SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Quinoprotein alcohol dehydrogenase-like alignments in Mus musculus 76_38

These alignments are sequences aligned to the 0046808 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1flga_               kd............................................................................
ENSMUSP00000045812  nnltsaayhkkthllvtgfasgifhlhelpefnlihslsi......................................
ENSMUSP00000065004  vgsdp.........................................................................
ENSMUSP00000136287  vgsdp.........................................................................
ENSMUSP00000122326  g.............................................................................
ENSMUSP00000135805  g.............................................................................
ENSMUSP00000115550  g.............................................................................
ENSMUSP00000117710  g.............................................................................
ENSMUSP00000041880  te............................................................................
ENSMUSP00000107982  te............................................................................
ENSMUSP00000094528  te............................................................................
ENSMUSP00000118325  mflrgrpvtmympkdqvdsysleaka....................................................
ENSMUSP00000116772  ylagc.........................................................................
ENSMUSP00000103825  ylagc.........................................................................
ENSMUSP00000068516  hc............................................................................
ENSMUSP00000048489  ylgc..........................................................................
ENSMUSP00000051080  q.............................................................................
ENSMUSP00000057209  lpt...........................................................................
ENSMUSP00000112491  rselps........................................................................
ENSMUSP00000105486  lpt...........................................................................
ENSMUSP00000069279  l.............................................................................
ENSMUSP00000113792  l.............................................................................
ENSMUSP00000105483  lpt...........................................................................
ENSMUSP00000037654  lpssrlkldwvypltsslsalleealgfssygyrgrdcranlyll.................................
ENSMUSP00000131842  lvsscfggelllwdltqswrrkytlfstsaeghnhsrivfnlcs..................................
ENSMUSP00000093960  ppp...........................................................................
ENSMUSP00000078426  tq............................................................................
ENSMUSP00000124804  atltgchkgit...................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ppggplratltgchkg..............................................................
ENSMUSP00000113309  plsmtwsfgwns..................................................................
ENSMUSP00000029347  kepkhqelvscvgwttaee...........................................................
ENSMUSP00000103442  kepkhqelvscvgwttaee...........................................................
ENSMUSP00000133263  kepkhqelvscvgwttaee...........................................................
ENSMUSP00000072509  prallfght.....................................................................
ENSMUSP00000117710  iyqldhrynefklhaimse...........................................................
ENSMUSP00000126736  gs............................................................................
ENSMUSP00000065643  diiyhtasigilhnvatgtqsfyqehnddilcltvnqhpkfinivatgqvgd..........................
ENSMUSP00000117489  s.............................................................................
ENSMUSP00000119362  gpvd..........................................................................
ENSMUSP00000120285  d.............................................................................
ENSMUSP00000045812  ispvg.........................................................................
ENSMUSP00000124712  mvds..........................................................................
ENSMUSP00000139411  t.............................................................................
ENSMUSP00000074387  neplqkv.......................................................................
ENSMUSP00000071863  deqiiifpsgnhcvkynidqkwqkfiagsdksqgmlal........................................
ENSMUSP00000080592  deqiiifpsgnhcvkynidqkwqkfiagsdksqgmlal........................................
ENSMUSP00000027139  tglmvdprtkalvlngkpghlqfyslqgdkqlynldiiqqeyindegl..............................
ENSMUSP00000085379  dfsneplqkv....................................................................
ENSMUSP00000102413  fgrts.........................................................................
ENSMUSP00000034093  l.............................................................................
ENSMUSP00000001059  grts..........................................................................
ENSMUSP00000110639  fv............................................................................
ENSMUSP00000113418  fv............................................................................
ENSMUSP00000033153  l.............................................................................
ENSMUSP00000107982  g.............................................................................
ENSMUSP00000094528  g.............................................................................
ENSMUSP00000041880  k.............................................................................
ENSMUSP00000124833  avsiqsra......................................................................
ENSMUSP00000112491  k.............................................................................
ENSMUSP00000112447  gk............................................................................
ENSMUSP00000119471  l.............................................................................
ENSMUSP00000051080  he............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  f.............................................................................
