  ...RFSP......DS..................................................................
ENSP00000457870  ...RFSP......DS..................................................................
ENSP00000280190  ...MWNTe.....IP..................................................................
ENSP00000422763  ...MWNTe.....IP..................................................................
ENSP00000422200  ...MWNTe.....IP..................................................................
ENSP00000384792  ...HVDP......SG..................................................................
ENSP00000481995  ...AIAP......ND..................................................................
ENSP00000384939  ...RYSI......DG..................................................................
ENSP00000385059  ...RYSI......DG..................................................................
ENSP00000450541  ...ALSP......DG..................................................................
ENSP00000320663  ...RYSI......DG..................................................................
ENSP00000448161  ...DISH......DA..................................................................
ENSP00000270301  ...HVDP......SG..................................................................
ENSP00000426154  ...QTDP......SG..................................................................
ENSP00000423760  ...VV--......LE..................................................................
ENSP00000473564  ...VV--......LE..................................................................
ENSP00000205214  ...VV--......LE..................................................................
ENSP00000327384  ...GFHP......SG..................................................................
ENSP00000334314  ...GFHP......SG..................................................................
ENSP00000262233  ...GFHP......SG..................................................................
ENSP00000371889  ...AVHP......GG..................................................................
ENSP00000426725  ...AVHP......GG..................................................................
ENSP00000348842  ...AFSP......DG..................................................................
ENSP00000245925  ...SFSP......DG..................................................................
ENSP00000414851  ...AFSP......NE..................................................................
ENSP00000442365  ...SFSP......DG..................................................................
ENSP00000447548  ...EVSH......KE..................................................................
ENSP00000464789  ...SFSP......DG..................................................................
ENSP00000451998  ...DWDI......RGkllqvntgakeqlffeaprgkkqtipsvevekiawaswtsvlglccegiwpvigevtdvtasclts
ENSP00000370039  ...DWDI......RGkllqvntgakeqlffeaprgkkqtipsvevekiawaswtsvlglccegiwpvigevtdvtasclts
ENSP00000361570  ...VISH......SG..................................................................
ENSP00000468312  ...GFHP......SG..................................................................
ENSP00000285873  ...AWSPh.....HD..................................................................
ENSP00000378254  ...RYSP......DG..................................................................
ENSP00000278845  ...RYSP......DG..................................................................
ENSP00000293879  ...AWSPpccgrpEQ..................................................................
ENSP00000435310  ...VISH......SG..................................................................
ENSP00000448122  ...AWSPpccgrpEQ..................................................................
ENSP00000348842  ...DWDS......RGkllqvnsgareqlffeaprgkrhiirpseiekiewdtwtcvlgptcegiwpahsditdvnaasltk
ENSP00000314193  ...CFSE......DG..................................................................
ENSP00000447224  ...EVSH......KE..................................................................
ENSP00000447224  ...VVSE......DE..................................................................
ENSP00000293879  ...AFNP......WDageltcvgqgtvtfwllqqrgadislqvrrepvpeavgageltslcygap................
ENSP00000254442  ...KWRP......SD..................................................................
ENSP00000350187  ...KWRP......SD..................................................................
ENSP00000416289  ...QYSG......DG..................................................................
ENSP00000389144  ...SFSS......--..................................................................
ENSP00000310686  ...SFSS......--..................................................................
ENSP00000288912  ...SFSH......DS..................................................................
ENSP00000452765  ...LMSPekfklrGE..................................................................
ENSP00000456709  cllAVSP......DG..................................................................
ENSP00000453378  ...LMSPekfklrGE..................................................................
ENSP00000396295  ...LWEA......GT..................................................................
ENSP00000370039  ...ATHP......SR..................................................................
ENSP00000451998  ...ATHP......SR..................................................................
ENSP00000464109  ...----......--..................................................................
ENSP00000458843  cllAVSP......DG..................................................................
ENSP00000484308  ...DVCL......SL..................................................................
ENSP00000368025  ...DVCL......SL..................................................................
ENSP00000260643  ...DVSE......SG..................................................................
ENSP00000440796  ...CLSS......SG..................................................................
ENSP00000335522  ...QV--......HG..................................................................
ENSP00000462737  ...----......--..................................................................
ENSP00000445814  ...----......--..................................................................
ENSP00000464095  ...ATSR......NG..................................................................
ENSP00000401445  ...----......--..................................................................
ENSP00000307235  ...----......--..................................................................
ENSP00000256797  ..yTWHQ......DG..................................................................
ENSP00000413812  ..yTWHQ......DG..................................................................
ENSP00000370348  ...DWNT......NG..................................................................
ENSP00000394097  ...DWNT......NG..................................................................
ENSP00000442365  ...ARSH......DG..................................................................
ENSP00000378254  ...CRSH......NE..................................................................
ENSP00000433417  ...CRSH......NE..................................................................
ENSP00000278845  ...CRSH......NE..................................................................
ENSP00000364345  ...----......--..................................................................
ENSP00000420608  ...----......--..................................................................
ENSP00000466100  ...----......--..................................................................
ENSP00000217964  ...DWNT......NG..................................................................
ENSP00000385988  ...DWNT......NG..................................................................
ENSP00000471331  ...----......--..................................................................
ENSP00000301678  ...----......--..................................................................
ENSP00000382814  ...----......--..................................................................
ENSP00000301679  ...----......--..................................................................
ENSP00000483191  fcpLMSFr.....QG..................................................................
ENSP00000197268  ...----......--..................................................................
ENSP00000394063  ...----......--..................................................................
ENSP00000412076  ...----......--..................................................................
ENSP00000409656  ...----......--..................................................................
ENSP00000421171  ...----......--..................................................................
ENSP00000398526  ...----......--..................................................................
ENSP00000317469  ...----......--..................................................................
ENSP00000465994  ...----......--..................................................................
ENSP00000364354  ...----......--..................................................................
ENSP00000408325  ...----......--..................................................................
ENSP00000457361  ...----......--..................................................................
ENSP00000405764  ...----......--..................................................................
ENSP00000399150  ...----......--..................................................................
ENSP00000398433  ...----......--..................................................................
ENSP00000407669  ...----......--..................................................................
ENSP00000451998  ...----......--..................................................................
ENSP00000432762  ...----......--..................................................................
ENSP00000433942  ...----......--..................................................................
ENSP00000482352  ...----......--..................................................................
ENSP00000403323  ...----......--..................................................................
ENSP00000477741  ...----......--..................................................................
ENSP00000355464  ...TF--......--..................................................................
ENSP00000355465  ...TF--......--..................................................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  .................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  .................................................................................
ENSP00000464789  .................................................................................
ENSP00000451998  dk...............................................................................
ENSP00000370039  dk...............................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  dcsllatgddfgfvklfsypvkgqharfkkyvghsahvtnvrwlhndsvlltvggadtalmiwtrefvgtqesklvdsees
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  .................................................................................
ENSP00000350187  .................................................................................
ENSP00000416289  .................................................................................
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  .................................................................................
ENSP00000291576  .................................................................................
ENSP00000339449  .................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  .................................................................................
ENSP00000464789  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  dtdveedggydsdvarekaidyttkiyavsiremegtkphqqlkevsveerppvsraapqpeklqknnitkkkklveelal
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  .................................................................................
ENSP00000350187  .................................................................................
ENSP00000416289  .................................................................................