ENSMUSP00000107547  f.............................................................................
ENSMUSP00000117676  hvidv.........................................................................
ENSMUSP00000102412  pgsfgrts......................................................................
ENSMUSP00000025649  rvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdlrvellgetsiaecltyldngvvfvgsrlgdsqlvklnvds
ENSMUSP00000102411  fgrts.........................................................................
ENSMUSP00000055321  c.............................................................................
ENSMUSP00000039427  l.............................................................................
ENSMUSP00000102639  r.............................................................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  neqgsyvvametftnlgpivdmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpg
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                         10            20        30 
                                                                          |             |         | 
d1flga_               ...........................................--VTWEDIANDDKTTGDVL....QYGMGTHAQRWS
ENSMUSP00000045812  ...........................................-------------------....------------
ENSMUSP00000065004  ...........................................-------------------....------------
ENSMUSP00000136287  ...........................................-------------------....------------
ENSMUSP00000122326  ...........................................-------------------....------------
ENSMUSP00000135805  ...........................................-------------------....------------
ENSMUSP00000115550  ...........................................-------------------....------------
ENSMUSP00000117710  ...........................................-------------------....------------
ENSMUSP00000041880  ...........................................-------------------....------------
ENSMUSP00000107982  ...........................................-------------------....------------
ENSMUSP00000094528  ...........................................-------------------....------------
ENSMUSP00000118325  ...........................................-------------------....------------
ENSMUSP00000116772  ...........................................-------------------....------------
ENSMUSP00000103825  ...........................................-------------------....------------
ENSMUSP00000068516  ...........................................-------------------....------------
ENSMUSP00000048489  ...........................................-------------------....------------
ENSMUSP00000051080  ...........................................-------------------....------------
ENSMUSP00000057209  ...........................................-------------------....------------
ENSMUSP00000112491  ...........................................-------------------....------------
ENSMUSP00000105486  ...........................................-------------------....------------
ENSMUSP00000069279  ...........................................-------------------....------------
ENSMUSP00000113792  ...........................................-------------------....------------
ENSMUSP00000105483  ...........................................-------------------....------------
ENSMUSP00000037654  ...........................................-------------------....------------
ENSMUSP00000131842  ...........................................-------------------....------------
ENSMUSP00000093960  ...........................................-------------------....------------
ENSMUSP00000078426  ...........................................-------------------....------------
ENSMUSP00000124804  ...........................................-------------------....------------
ENSMUSP00000052465  ...........................................-------------------....------------
ENSMUSP00000125092  ...........................................-------------------....------------
ENSMUSP00000113309  ...........................................-------------------....------------
ENSMUSP00000029347  ...........................................-------------------....------------
ENSMUSP00000103442  ...........................................-------------------....------------
ENSMUSP00000133263  ...........................................-------------------....------------
ENSMUSP00000072509  ...........................................-------------------....------------
ENSMUSP00000117710  ...........................................-------------------....------------
ENSMUSP00000126736  ...........................................-------------------....------------