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                                                                     480          49
                                                                                       |            
d1g72a_            ................................................................GLVWY..ATLDGY.LKA
ENSP00000355148  ................................................................SFLIS..GGFDRT.VAI
ENSP00000348129  ................................................................SFLIS..GGFDRT.VAI
ENSP00000482107  ................................................................EIVSA..GAQDSFeIFV
ENSP00000291576  ................................................................EIVSA..GAQDSFeIFV
ENSP00000339449  ................................................................VHFVT..GGNDHL.VKV
ENSP00000331815  ................................................................QVLAT..ASADGT.IKL
ENSP00000371888  ................................................................TLLAT..CSADQT.CKI
ENSP00000380313  ................................................................TLLAT..CSADQT.CKI
ENSP00000455046  ................................................................TLLAT..CSADQT.CKI
ENSP00000456405  ................................................................TLLAT..CSADQT.CKI
ENSP00000457870  ................................................................TLLAT..CSADQT.CKI
ENSP00000280190  ................................................................YLLIS..GSWDYT.IKV
ENSP00000422763  ................................................................YLLIS..GSWDYT.IKV
ENSP00000422200  ................................................................YLLIS..GSWDYT.IKV
ENSP00000384792  ................................................................TFLAT..SCSDKS.ISV
ENSP00000481995  ................................................................KLLAT..GSQDRT.AKL
ENSP00000384939  ................................................................TFLAV..GSHDNF.IYL
ENSP00000385059  ................................................................TFLAV..GSHDNF.IYL
ENSP00000450541  ................................................................DRVAV..GYRADG.IRI
ENSP00000320663  ................................................................TFLAV..GSHDNF.IYL
ENSP00000448161  ................................................................TKFSS..TSADKT.AKI
ENSP00000270301  ................................................................TFLAT..SCSDKS.ISV
ENSP00000426154  ................................................................IYIAT..SCSDKN.LSI
ENSP00000423760  ................................................................SMLII..GCRDNY.VYC
ENSP00000473564  ................................................................SMLII..GCRDNY.VYC
ENSP00000205214  ................................................................SMLII..GCRDNY.VYC
ENSP00000327384  ................................................................SVVAV..GTLTGR.WFV
ENSP00000334314  ................................................................SVVAV..GTLTGR.WFV
ENSP00000262233  ................................................................SVVAV..GTLTGR.WFV
ENSP00000371889  ................................................................DTVAI..GGVDGN.VRL
ENSP00000426725  ................................................................DTVAI..GGVDGN.VRL
ENSP00000348842  ................................................................SQLAL..GMKDGS.FIV
ENSP00000245925  ................................................................AYLAV..GSHDNL.VYV
ENSP00000414851  ................................................................KFLLA..VSRDRT.WSL
ENSP00000442365  ................................................................AYLAV..GSHDNL.VYV
ENSP00000447548  ................................................................QLVVS..GSEDAL.LCL
ENSP00000464789  ................................................................AYLAV..GSHDNL.VYV
ENSP00000451998  ................................................................MVLAT..GDDLGF.VKL
ENSP00000370039  ................................................................MVLAT..GDDLGF.VKL
ENSP00000361570  ................................................................RMMFV..GTSVGT.IRA
ENSP00000468312  ................................................................SVLAV..GTVTGR.WLL
ENSP00000285873  ................................................................GRLVS..ASYDGT.AQV
ENSP00000378254  ................................................................LYLAI..GSHDNV.IYI
ENSP00000278845  ................................................................LYLAI..GSHDNV.IYI
ENSP00000293879  ................................................................QRLAA..GYGDGS.LRI
ENSP00000435310  ................................................................RMMFV..GTSVGT.IRA
ENSP00000448122  ................................................................QRLAA..GYGDGS.LRI
ENSP00000348842  dhvfgyrgfdcrnnlhylndgadiifhtaaagivqnlstgsqsfylehtddilcltvnqhpkyrNVVATsqIGTTPS.IHI
ENSP00000314193  ................................................................SLLAV..SFE-EI.VTI
ENSP00000447224  ................................................................QLVVS..GSEDAL.LCL
ENSP00000447224  ................................................................SLLAA..GFG-RS.VRI
ENSP00000293879  ................................................................PLLYC..GTSSGQ.VCV
ENSP00000254442  ................................................................DYLVV..GCSDGS.VYV
ENSP00000350187  ................................................................DYLVV..GCSDGS.VYV
ENSP00000416289  ................................................................QWLAC..GLANHL.LLV
ENSP00000389144  ................................................................-----..------.---
ENSP00000310686  ................................................................-----..------.---
ENSP00000288912  ................................................................QYMAT..ADRSFT.VAV
ENSP00000452765  ................................................................QIICC..VCGDHS.VAL
ENSP00000456709  ................................................................NWLAA..SGTSAG.VHV
ENSP00000453378  ................................................................QIICC..VCGDHS.VAL
ENSP00000396295  ................................................................AVVYT..CSLDGI.VRL
ENSP00000370039  ................................................................DFFLS..AAEDGT.VRL
ENSP00000451998  ................................................................DFFLS..AAEDGT.VRL
ENSP00000464109  ................................................................-----..------.---
ENSP00000458843  ................................................................NWLAA..SGTSAG.VHV
ENSP00000484308  ................................................................SLFVT..GSADGS.VRI
ENSP00000368025  ................................................................SLFVT..GSADGS.VRI
ENSP00000260643  ................................................................TFLGL..GTVTGS.VAI
ENSP00000440796  ................................................................QRLLS..GSLDRK.VKV
ENSP00000335522  ................................................................QVLYT..ASHDGA.LRL
ENSP00000462737  ................................................................-----..------.---
ENSP00000445814  ................................................................-FLVA..GGEDFK.LYK
ENSP00000464095  ................................................................QYVAC..GCY---.---
ENSP00000401445  ................................................................-----..------.---
ENSP00000307235  ................................................................-----..------.---
ENSP00000256797  ................................................................-----..------.---
ENSP00000413812  ................................................................-----..------.---
ENSP00000370348  ................................................................TLLAT..GSYDGF.ARI
ENSP00000394097  ................................................................TLLAT..GSYDGF.ARI
ENSP00000442365  ................................................................KLLAS..ADDFGK.VHL
ENSP00000378254  ................................................................RVVAV..ADDFCK.VHL
ENSP00000433417  ................................................................RVVAV..ADDFCK.VHL
ENSP00000278845  ................................................................RVVAV..ADDFCK.VHL
ENSP00000364345  ................................................................-----..------.---
ENSP00000420608  ................................................................-----..------.---
ENSP00000466100  ................................................................-----..------.---
ENSP00000217964  ................................................................TLLAT..GSYDGF.ARI
ENSP00000385988  ................................................................TLLAT..GSYDGF.ARI
ENSP00000471331  ................................................................-----..------.---
ENSP00000301678  ................................................................-----..------.---
ENSP00000382814  ................................................................-----..------.---
ENSP00000301679  ................................................................-----..------.---
ENSP00000483191  ................................................................ACVVT..GSEDMC.VHF
ENSP00000197268  ................................................................-----..------.---
ENSP00000394063  ................................................................-----..------.---
ENSP00000412076  ................................................................-----..------.---
ENSP00000409656  ................................................................-----..------.---
ENSP00000421171  ................................................................-----..------.---
ENSP00000398526  ................................................................-----..------.---
ENSP00000317469  ................................................................-----..------.---
ENSP00000465994  ................................................................-----..------.---
ENSP00000364354  ................................................................-----..------.---
ENSP00000408325  ................................................................-----..------.---
ENSP00000457361  ................................................................-----..------.---
ENSP00000405764  ................................................................-----..------.---
ENSP00000399150  ................................................................-----..------.---
ENSP00000398433  ................................................................-----..------.---
ENSP00000407669  ................................................................-----..------.---
ENSP00000451998  ................................................................-----..------.---
ENSP00000432762  ................................................................-----..------.---
ENSP00000433942  ................................................................-----..------.---
ENSP00000482352  ................................................................-----..------.---
ENSP00000403323  ................................................................-----..------.---
ENSP00000477741  ................................................................-----..------.---
ENSP00000355464  ................................................................-----..------.---
ENSP00000355465  ................................................................-----..------.---


                   0                                                                                
                   |                                                                                
d1g72a_            L....DNKDG.....KELW..............................................................