ENSMUSP00000065643  ...........................................-------------------....------------
ENSMUSP00000117489  ...........................................-------------------....------------
ENSMUSP00000119362  ...........................................-------------------....------------
ENSMUSP00000120285  ...........................................-------------------....------------
ENSMUSP00000045812  ...........................................-------------------....------------
ENSMUSP00000124712  ...........................................-------------------....------------
ENSMUSP00000139411  ...........................................-------------------....------------
ENSMUSP00000074387  ...........................................-------------------....------------
ENSMUSP00000071863  ...........................................-------------------....------------
ENSMUSP00000080592  ...........................................-------------------....------------
ENSMUSP00000027139  ...........................................-------------------....------------
ENSMUSP00000085379  ...........................................-------------------....------------
ENSMUSP00000102413  ...........................................-------------------....------------
ENSMUSP00000034093  ...........................................-------------------....------------
ENSMUSP00000001059  ...........................................-------------------....------------
ENSMUSP00000110639  ...........................................-----VFVLSFIIPCPDRPssqgTWKLDYNNAV--
ENSMUSP00000113418  ...........................................-----VFVLSFIIPCPDRPssqgTWKLDYNNAV--
ENSMUSP00000033153  ...........................................-------------------....------------
ENSMUSP00000107982  ...........................................-------------------....------------
ENSMUSP00000094528  ...........................................-------------------....------------
ENSMUSP00000041880  ...........................................-------------------....------------
ENSMUSP00000124833  ...........................................-------------------....------------
ENSMUSP00000112491  ...........................................-------------------....------------
ENSMUSP00000112447  ...........................................-------------------....------------
ENSMUSP00000119471  ...........................................-------------------....------------
ENSMUSP00000051080  ...........................................-------------------....------------
ENSMUSP00000049034  ...........................................-------------------....------------
ENSMUSP00000137103  ...........................................-------------------....------------
ENSMUSP00000080888  ...........................................-------------------....------------
ENSMUSP00000107546  ...........................................-------------------....------------
ENSMUSP00000107547  ...........................................-------------------....------------
ENSMUSP00000117676  ...........................................-------------------....------------
ENSMUSP00000102412  ...........................................-------------------....------------
ENSMUSP00000025649  retddtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcg-------------------....------------
ENSMUSP00000102411  ...........................................-------------------....------------
ENSMUSP00000055321  ...........................................-------------------....------------
ENSMUSP00000039427  ...........................................-------------------....------------
ENSMUSP00000102639  ...........................................-------------------....------------


                             40        50            60                 70                     80   
                              |         |             |                  |                      |   
d1flga_               PLKQVNADNVFKLTPAWSYSFGDEKQR.G...Q.ESQAIVS........DGV..IYVTASYS...........RLFAL
ENSMUSP00000045812  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000065004  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000136287  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000122326  ---------------------------.-...-.-------........--H..VVCCFLDG...........GVGLY
ENSMUSP00000135805  ---------------------------.-...-.-------........--H..VVCCFLDG...........GVGLY
ENSMUSP00000115550  ---------------------------.-...-.-------........--H..VVCCFLDG...........GVGLY
ENSMUSP00000117710  ---------------------------.-...-.-------........--H..VVCCFLDG...........GVGLY
ENSMUSP00000041880  -------LPPEKLKLEWVYGYRGKDCRaN...V.YLLPT--........GEI..VYFIAS--...........VVVLF
ENSMUSP00000107982  -------LPPEKLKLEWVYGYRGKDCRaN...V.YLLPT--........GEI..VYFIAS--...........VVVLF
ENSMUSP00000094528  -------LPPEKLKLEWVYGYRGKDCRaN...V.YLLPT--........GEI..VYFIAS--...........VVVLF
ENSMUSP00000118325  ------ELPTKRLKLEWVYGYRGRDCR.N...NlYLLPT--........GET..VYFIAS--...........VVVLY
ENSMUSP00000116772  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000103825  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000068516  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000048489  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000051080  ------------LRLEWVYGYRGHQCR.N...NlYYT--AG........KEV..VYFVAGVG...........VVYNT
ENSMUSP00000057209  ----------KRLKLEWVYGYRGRDCR.N...NlYLLPT--........GET..VYFIAS--...........VVVLY
ENSMUSP00000112491  ----------SRLKLDWVYGYRGRDCRaN...L.YLLPT--........GEV..VYFVASVA...........VLYSV
ENSMUSP00000105486  ----------KRLKLEWVYGYRGRDCR.N...NlYLLPT--........GET..VYFIAS--...........VVVLY
ENSMUSP00000069279  -------------RERWRSDTGKCVD-.-...-.-ASPLLVraavqdkpSTT..VYIGSHSH...........TVKAV
ENSMUSP00000113792  -------------RERWRSDTGKCVD-.-...-.-ASPLLVraavqdkpSTT..VYIGSHSH...........TVKAV
ENSMUSP00000105483  ----------KRLKLEWVYGYRGRDCR.N...NlYLLPT--........GET..VYFIAS--...........VVVLY
ENSMUSP00000037654  ---------------------------.-...-.---PT--........GEV..VYFVASVA...........VLYSV
ENSMUSP00000131842  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000093960  ----------ETLSLDWVYGYRGRDSR.S...N.LFVL---........---..--------...........-----
ENSMUSP00000078426  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000124804  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000052465  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000125092  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000113309  ---------------------------.-...-.-SLPVYYmre.....DRR..VILYTCAH...........TAIMY
ENSMUSP00000029347  ---------------------------.-...-.-------........---..LYSCSDDH...........QIVKW
ENSMUSP00000103442  ---------------------------.-...-.-------........---..LYSCSDDH...........QIVKW
ENSMUSP00000133263  ---------------------------.-...-.-------........---..LYSCSDDH...........QIVKW
ENSMUSP00000072509  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000117710  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000126736  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000065643  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000117489  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000119362  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000120285  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000045812  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000124712  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000139411  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000074387  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000071863  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000080592  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000027139  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000085379  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000102413  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000034093  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000001059  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000110639  MYDFLALGDINKDKVQDVLFLYKNTNS.S...N.NLTRSCA........DEG..--FSTPCA...........FVVAV
ENSMUSP00000113418  MYDFLALGDINKDKVQDVLFLYKNTNS.S...N.NLTRSCA........DEG..--FSTPCA...........FVVAV
ENSMUSP00000033153  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000107982  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000094528  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000041880  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000124833  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000112491  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000112447  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000119471  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000051080  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000049034  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000137103  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000080888  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000107546  ----LIPCPPRDLHSAWSRRLGSQGGG.DlspL.ELADVNRdgl.....RDVllTFVTTRNGteggvgsqptaDLVCL
ENSMUSP00000107547  ----LIPCPPRDLHSAWSRRLGSQGGG.DlspL.ELADVNRdgl.....RDVllTFVTTRNGteggvgsqptaDLVCL
ENSMUSP00000117676  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000102412  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000025649  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000102411  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000055321  ---------------------------.-...-.-------........---..--------...........-----