ENSP00000355148  W....DVAEG.....YRKL..............................................................
ENSP00000348129  W....DVAEG.....YRKL..............................................................
ENSP00000482107  W....SMQTG.....RLLD..............................................................
ENSP00000291576  W....SMQTG.....RLLD..............................................................
ENSP00000339449  W....DYNEG.....EVTH..............................................................
ENSP00000331815  W....ALQDF.....SCLK..............................................................
ENSP00000371888  W....RTSNF.....SLMT..............................................................
ENSP00000380313  W....RTSNF.....SLMT..............................................................
ENSP00000455046  W....RTSNF.....SLMT..............................................................
ENSP00000456405  W....RTSNF.....SLMT..............................................................
ENSP00000457870  W....RTSNF.....SLMT..............................................................
ENSP00000280190  W....DTREG.....TCVD..............................................................
ENSP00000422763  W....DTREG.....TCVD..............................................................
ENSP00000422200  W....DTREG.....TCVD..............................................................
ENSP00000384792  I....DFYSG.....ECIA..............................................................
ENSP00000481995  W....ALPQC.....QLLG..............................................................
ENSP00000384939  YvvseNGRKY.....SRYG..............................................................
ENSP00000385059  YvvseNGRKY.....SRYG..............................................................
ENSP00000450541  Y....KISSG.....SQGAqgqaldvavsalawlspkvlvsgaedgslqgwalkecslqslwllsrfqkpvlglatsqell
ENSP00000320663  YvvseNGRKY.....SRYG..............................................................
ENSP00000448161  W....NVSNG.....ELLH..............................................................
ENSP00000270301  I....DFYSG.....ECIA..............................................................
ENSP00000426154  F....DFSSG.....ECVA..............................................................
ENSP00000423760  L....DLLG-.....----..............................................................
ENSP00000473564  L....DLLG-.....----..............................................................
ENSP00000205214  L....DLL--.....----..............................................................
ENSP00000327384  F....DTETK.....DLVT..............................................................
ENSP00000334314  F....DTETK.....DLVT..............................................................
ENSP00000262233  F....DTETK.....DLVT..............................................................
ENSP00000371889  Y....SILGT.....TLKD..............................................................
ENSP00000426725  Y....SILGT.....TLKD..............................................................
ENSP00000348842  L....RVRDM.....TEVV..............................................................
ENSP00000245925  Y....TVDQGgrkv.SRLG..............................................................
ENSP00000414851  W....KKQDTispefEPVF..............................................................
ENSP00000442365  Y....TVDQGgrkv.SRLG..............................................................
ENSP00000447548  W....DLQAR.....KWKF..............................................................
ENSP00000464789  Y....TVDQGgrkv.SRLG..............................................................
ENSP00000451998  F....RYPTK.....GKFG..............................................................
ENSP00000370039  F....RYPTK.....GKFG..............................................................
ENSP00000361570  M....KYPLPlq...KEFN..............................................................
ENSP00000468312  L....DTETH.....DLVA..............................................................
ENSP00000285873  W....DALRE.....EPLC..............................................................
ENSP00000378254  Y....SVSSDgaks.SRFG..............................................................
ENSP00000278845  Y....SVSSDgaks.SRFG..............................................................
ENSP00000293879  F....SVSRT.....AMEL..............................................................
ENSP00000435310  M....KYPLPlq...KEFN..............................................................
ENSP00000448122  F....SVSRT.....AMEL..............................................................
ENSP00000348842  W....DAMTK.....HTLS..............................................................
ENSP00000314193  W....DSVTW.....ELKC..............................................................
ENSP00000447224  W....DLQAR.....KWKF..............................................................
ENSP00000447224  Fla..DSRGF.....RRFM..............................................................
ENSP00000293879  W....DTRAG.....RCFL..............................................................
ENSP00000254442  W....QMDTG.....A---..............................................................
ENSP00000350187  W....QMDTG.....A---..............................................................
ENSP00000416289  F....DASLT.....GTPA..............................................................
ENSP00000389144  -....-----.....----..............................................................
ENSP00000310686  -....-----.....----..............................................................
ENSP00000288912  Yml..VVRNG.....QRVW..............................................................
ENSP00000452765  L....HLEGK.....SCLL..............................................................
ENSP00000456709  Y....NVKQL.....KLHC..............................................................
ENSP00000453378  L....HLEGK.....SCLL..............................................................
ENSP00000396295  W....DARTG.....RLLT..............................................................
ENSP00000370039  W....DIADK.....KMLN..............................................................
ENSP00000451998  W....DIADK.....KMLN..............................................................
ENSP00000464109  -....-----.....----..............................................................
ENSP00000458843  Y....NVKQL.....KLHC..............................................................
ENSP00000484308  W....DF---.....----..............................................................
ENSP00000368025  W....DF---.....----..............................................................
ENSP00000260643  Y....IAFSL.....QCLY..............................................................
ENSP00000440796  Y....STTSY.....KVVH..............................................................
ENSP00000335522  W....DVR--.....----..............................................................
ENSP00000462737  -....-----.....----..............................................................
ENSP00000445814  Y....DYNSG.....EELE..............................................................
ENSP00000464095  -....-----.....----..............................................................
ENSP00000401445  -....-----.....----..............................................................
ENSP00000307235  -....-----.....----..............................................................
ENSP00000256797  -....-----.....----..............................................................
ENSP00000413812  -....-----.....----..............................................................
ENSP00000370348  W....-----.....----..............................................................
ENSP00000394097  W....-----.....----..............................................................
ENSP00000442365  F....SYPCCqpr..ALSH..............................................................
ENSP00000378254  F....QYPCArak..APSR..............................................................
ENSP00000433417  F....QYPCArak..APSR..............................................................
ENSP00000278845  F....QYPCArak..APSR..............................................................
ENSP00000364345  -....-----.....----..............................................................
ENSP00000420608  -....-----.....----..............................................................
ENSP00000466100  -....-----.....----..............................................................
ENSP00000217964  W....-----.....----..............................................................
ENSP00000385988  W....-----.....----..............................................................
ENSP00000471331  -....-----.....----..............................................................
ENSP00000301678  -....-----.....----..............................................................
ENSP00000382814  -....-----.....----..............................................................
ENSP00000301679  -....-----.....----..............................................................
ENSP00000483191  F....DV---.....----..............................................................
ENSP00000197268  -....-----.....----..............................................................
ENSP00000394063  -....-----.....----..............................................................
ENSP00000412076  -....-----.....----..............................................................
ENSP00000409656  -....-----.....----..............................................................
ENSP00000421171  -....-----.....----..............................................................
ENSP00000398526  -....-----.....----..............................................................