ENSMUSP00000039427  -------------SPVWETHTDTGTG-.-...-.-------........---..--------...........RPYYY
ENSMUSP00000102639  ------------LSPVWETHTDTGTGR.-...-.-------........---..--------...........-PYYY


                           90                             100       110                    120      
                            |                               |         |                      |      
d1flga_               DAKTGKRLW......................TYNHRLPDDIRPCCDVVNRGAAIYG..D...........KVFFG..T
ENSMUSP00000045812  ---------......................----SDQRVA--SV-----AINSSG..D...........WIAFGc.S
ENSMUSP00000065004  ---------......................-------------------------..-...........-----..-
ENSMUSP00000136287  ---------......................-------------------------..-...........-----..-
ENSMUSP00000122326  DMGAKKWDF......................LRELGHVETIFDC------KFKPDDp.N...........VLATA..S
ENSMUSP00000135805  DMGAKKWDF......................LRELGHVETIFDC------KFKPDDp.N...........VLATA..S
ENSMUSP00000115550  DMGAKKWDF......................LRELGHVETIFDC------KFKPDDp.N...........VLATA..S
ENSMUSP00000117710  DMGAKKWDF......................LRELGHVETIFDC------KFKPDDp.N...........VLATA..S
ENSMUSP00000041880  NY---EERT......................QRHYLGHTDCVRCLAVHPDKIRIAT..G...........QIAGV..D
ENSMUSP00000107982  NY---EERT......................QRHYLGHTDCVRCLAVHPDKIRIAT..G...........QIAGV..D
ENSMUSP00000094528  NY---EERT......................QRHYLGHTDCVRCLAVHPDKIRIAT..G...........QIAGV..D
ENSMUSP00000118325  NV---EEQL......................QRHYAGHNDDVKCLAVHPDRITIAT..G...........QVAGT..S
ENSMUSP00000116772  ---------......................-------------------------..-...........-----..-
ENSMUSP00000103825  ---------......................-------------------------..-...........-----..-
ENSMUSP00000068516  ---------......................--------------------ISVTQ..E...........YIFCG..C
ENSMUSP00000048489  ---------......................-------------------------..-...........-----..-
ENSMUSP00000051080  -----REHS......................QKFFLGHNDDIISL-----ALHPDK..T...........LIATGqvG
ENSMUSP00000057209  NV---EEQL......................QRHYAGHNDDVKCLAVHPDRITIAT..G...........QVAGT..S
ENSMUSP00000112491  E-----EQR......................QRHYLGHNDDIKCLAVHPDMVTIAT..G...........QVAGT..T
ENSMUSP00000105486  NV---EEQL......................QRHYAGHNDDVKCLAVHPDRITIAT..G...........QVAGT..S
ENSMUSP00000069279  DLSSGETRW......................EQLLGDRIESSA-------CVSKCG..N...........FIVVG..C
ENSMUSP00000113792  DLSSGETRW......................EQLLGDRIESSA-------CVSKCG..N...........FIVVG..C
ENSMUSP00000105483  NV---EEQL......................QRHYAGHNDDVKCLAVHPDRITIAT..G...........QVAGT..S
ENSMUSP00000037654  -----EEQR......................QRHYLGHNDDIKCLAVHPDMVTIAT..G...........QVAGT..T
ENSMUSP00000131842  ---------......................-------------------LKTEDGk.Q...........LLLST..S
ENSMUSP00000093960  --RSGEVVYfiacvvvlyrpgggpggpggggQRHYRGHTDCVRCL-----AVHPDG..V...........RVASG..Q
ENSMUSP00000078426  --------W......................ALWTKDGVAVVYPCHAV--------..-...........-----..-
ENSMUSP00000124804  ---------......................------------AI-----AWSLEE..K...........LLVVG..T
ENSMUSP00000052465  ---------......................-------------------------..-...........-----..-
ENSMUSP00000125092  ---------......................----------ITAI-----AWSLEE..K...........LLVVG..T
ENSMUSP00000113309  DVVRNT---......................QYHLQGHPNIISCL-----CVSEDR..R...........WIATA..D
ENSMUSP00000029347  NLLTSETSL......................IVKLPDDIYPI--------DLHWFP..KslgikkqtqaeSFVLT..S
ENSMUSP00000103442  NLLTSETSL......................IVKLPDDIYPI--------DLHWFP..KslgikkqtqaeSFVLT..S
ENSMUSP00000133263  NLLTSETSL......................IVKLPDDIYPI--------DLHWFP..KslgikkqtqaeSFVLT..S
ENSMUSP00000072509  ---------......................--------ASITCLSKA--CASGDK..R...........YTVSA..S
ENSMUSP00000117710  ---------......................-------------------------..-...........-----..-
ENSMUSP00000126736  ---------......................-------------------------..-...........-----..-
ENSMUSP00000065643  ---------......................-------------------------..-...........-----..-
ENSMUSP00000117489  ---SGETRW......................EQLLGDRIESSA-------CVSKCG..N...........FIVVG..C
ENSMUSP00000119362  ---------......................-------------------------..-...........-----..-
ENSMUSP00000120285  ---------......................-------------------------..-...........-----..-
ENSMUSP00000045812  ---------......................-------------------------..-...........-----..-
ENSMUSP00000124712  ---------......................-------------------------..-...........-----..-
ENSMUSP00000139411  ---------......................-------------------------..-...........-----..-
ENSMUSP00000074387  ---------......................-------------------------..-...........-----..-
ENSMUSP00000071863  ---------......................-------------------AISPNR..R...........YLAISe.T
ENSMUSP00000080592  ---------......................-------------------AISPNR..R...........YLAISe.T
ENSMUSP00000027139  ---------......................-------------------------..-...........-----..-
ENSMUSP00000085379  ---------......................-------------------------..-...........-----..-
ENSMUSP00000102413  ---------......................-------------------TVTLPE..T...........LLFVS..T
ENSMUSP00000034093  ---------......................-------------------------..-...........-VIIS..T
ENSMUSP00000001059  ---------......................-------------------TVTLPE..T...........LLFVS..T
ENSMUSP00000110639  SGANGSVLW......................ERPVAQDVALVKCAMPQ--TLDSDEvsS...........ACIVV..G
ENSMUSP00000113418  SGANGSVLW......................ERPVAQDVALVKCAMPQ--TLDSDEvsS...........ACIVV..G
ENSMUSP00000033153  ---------......................-------------------------..-...........-LFVS..T
ENSMUSP00000107982  ---------......................-------------------------..-...........-----..-
ENSMUSP00000094528  ---------......................-------------------------..-...........-----..-
ENSMUSP00000041880  ---------......................-------------------------..-...........-----..-
ENSMUSP00000124833  ---------......................-------------------------..-...........-----..-
ENSMUSP00000112491  ---------......................-------------------------..-...........-----..-
ENSMUSP00000112447  ---------......................-------------------------..-...........-----..-
ENSMUSP00000119471  ---------......................-------------------------..-...........-----..-
ENSMUSP00000051080  ---------......................-------------------------..-...........-----..-
ENSMUSP00000049034  ----GKFDW......................RQQYVGKIKFASL------EFSPGS..K...........KLVVA..T
ENSMUSP00000137103  ----GKFDW......................RQQYVGKIKFASL------EFSPGS..K...........KLVVA..T
ENSMUSP00000080888  ----GKFDW......................RQQYVGKIKFASL------EFSPGS..K...........KLVVA..T
ENSMUSP00000107546  SGMNGSTLW......................SSPLPEEAQDVTCLDLI--PGSVAK..T...........ICLVT..G
ENSMUSP00000107547  SGMNGSTLW......................SSPLPEEAQDVTCLDLI--PGSVAK..T...........ICLVT..G
ENSMUSP00000117676  ---------......................-------------------------..-...........-----..-
ENSMUSP00000102412  ---------......................-------------------TVTLPE..T...........LLFVS..T
ENSMUSP00000025649  ---------......................-------------------------..-...........-----..-
ENSMUSP00000102411  ---------......................-------------------TVTLPE..T...........LLFVS..T
ENSMUSP00000055321  ---------......................-------------------------..-...........-LVLG..T
ENSMUSP00000039427  NPDTGVTTW......................ESPFETPEG----------TTSPAT..S...........RASVG..S
ENSMUSP00000102639  NPDTGVTTW......................ESPFETPEG----------TTSPAT..S...........RASVG..S


                                                 130         140                          150       
                                                   |           |                            |       
d1flga_               L..............DA..........SVVALNKN.TGKV.VWKKKF...................ADHGAG......
ENSMUSP00000045812  G..............MG..........QLLVWEWQ.SESY.VLKQQG...................-----H......
ENSMUSP00000065004  -..............--..........--------.----.------...................------......
ENSMUSP00000136287  -..............--..........--------.----.------...................------......
ENSMUSP00000122326  F..............DG..........TIKVWDIN.TLTA.VYTSPG...................-----N......
ENSMUSP00000135805  F..............DG..........TIKVWDIN.TLTA.VYTSPG...................-----N......
ENSMUSP00000115550  F..............DG..........TIKVWDIN.TLTA.VYTSPG...................-----N......
ENSMUSP00000117710  F..............DG..........TIKVWDIN.TLTA.VYTSPG...................-----N......
ENSMUSP00000041880  K..............DGrplqp.....HVRVWDSV.SLTT.LHVIGL...................GT---F......
ENSMUSP00000107982  K..............DGrplqp.....HVRVWDSV.SLTT.LHVIGL...................GT---F......
ENSMUSP00000094528  K..............DGrplqp.....HVRVWDSV.SLTT.LHVIGL...................GT---F......
ENSMUSP00000118325  K..............DGkqlpp.....HVRIWDSV.TLNT.LHVIGI...................GF---F......
ENSMUSP00000116772  -..............--..........VVVVLNPK.ENKQ.QHIFNT...................-----T......
ENSMUSP00000103825  -..............--..........VVVVLNPK.ENKQ.QHIFNT...................-----T......
ENSMUSP00000068516  A..............DG..........TVRLFNPS.NLHF.LSTLPRphalgtdiasiteasrlfsGGVNAR......