ENSP00000317469  -....-----.....----..............................................................
ENSP00000465994  -....-----.....----..............................................................
ENSP00000364354  -....-----.....----..............................................................
ENSP00000408325  -....-----.....----..............................................................
ENSP00000457361  -....-----.....----..............................................................
ENSP00000405764  -....-----.....----..............................................................
ENSP00000399150  -....-----.....----..............................................................
ENSP00000398433  -....-----.....----..............................................................
ENSP00000407669  -....-----.....----..............................................................
ENSP00000451998  -....-----.....----..............................................................
ENSP00000432762  -....-----.....----..............................................................
ENSP00000433942  -....-----.....----..............................................................
ENSP00000482352  -....-----.....----..............................................................
ENSP00000403323  -....-----.....----..............................................................
ENSP00000477741  -....-----.....----..............................................................
ENSP00000355464  -....-----.....----..............................................................
ENSP00000355465  -....-----.....----..............................................................


                                               500                   510                            
                                                 |                     |                            
d1g72a_            ..............................NF........K..MPSGG..IGSP...........................
ENSP00000355148  ..............................SL........K..-GHND..WVMD...........................
ENSP00000348129  ..............................SL........K..-GHND..WVMD...........................
ENSP00000482107  ..............................VL........S..-GHEG..PISG...........................
ENSP00000291576  ..............................VL........S..-GHEG..PISG...........................
ENSP00000339449  ..............................VG........-..VGHSG..NITR...........................
ENSP00000331815  ..............................TF........E..-GHDA..SVLK...........................
ENSP00000371888  ..............................ELsiksgnpgE..-SSRG..WMWG...........................
ENSP00000380313  ..............................ELsiksgnpgE..-SSRG..WMWG...........................
ENSP00000455046  ..............................ELsiksgnpgE..-SSRG..WMWG...........................
ENSP00000456405  ..............................ELsiksgnpgE..-SSRG..WMWG...........................
ENSP00000457870  ..............................ELsiksgnpgE..-SSRG..WMWG...........................
ENSP00000280190  ..............................TV........-..YDHGA..DVYG...........................
ENSP00000422763  ..............................TV........-..YDHGA..DVYG...........................
ENSP00000422200  ..............................TV........-..YDHGA..DVYG...........................
ENSP00000384792  ..............................KM........-..FGHSE..IITS...........................
ENSP00000481995  ..............................VF........S..-GHRV..ASGAssslpwtrcwprpqlmapsssghsrts
ENSP00000384939  ..............................RC........-..TGHSS..YITH...........................
ENSP00000385059  ..............................RC........-..TGHSS..YITH...........................
ENSP00000450541  asasedftvqlwprqlltrphkaedfpcgtEL........R..-GHEG..PVSC...........................
ENSP00000320663  ..............................RC........-..TGHSS..YITH...........................
ENSP00000448161  ..............................LCaplse...EgaATHGG..WVTD...........................
ENSP00000270301  ..............................KM........-..FGHSE..IITS...........................
ENSP00000426154  ..............................TM........-..FGHSE..IVTG...........................
ENSP00000423760  ..............................--........-..-----..----...........................
ENSP00000473564  ..............................--........-..-----..----...........................
ENSP00000205214  ..............................--........-..-----..----...........................
ENSP00000327384  ..............................VH........-..TDGNE..QLSV...........................
ENSP00000334314  ..............................VH........-..TDGNE..QLSV...........................
ENSP00000262233  ..............................VH........-..TDGNE..QLSV...........................
ENSP00000371889  ..............................EG........Kl.LEAKG..PVTD...........................
ENSP00000426725  ..............................EG........Kl.LEAKG..PVTD...........................
ENSP00000348842  ..............................HI........K..-DRKE..VIHE...........................
ENSP00000245925  ..............................KC........S..-GHSS..FITH...........................
ENSP00000414851  ..............................SLfaftnkitS..-VHSR..IIWS...........................
ENSP00000442365  ..............................KC........S..-GHSS..FITH...........................
ENSP00000447548  ..............................EM........S..YTSSYcrGVQC...........................
ENSP00000464789  ..............................KC........S..-GHSS..FITH...........................
ENSP00000451998  ..............................KF........KryVAHST..HVTN...........................
ENSP00000370039  ..............................KF........KryVAHST..HVTN...........................
ENSP00000361570  ..............................EY........Q..-AHAG..PITK...........................
ENSP00000468312  ..............................IH........-..TDGNE..QISV...........................
ENSP00000285873  ..............................NF........R..-GHRG..RLLC...........................
ENSP00000378254  ..............................RC........-..MGHSS..FITH...........................
ENSP00000278845  ..............................RC........-..MGHSS..FITH...........................
ENSP00000293879  ..............................KM........-..HPHPV..ALTT...........................
ENSP00000435310  ..............................EY........Q..-----..----...........................
ENSP00000448122  ..............................KM........-..HPHPV..ALTT...........................
ENSP00000348842  ..............................ML........R..CFHSK..GVNY...........................
ENSP00000314193  ..............................TF........-..CQRAG..KIRH...........................
ENSP00000447224  ..............................EM........S..YTSSYcrGVQC...........................
ENSP00000447224  ..............................AM........D..LEHED..MVET...........................
ENSP00000293879  ..............................SW........E..-ADDG..GIGL...........................
ENSP00000254442  ..............................--........-..-----..----...........................
ENSP00000350187  ..............................--........-..-----..----...........................
ENSP00000416289  ..............................VF........S..-GHDG..AVNA...........................
ENSP00000389144  ..............................--........-..-----..----...........................
ENSP00000310686  ..............................--........-..-----..----...........................
ENSP00000288912  ..............................EYlarl....R..-SHRK..SIRS...........................
ENSP00000452765  ..............................HA........R..-KHLF..PVRM...........................
ENSP00000456709  ..............................TV........P..-AYNF..PVTA...........................
ENSP00000453378  ..............................HA........R..-KHLF..PVRM...........................
ENSP00000396295  ..............................DY........R..-GHTA..EILD...........................
ENSP00000370039  ..............................KV........N..LGH--..AART...........................
ENSP00000451998  ..............................KV........N..LGH--..AART...........................
ENSP00000464109  ..............................--........-..-----..----...........................
ENSP00000458843  ..............................TV........P..-AYNF..PVTA...........................
ENSP00000484308  ..............................--........-..-----..----...........................
ENSP00000368025  ..............................--........-..-----..----...........................
ENSP00000260643  ..............................YV........R..EAHGI..VVTD...........................
ENSP00000440796  ..............................SF........-..-DYAA..SILS...........................
ENSP00000335522  ..............................--........-..-----..----...........................
ENSP00000462737  ..............................--........-..-----..----...........................
ENSP00000445814  ..............................SY........K..-GHFG..PIHC...........................
ENSP00000464095  ..............................--........-..-----..----...........................
ENSP00000401445  ..............................--........-..-----..----...........................
ENSP00000307235  ..............................--........-..-----..----...........................
ENSP00000256797  ..............................--........-..-----..----...........................
ENSP00000413812  ..............................--........-..-----..----...........................
ENSP00000370348  ..............................--........-..-----..----...........................
ENSP00000394097  ..............................--........-..-----..----...........................
ENSP00000442365  ..............................KY........-..GGHSS..HVTN...........................
ENSP00000378254  ..............................MY........-..GGHGS..HVTS...........................
ENSP00000433417  ..............................MY........-..GGHGS..HVTS...........................