ENSMUSP00000048489  -..............--..........--------.----.------...................-----H......
ENSMUSP00000051080  K..............EP..........YICIWNSY.NVHT.VSILKD...................V----H......
ENSMUSP00000057209  K..............DGkqlpp.....HVRIWDSV.TLNT.LHVIGI...................GF---F......
ENSMUSP00000112491  K..............EGkplpp.....HVRVWDSV.SLST.LHVLGL...................GV---F......
ENSMUSP00000105486  K..............DGkqlpp.....HVRIWDSV.TLNT.LHVIGI...................GF---F......
ENSMUSP00000069279  Y..............NG..........LVYVLKSN.SGEK.YWTFTT...................-----E......
ENSMUSP00000113792  Y..............NG..........LVYVLKSN.SGEK.YWTFTT...................-----E......
ENSMUSP00000105483  K..............DGkqlpp.....HVRIWDSV.TLNT.LHVIGI...................GF---F......
ENSMUSP00000037654  K..............EGkplpp.....HVRVWDSV.SLST.LHVLGL...................GV---F......
ENSMUSP00000131842  M..............DR..........DVKCWDMA.TLEC.CWTLPS...................-----L......
ENSMUSP00000093960  T..............AGvdkdgkplqpVVHIWDSE.TLLK.LQEIGL...................GA---F......
ENSMUSP00000078426  -..............--..........-IIVLQID.TGQQ.RFFLG-...................-----H......
ENSMUSP00000124804  Q..............DG..........AMVVWDVE.EQQV.VHVLMG...................-----H......
ENSMUSP00000052465  -..............--..........--------.----.------...................------......
ENSMUSP00000125092  Q..............DG..........AMVVWDVE.EQQV.VHVLMG...................-----H......
ENSMUSP00000113309  Egp............DC..........LIIIWDSF.TGIP.VHTIFD...................SCP--E......
ENSMUSP00000029347  S..............DG..........KFHLISK-.LGRV.EKSVEA...................-----H......
ENSMUSP00000103442  S..............DG..........KFHLISK-.LGRV.EKSVEA...................-----H......
ENSMUSP00000133263  S..............DG..........KFHLISK-.LGRV.EKSVEA...................-----H......
ENSMUSP00000072509  A..............NG..........EMCLWDVN.DGRC.IEFTKLact................H----T......
ENSMUSP00000117710  -..............--..........--------.----.------...................-----H......
ENSMUSP00000126736  -..............--..........RLCVWSSK.DPSHqLLTLQG...................-----H......
ENSMUSP00000065643  -..............-Sadmsatap..SVHIWDAV.NKQT.LSILRC...................S----H......
ENSMUSP00000117489  Y..............NG..........LVYVLKSN.SGEK.YWTFTT...................-----E......
ENSMUSP00000119362  -..............--..........--------.----.------...................------......
ENSMUSP00000120285  -..............--..........--------.----.------...................------......
ENSMUSP00000045812  -..............-N..........RVTVFDLK.NNRS.NTLPLA...................-----T......
ENSMUSP00000124712  -..............--..........--------.----.------...................------......
ENSMUSP00000139411  -..............--..........--------.----.------...................------......
ENSMUSP00000074387  -..............--..........--------.----.------...................------......
ENSMUSP00000071863  V..............QEkpavtiy...ELSSIPCR.KRKV.LNNFDF...................-----Q......
ENSMUSP00000080592  V..............QEkpavtiy...ELSSIPCR.KRKV.LNNFDF...................-----Q......
ENSMUSP00000027139  -..............--..........--------.----.------...................------......
ENSMUSP00000085379  -..............--..........--------.----.------...................------......
ENSMUSP00000102413  L..............DG..........SLHAVSKR.TGSI.KWTLKE...................DPVLQV......
ENSMUSP00000034093  L..............DG..........RIAALDAEnDGKK.QWDLDV...................GSGSLV......
ENSMUSP00000001059  L..............DG..........SLHAVSKR.TGSI.KWTLKE...................DPVLQV......