ENSP00000278845  ..............................MY........-..GGHGS..HVTS...........................
ENSP00000364345  ..............................--........-..-----..----...........................
ENSP00000420608  ..............................--........-..-----..----...........................
ENSP00000466100  ..............................--........-..-----..----...........................
ENSP00000217964  ..............................--........-..-----..----...........................
ENSP00000385988  ..............................--........-..-----..----...........................
ENSP00000471331  ..............................--........-..-----..----...........................
ENSP00000301678  ..............................--........-..-----..----...........................
ENSP00000382814  ..............................--........-..-----..----...........................
ENSP00000301679  ..............................--........-..-----..----...........................
ENSP00000483191  ..............................--........-..-----..----...........................
ENSP00000197268  ..............................--........-..-----..----...........................
ENSP00000394063  ..............................--........-..-----..----...........................
ENSP00000412076  ..............................--........-..-----..----...........................
ENSP00000409656  ..............................--........-..-----..----...........................
ENSP00000421171  ..............................--........-..-----..----...........................
ENSP00000398526  ..............................--........-..-----..----...........................
ENSP00000317469  ..............................--........-..-----..----...........................
ENSP00000465994  ..............................--........-..-----..----...........................
ENSP00000364354  ..............................--........-..-----..----...........................
ENSP00000408325  ..............................--........-..-----..----...........................
ENSP00000457361  ..............................--........-..-----..----...........................
ENSP00000405764  ..............................--........-..-----..----...........................
ENSP00000399150  ..............................--........-..-----..----...........................
ENSP00000398433  ..............................--........-..-----..----...........................
ENSP00000407669  ..............................--........-..-----..----...........................
ENSP00000451998  ..............................--........-..-----..----...........................
ENSP00000432762  ..............................--........-..-----..----...........................
ENSP00000433942  ..............................--........-..-----..----...........................
ENSP00000482352  ..............................--........-..-----..----...........................
ENSP00000403323  ..............................--........-..-----..----...........................
ENSP00000477741  ..............................--........-..-----..----...........................
ENSP00000355464  ..............................--........-..-----..----...........................
ENSP00000355465  ..............................--........-..-----..----...........................


                                             520        530       540        550       560         5
                                               |          |         |          |         |          
d1g72a_            ..............MTY....SF..KGKQYIG.SMYGVGGWPGVGLVFDLT.DPS----------------------..--
ENSP00000355148  ..............VAI....SN..NKKWILS.ASKD-----RTMRLWNIE.EID----------------------..--
ENSP00000348129  ..............VAI....SN..NKKWILS.ASKD-----RTMRLWNIE.EID----------------------..--
ENSP00000482107  ..............LCF....NP..MKSVLAS.ASWD-----KTVRLWDMFdSWR----------T-----------..--
ENSP00000291576  ..............LCF....NP..MKSVLAS.ASWD-----KTVRLWDMFdSWR----------T-----------..--
ENSP00000339449  ..............IRI....SP..GNQYIVS.VSAD-----GAILRWKY-.-------------------------..--
ENSP00000331815  ..............VAF....VS..RGTQLLS.SGSD-----GLVKLWTIK.NNE----------CVRTLDAHEDK-..--
ENSP00000371888  ..............CAF....SG..DSQYIVT.ASSD-----NLARLWCVE.TGE----------IKREYGGHQKAVvcL-
ENSP00000380313  ..............CAF....SG..DSQYIVT.ASSD-----NLARLWCVE.TGE----------IKREYGGHQKAVvcL-
ENSP00000455046  ..............CAF....SG..DSQYIVT.ASSD-----NLARLWCVE.TGE----------IKREYGGHQKAVvcL-
ENSP00000456405  ..............CAF....SG..DSQYIVT.ASSD-----NLARLWCVE.TGE----------IKREYGGHQKAVvcL-
ENSP00000457870  ..............CAF....SG..DSQYIVT.ASSD-----NLARLWCVE.TGE----------IKREYGGHQKAVvcL-
ENSP00000280190  ..............LTC....HPs.RPFTMAS.CSRD-----STVRLWSL-.-------------------------..--
ENSP00000422763  ..............LTC....HPs.RPFTMAS.CSRD-----STVRLWSL-.-------------------------..--
ENSP00000422200  ..............LTC....HPs.RPFTMAS.CSRD-----STVRLWSL-.-------------------------..--
ENSP00000384792  ..............MKF....TY..DCHHLIT.VSGD-----SCVFIWHL-.-------------------------..--
ENSP00000481995  avsrhlrgtmlclkVAF....VS..RGTQLLS.SGSD-----GLVKLWTIK.NNE----------CVRTLDAHEDK-..--
ENSP00000384939  ..............LDW....SP..DNKYIMS.NSGD-----YEILYWDIP.NGC----------------------..--
ENSP00000385059  ..............LDW....SP..DNKYIMS.NSGD-----YEILYWDIP.NGC----------------------..--
ENSP00000450541  ..............CSF....ST..DGGSLAT.GGRD-----RSLLCWDVR.TPK----------------------..--
ENSP00000320663  ..............LDW....SP..DNKYIMS.NSGD-----YEILYWDIP.NGC----------------------..--
ENSP00000448161  ..............LCF....SP..DGKMLIS.AG-------GYIKWWNVV.TGE----------------------..--
ENSP00000270301  ..............MKF....TY..DCHHLIT.VSGD-----SCVFIWHL-.-------------------------..--
ENSP00000426154  ..............MKF....SN..DCKHLIS.VSGD-----SCIFVWRLS.-------------------------..--
ENSP00000423760  ..............---....--..-------.------------------.-------------------------..--
ENSP00000473564  ..............---....--..-------.------------------.-------------------------..--
ENSP00000205214  ..............---....--..-------.------------------.-------------------------..--
ENSP00000327384  ..............MRY....SP..DGNFLAI.GSHD-----NCIYIYGVS.DNGRKYT------RVGKCSGHSSFIthLD
ENSP00000334314  ..............MRY....SP..DGNFLAI.GSHD-----NCIYIYGVS.DNGRKYT------RVGKCSGHSSFIthLD
ENSP00000262233  ..............MRY....SP..DGNFLAI.GSHD-----NCIYIYGVS.DNGRKYT------RVGKCSGHSSFIthLD
ENSP00000371889  ..............VAY....SH..DGAFLAV.CDAS-----KVVTVFSVA.DGY----------------------..--
ENSP00000426725  ..............VAY....SH..DGAFLAV.CDAS-----KVVTVFSVA.DGY----------------------..--
ENSP00000348842  ..............MKF....SP..DGSYLAV.GSND--------------.-------------------------..--
ENSP00000245925  ..............LDW....AQ..DSSCFVT.NSGD-----YEILYWDPA.TCK----------------------..--
ENSP00000414851  ..............CDW....SP..DSKYFFT.GSRD-----KKVVVWG--.-------------------------..--
ENSP00000442365  ..............LDW....AQ..DSSCFVT.NSGD-----YEILYWDPA.TCK----------------------..--
ENSP00000447548  ..............ACF....SK..DDKYVYV.GLKD-----RSILVWSVL.DGT----------------------..--
ENSP00000464789  ..............LDW....AQ..DSSCFVT.NSGD-----YEILYWDPA.TCK----------------------..--
ENSP00000451998  ..............VRW....TY..DDSMLVTlGGTD-----MSLMVW---.-------------------------..--
ENSP00000370039  ..............VRW....TY..DDSMLVTlGGTD-----MSLMVW---.-------------------------..--
ENSP00000361570  ..............MLL....TF..DDQFLLT.AAED-----GCLFTWKVF.DKD----------------------..--
ENSP00000468312  ..............VSF....SP..DGAYLAV.GSHD-----NLVYVYTVD.Q------------------------..--