ENSMUSP00000110639  R..............AG..........SFVAVSFF.TGET.LWSHPSsfs................GNVSIL......
ENSMUSP00000113418  R..............AG..........SFVAVSFF.TGET.LWSHPSsfs................GNVSIL......
ENSMUSP00000033153  L..............DG..........SLHALNKQ.TGDL.KWTVKD...................DPIIQG......
ENSMUSP00000107982  -..............--..........--------.----.------...................------......
ENSMUSP00000094528  -..............--..........--------.----.------...................------......
ENSMUSP00000041880  -..............--..........--------.----.------...................------......
ENSMUSP00000124833  -..............--..........--------.----.------...................------......
ENSMUSP00000112491  -..............--..........--------.----.------...................------......
ENSMUSP00000112447  -..............--..........--------.----.------...................------......
ENSMUSP00000119471  -..............--..........--------.----.------...................------......
ENSMUSP00000051080  -..............--..........--------.----.------...................------......
ENSMUSP00000049034  E..............KN..........VIAALNSR.TGEI.LWRHVD...................KGT--A......
ENSMUSP00000137103  E..............KN..........VIAALNSR.TGEI.LWRHVD...................KGT--A......
ENSMUSP00000080888  E..............KN..........VIAALNSR.TGEI.LWRHVD...................KGT--A......
ENSMUSP00000107546  T..............RK..........MLSAFNAT.SGKV.LWTLNPnhl................SNGTLA......
ENSMUSP00000107547  T..............RK..........MLSAFNAT.SGKV.LWTLNPnhl................SNGTLA......
ENSMUSP00000117676  -..............--..........--------.----.------...................------......
ENSMUSP00000102412  L..............DG..........SLHAVSKR.TGSI.KWTLKE...................DPVLQV......
ENSMUSP00000025649  -..............--..........--------.----.------...................------......
ENSMUSP00000102411  L..............DG..........SLHAVSKR.TGSI.KWTLKE...................G-----......
ENSMUSP00000055321  E..............SK..........ELLVLDPE.AFTI.LAKMSL...................PSVPVF......
ENSMUSP00000039427  GesletewgqywdeeSR..........RVFFYNPL.TGET.AWEDETeele...............E----Dhqeqle
ENSMUSP00000102639  GesletewgqywdeeSR..........RVFFYNPL.TGET.AWEDETeele...............E----Dhqeqle


                                                                              160              170  
                                                                                |                |  
d1flga_               ..................................................YTMTGAPTIVK...D.GKTG...KVLLI
ENSMUSP00000045812  ..................................................FNSMVALAYSP...D.G---...QYIVT
ENSMUSP00000065004  ..................................................-----------...-.----...VILAT
ENSMUSP00000136287  ..................................................-----------...-.----...VILAT
ENSMUSP00000122326  ..................................................EGVIFALSWAP...-.GDL-...NCIAG
ENSMUSP00000135805  ..................................................EGVIFALSWAP...-.GDL-...NCIAG
ENSMUSP00000115550  ..................................................EGVIFALSWAP...-.GDL-...NCIAG
ENSMUSP00000117710  ..................................................EGVIFALSWAP...-.GDL-...NCIAG
ENSMUSP00000041880  ..................................................ERGVGCLDFSKad.S.GV--...HLCVI
ENSMUSP00000107982  ..................................................ERGVGCLDFSKad.S.GV--...HLCVI
ENSMUSP00000094528  ..................................................ERGVGCLDFSKad.S.GV--...HLCVI
ENSMUSP00000118325  ..................................................DRAVTCIAFSKs..N.GGG-...HLCAV
ENSMUSP00000116772  ..................................................RKSLSALAFSP...D.G---...KYIVT
ENSMUSP00000103825  ..................................................RKSLSALAFSP...D.G---...KYIVT
ENSMUSP00000068516  ..................................................YPDTIALTFDP...T.N---...QWLSC
ENSMUSP00000048489  ..................................................SDLVTDLDFSPf..D.D---...FLLAS
ENSMUSP00000051080  ..................................................THGVACLAFDS...D.GQ--