ENSP00000285873  ..............VAW....SPl.DPDCIYS.GADD--------------.-------------------------..--
ENSP00000378254  ..............LDW....SK..DGNFIMS.NSGD-----YEILYWDVA.GGC----------------------..--
ENSP00000278845  ..............LDW....SK..DGNFIMS.NSGD-----YEILYWDVA.GGC----------------------..--
ENSP00000293879  ..............VAF....ST..DGQTVLS.GDKD-----GLVAVSHPC.TGT----------TFRVLSDHQG--..--
ENSP00000435310  ..............---....--..-------.------------------.-------------------------..--
ENSP00000448122  ..............VAF....ST..DGQTVLS.GDKD-----GLVAVSHPC.TGT----------------------..--
ENSP00000348842  ..............INF....SA..TGKLLVS.VGVDPE---HTITVWRWQ.EGA----------KVASRGGHLERI..--
ENSP00000314193  ..............LCF....GRltCSKYLLG.ATEN-----GILCCWNLL.SCA----------------------..--
ENSP00000447224  ..............ACF....SK..DDKYVYV.GLKD-----RSILVWSVL.DGT----------------------..--
ENSP00000447224  ..............AVF....GT..ENNLIIT.GSLD-----ALIQVWSLS.E------------------------..--
ENSP00000293879  ..............LLF....--..SGSRLVS.GSST-----GRLRLWA--.-------------------------..--
ENSP00000254442  ..............---....--..-------.------------------.-------------------------..--
ENSP00000350187  ..............---....--..-------.------------------.-------------------------..--
ENSP00000416289  ..............VCW....SQ..DRRWLLS.AARD-----GTLRMWSAR.GAE----------------------..--
ENSP00000389144  ..............---....--..-------.------------------.-------------------------..--
ENSP00000310686  ..............---....--..-------.------------------.-------------------------..--
ENSP00000288912  ..............LLFgvylDS..NEPRLLS.LGTD--------------.-------------------------..--
ENSP00000452765  ..............IKW....HP..VENFLIV.GCAD-----DSVYIWEIE.TGT----------------------..--
ENSP00000456709  ..............MAI....AP..NTNNLVI.AHSD-----QQVFEYSIP.DKQ----------------------..--
ENSP00000453378  ..............IKW....HP..VENFLIV.GCAD-----DSVYIWEIE.TGT----------------------..--
ENSP00000396295  ..............FAL....SK..DASLVVT.TSGD-----HKAKVFCVQ.RPD----------------------..--
ENSP00000370039  ..............VCY....SP..EGDMVAI.GMKN-----G--------.-------------------------..--
ENSP00000451998  ..............VCY....SP..EGDMVAI.GMKN-----G--------.-------------------------..--
ENSP00000464109  ..............---....--..-------.------------------.-------------------------..--
ENSP00000458843  ..............MAI....AP..NTNNLVI.AHSD-----QQVFEYSIP.DKQ----------------------..--
ENSP00000484308  ..............---....--..-------.------------------.-------------------------..--
ENSP00000368025  ..............---....--..-------.------------------.-------------------------..--
ENSP00000260643  ..............VAF....LP..-------.------------------.-------------------------..--
ENSP00000440796  ..............LAL....AH..EDETIVV.GMTN-----G--------.-------------------------..--
ENSP00000335522  ..............---....--..-------.------------------.-------------------------..--
ENSP00000462737  ..............---....--..-------.------------------.-------------------------..--
ENSP00000445814  ..............VRF....SP..DGELYAS.GSED-----GTLRLWQTV.VGK----------------------..--
ENSP00000464095  ..............---....--..-------.------------------.-------------------------..--
ENSP00000401445  ..............---....--..-------.------------------.-------------------------..--
ENSP00000307235  ..............---....--..-------.------------------.-------------------------..--
ENSP00000256797  ..............---....--..-------.------------------.-------------------------..--
ENSP00000413812  ..............---....--..-------.------------------.-------------------------..--
ENSP00000370348  ..............---....--..-------.------------------.-------------------------..--
ENSP00000394097  ..............---....--..-------.------------------.-------------------------..--
ENSP00000442365  ..............VAF....LW..DDSMALTtGGKD-----TSVLQWR--.-------------------------..--
ENSP00000378254  ..............VRF....TH..DDSHLVSlGGKD-----ASIFQWR--.-------------------------..--
ENSP00000433417  ..............VRF....TH..DDSHLVSlGGKD-----ASIFQWR--.-------------------------..--
ENSP00000278845  ..............VRF....TH..DDSHLVSlGGKD-----ASIFQWR--.-------------------------..--
ENSP00000364345  ..............---....--..-------.------------------.-------------------------..--
ENSP00000420608  ..............---....--..-------.------------------.-------------------------..--
ENSP00000466100  ..............---....--..-------.------------------.-------------------------..--
ENSP00000217964  ..............---....--..-------.------------------.-------------------------..--
ENSP00000385988  ..............---....--..-------.------------------.-------------------------..--
ENSP00000471331  ..............---....--..-------.------------------.-------------------------..--
ENSP00000301678  ..............---....--..-------.------------------.-------------------------..--
ENSP00000382814  ..............---....--..-------.------------------.-------------------------..--
ENSP00000301679  ..............---....--..-------.------------------.-------------------------..--
ENSP00000483191  ..............---....--..-------.------------------.-------------------------..--
ENSP00000197268  ..............---....--..-------.------------------.-------------------------..--
ENSP00000394063  ..............---....--..-------.------------------.-------------------------..--
ENSP00000412076  ..............---....--..-------.------------------.-------------------------..--
ENSP00000409656  ..............---....--..-------.------------------.-------------------------..--
ENSP00000421171  ..............---....--..-------.------------------.-------------------------..--
ENSP00000398526  ..............---....--..-------.------------------.-------------------------..--
ENSP00000317469  ..............---....--..-------.------------------.-------------------------..--
ENSP00000465994  ..............---....--..-------.------------------.-------------------------..--
ENSP00000364354  ..............---....--..-------.------------------.-------------------------..--
ENSP00000408325  ..............---....--..-------.------------------.-------------------------..--
ENSP00000457361  ..............---....--..-------.------------------.-------------------------..--
ENSP00000405764  ..............---....--..-------.------------------.-------------------------..--
ENSP00000399150  ..............---....--..-------.------------------.-------------------------..--
ENSP00000398433  ..............---....--..-------.------------------.-------------------------..--
ENSP00000407669  ..............---....--..-------.------------------.-------------------------..--
ENSP00000451998  ..............---....--..-------.------------------.-------------------------..--
ENSP00000432762  ..............---....--..-------.------------------.-------------------------..--
ENSP00000433942  ..............---....--..-------.------------------.-------------------------..--
ENSP00000482352  ..............---....--..-------.------------------.-------------------------..--
ENSP00000403323  ..............---....--..-------.------------------.-------------------------..--
ENSP00000477741  ..............---....--..-------.------------------.-------------------------..--
ENSP00000355464  ..............---....--..-------.------------------.-------------------------..--
ENSP00000355465  ..............---....--..-------.------------------.-------------------------..--


                   70                                                                               
                    |                                                                               
d1g72a_            ---aglgavgafrelqnhtqmggglmvfsl...................................................
ENSP00000355148  ---..............................................................................
ENSP00000348129  ---..............................................................................
ENSP00000482107  ---ketlaltsdalavtfrpdgaelavatlnsqitfwdpenavqtgsiegrhdlktgrkeldkitakhaakgkaftalcys
ENSP00000291576  ---ketlaltsdalavtfrpdgaelavatlnsqitfwdpenavqtgsiegrhdlktgrkeldkitakhaakgkaftalcys
ENSP00000339449  ---p.............................................................................
ENSP00000331815  ---v.............................................................................
ENSP00000371888  ---af............................................................................
ENSP00000380313  ---af............................................................................
ENSP00000455046  ---af............................................................................
ENSP00000456405  ---af............................................................................
ENSP00000457870  ---af............................................................................
ENSP00000280190  ---t.............................................................................
ENSP00000422763  ---t.............................................................................
ENSP00000422200  ---t.............................................................................
ENSP00000384792  ---g.............................................................................
ENSP00000481995  ---v.............................................................................
ENSP00000384939  ---k.............................................................................
ENSP00000385059  ---k.............................................................................
ENSP00000450541  ---..............................................................................
ENSP00000320663  ---k.............................................................................
ENSP00000448161  ---ssqt..........................................................................
ENSP00000270301  ---gp............................................................................
ENSP00000426154  ---se............................................................................
ENSP00000423760  ---gn............................................................................
ENSP00000473564  ---gn............................................................................
ENSP00000205214  ---gg............................................................................
ENSP00000327384  WS-..............................................................................
ENSP00000334314  WS-..............................................................................
ENSP00000262233  WS-..............................................................................
ENSP00000371889  ---..............................................................................
ENSP00000426725  ---..............................................................................
ENSP00000348842  ---gpvdvy........................................................................
ENSP00000245925  ---..............................................................................
ENSP00000414851  ---ec............................................................................
ENSP00000442365  ---..............................................................................
ENSP00000447548  ---..............................................................................
ENSP00000464789  ---..............................................................................
ENSP00000451998  ---t.............................................................................
ENSP00000370039  ---t.............................................................................
ENSP00000361570  ---..............................................................................
ENSP00000468312  ---g.............................................................................
ENSP00000285873  ---fcvhkwlt......................................................................
ENSP00000378254  ---..............................................................................
ENSP00000278845  ---..............................................................................
ENSP00000293879  ---apisticvtckecedlgvegtdlwlaasgdqrvsvwasdwlrnhcelvdwlsfpmpattetqghlppslaafcpwdga
ENSP00000435310  ---ahagpi........................................................................
ENSP00000448122  ---..............................................................................
ENSP00000348842  ---fvvefrpdsdtqfvsv..............................................................
ENSP00000314193  ---lewnaklnvrv...................................................................
ENSP00000447224  ---lltvq.........................................................................
ENSP00000447224  ---qgtl..........................................................................
ENSP00000293879  ---vg............................................................................
ENSP00000254442  ---l.............................................................................
ENSP00000350187  ---l.............................................................................
ENSP00000416289  ---..............................................................................
ENSP00000389144  ---hs............................................................................
ENSP00000310686  ---hs............................................................................
ENSP00000288912  ---rllieydl......................................................................
ENSP00000452765  ---lerhetger.....................................................................
ENSP00000456709  ---ytdwsrtvq.....................................................................
ENSP00000453378  ---lerhe.........................................................................
ENSP00000396295  ---..............................................................................
ENSP00000370039  ---efiillvsslk...................................................................
ENSP00000451998  ---efiillvsslk...................................................................
ENSP00000464109  ---..............................................................................
ENSP00000458843  ---..............................................................................
ENSP00000484308  ---h.............................................................................
ENSP00000368025  ---h.............................................................................
ENSP00000260643  ---e.............................................................................
ENSP00000440796  ---ilsv..........................................................................
ENSP00000335522  ---..............................................................................
ENSP00000462737  ---..............................................................................
ENSP00000445814  ---..............................................................................
ENSP00000464095  ---fs............................................................................
ENSP00000401445  ---yasp..........................................................................
ENSP00000307235  ---vipis.........................................................................
ENSP00000256797  ---l.............................................................................
ENSP00000413812  ---l.............................................................................
ENSP00000370348  ---te............................................................................
ENSP00000394097  ---te............................................................................
ENSP00000442365  ---v.............................................................................
ENSP00000378254  ---v.............................................................................
ENSP00000433417  ---v.............................................................................
ENSP00000278845  ---v.............................................................................
ENSP00000364345  ---rv............................................................................
ENSP00000420608  ---vstpwlqhlsga..................................................................
ENSP00000466100  ---..............................................................................
ENSP00000217964  ---..............................................................................
ENSP00000385988  ---..............................................................................
ENSP00000471331  ---lps...........................................................................
ENSP00000301678  ---lps...........................................................................
ENSP00000382814  ---lps...........................................................................
ENSP00000301679  ---lps...........................................................................
ENSP00000483191  ---e.............................................................................
ENSP00000197268  ---hmketpatsavtsdqk..............................................................
ENSP00000394063  ---hmketpatsavtsdqk..............................................................
ENSP00000412076  ---vipis.........................................................................
ENSP00000409656  ---..............................................................................
ENSP00000421171  ---..............................................................................
ENSP00000398526  ---dntlimttrggg..................................................................
ENSP00000317469  ---dntlimttrggg..................................................................
ENSP00000465994  ---gpfqf.........................................................................
ENSP00000364354  ---rvst..........................................................................
ENSP00000408325  ---vipis.........................................................................
ENSP00000457361  ---t.............................................................................
ENSP00000405764  ---mttrggg.......................................................................
ENSP00000399150  ---nasilspllqvpdvdgdgapdllvlt....................................................
ENSP00000398433  ---nasilspllqvpdvdgdgapdllvl.....................................................
ENSP00000407669  ---nasilspllqvpdvdgdgapdllvltqer.................................................
ENSP00000451998  ---ikraalapgskgllledn............................................................
ENSP00000432762  ---vpvpaprsihkssqdg..............................................................
ENSP00000433942  ---vpvpaprsihkssqdg..............................................................
ENSP00000482352  ---vpvpaprsihkssqdg..............................................................
ENSP00000403323  ---vpvpaprsihkssqdg..............................................................
ENSP00000477741  ---vpvpaprsihkssqdg..............................................................
ENSP00000355464  ---..............................................................................
ENSP00000355465  ---..............................................................................


                                                                                                    
                                                                                                    
d1g72a_            .................................................................................
ENSP00000355148  .................................................................................
ENSP00000348129  .................................................................................
ENSP00000482107  adghsilaggmskfvciyhvreqilmkrfeiscnlsl............................................
ENSP00000291576  adghsilaggmskfvciyhvreqilmkrfeiscnlsl............................................
ENSP00000339449  .................................................................................
ENSP00000331815  .................................................................................
ENSP00000371888  .................................................................................
ENSP00000380313  .................................................................................
ENSP00000455046  .................................................................................
ENSP00000456405  .................................................................................
ENSP00000457870  .................................................................................
ENSP00000280190  .................................................................................
ENSP00000422763  .................................................................................
ENSP00000422200  .................................................................................
ENSP00000384792  .................................................................................
ENSP00000481995  .................................................................................
ENSP00000384939  .................................................................................
ENSP00000385059  .................................................................................
ENSP00000450541  .................................................................................
ENSP00000320663  .................................................................................
ENSP00000448161  .................................................................................
ENSP00000270301  .................................................................................
ENSP00000426154  .................................................................................
ENSP00000423760  .................................................................................
ENSP00000473564  .................................................................................
ENSP00000205214  .................................................................................
ENSP00000327384  .................................................................................
ENSP00000334314  .................................................................................
ENSP00000262233  .................................................................................
ENSP00000371889  .................................................................................
ENSP00000426725  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000245925  .................................................................................
ENSP00000414851  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000447548  .................................................................................
ENSP00000464789  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000361570  .................................................................................
ENSP00000468312  .................................................................................
ENSP00000285873  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000293879  llmyvgpgvykeviiynlcqkqvvekiplpffamslslspgthllavgfaecmlrlvdcamgtaqdfaghdnavhlcrftp
ENSP00000435310  .................................................................................
ENSP00000448122  .................................................................................
ENSP00000348842  .................................................................................
ENSP00000314193  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000447224  .................................................................................
ENSP00000293879  .................................................................................
ENSP00000254442  .................................................................................
ENSP00000350187  .................................................................................
ENSP00000416289  .................................................................................
ENSP00000389144  .................................................................................
ENSP00000310686  .................................................................................
ENSP00000288912  .................................................................................
ENSP00000452765  .................................................................................
ENSP00000456709  .................................................................................
ENSP00000453378  .................................................................................
ENSP00000396295  .................................................................................
ENSP00000370039  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000464109  .................................................................................
ENSP00000458843  .................................................................................
ENSP00000484308  .................................................................................
ENSP00000368025  .................................................................................
ENSP00000260643  .................................................................................
ENSP00000440796  .................................................................................
ENSP00000335522  .................................................................................
ENSP00000462737  .................................................................................
ENSP00000445814  .................................................................................
ENSP00000464095  .................................................................................
ENSP00000401445  .................................................................................
ENSP00000307235  .................................................................................
ENSP00000256797  .................................................................................
ENSP00000413812  .................................................................................
ENSP00000370348  .................................................................................
ENSP00000394097  .................................................................................
ENSP00000442365  .................................................................................
ENSP00000378254  .................................................................................
ENSP00000433417  .................................................................................
ENSP00000278845  .................................................................................
ENSP00000364345  .................................................................................
ENSP00000420608  .................................................................................
ENSP00000466100  .................................................................................
ENSP00000217964  .................................................................................
ENSP00000385988  .................................................................................
ENSP00000471331  .................................................................................
ENSP00000301678  .................................................................................
ENSP00000382814  .................................................................................
ENSP00000301679  .................................................................................
ENSP00000483191  .................................................................................
ENSP00000197268  .................................................................................
ENSP00000394063  .................................................................................
ENSP00000412076  .................................................................................
ENSP00000409656  .................................................................................
ENSP00000421171  .................................................................................
ENSP00000398526  .................................................................................
ENSP00000317469  .................................................................................
ENSP00000465994  .................................................................................
ENSP00000364354  .................................................................................
ENSP00000408325  .................................................................................
ENSP00000457361  .................................................................................
ENSP00000405764  .................................................................................
ENSP00000399150  .................................................................................
ENSP00000398433  .................................................................................
ENSP00000407669  .................................................................................
ENSP00000451998  .................................................................................
ENSP00000432762  .................................................................................
ENSP00000433942  .................................................................................
ENSP00000482352  .................................................................................
ENSP00000403323  .................................................................................
ENSP00000477741  .................................................................................
ENSP00000355464  .................................................................................
ENSP00000355465  .................................................................................


                                      
                                      
d1g72a_            ...................
ENSP00000355148  ...................
ENSP00000348129  ...................
ENSP00000482107  ...................
ENSP00000291576  ...................
ENSP00000339449  ...................
ENSP00000331815  ...................
ENSP00000371888  ...................
ENSP00000380313  ...................
ENSP00000455046  ...................
ENSP00000456405  ...................
ENSP00000457870  ...................
ENSP00000280190  ...................
ENSP00000422763  ...................
ENSP00000422200  ...................
ENSP00000384792  ...................
ENSP00000481995  ...................
ENSP00000384939  ...................
ENSP00000385059  ...................
ENSP00000450541  ...................
ENSP00000320663  ...................
ENSP00000448161  ...................
ENSP00000270301  ...................
ENSP00000426154  ...................
ENSP00000423760  ...................
ENSP00000473564  ...................
ENSP00000205214  ...................
ENSP00000327384  ...................
ENSP00000334314  ...................
ENSP00000262233  ...................
ENSP00000371889  ...................
ENSP00000426725  ...................
ENSP00000348842  ...................
ENSP00000245925  ...................
ENSP00000414851  ...................
ENSP00000442365  ...................
ENSP00000447548  ...................
ENSP00000464789  ...................
ENSP00000451998  ...................
ENSP00000370039  ...................
ENSP00000361570  ...................
ENSP00000468312  ...................
ENSP00000285873  ...................
ENSP00000378254  ...................
ENSP00000278845  ...................
ENSP00000293879  sarllftaarneilvwevp
ENSP00000435310  ...................
ENSP00000448122  ...................
ENSP00000348842  ...................
ENSP00000314193  ...................
ENSP00000447224  ...................
ENSP00000447224  ...................
ENSP00000293879  ...................
ENSP00000254442  ...................
ENSP00000350187  ...................
ENSP00000416289  ...................
ENSP00000389144  ...................
ENSP00000310686  ...................
ENSP00000288912  ...................
ENSP00000452765  ...................
ENSP00000456709  ...................
ENSP00000453378  ...................
ENSP00000396295  ...................
ENSP00000370039  ...................
ENSP00000451998  ...................
ENSP00000464109  ...................
ENSP00000458843  ...................
ENSP00000484308  ...................
ENSP00000368025  ...................
ENSP00000260643  ...................
ENSP00000440796  ...................
ENSP00000335522  ...................
ENSP00000462737  ...................
ENSP00000445814  ...................
ENSP00000464095  ...................
ENSP00000401445  ...................
ENSP00000307235  ...................
ENSP00000256797  ...................
ENSP00000413812  ...................
ENSP00000370348  ...................
ENSP00000394097  ...................
ENSP00000442365  ...................
ENSP00000378254  ...................
ENSP00000433417  ...................
ENSP00000278845  ...................
ENSP00000364345  ...................
ENSP00000420608  ...................
ENSP00000466100  ...................
ENSP00000217964  ...................
ENSP00000385988  ...................
ENSP00000471331  ...................
ENSP00000301678  ...................
ENSP00000382814  ...................
ENSP00000301679  ...................
ENSP00000483191  ...................
ENSP00000197268  ...................
ENSP00000394063  ...................
ENSP00000412076  ...................
ENSP00000409656  ...................
ENSP00000421171  ...................
ENSP00000398526  ...................
ENSP00000317469  ...................
ENSP00000465994  ...................
ENSP00000364354  ...................
ENSP00000408325  ...................
ENSP00000457361  ...................
ENSP00000405764  ...................
ENSP00000399150  ...................
ENSP00000398433  ...................
ENSP00000407669  ...................
ENSP00000451998  ...................
ENSP00000432762  ...................
ENSP00000433942  ...................
ENSP00000482352  ...................
ENSP00000403323  ...................
ENSP00000477741  ...................
ENSP00000355464  ...................
ENSP00000355465  ...................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046933 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes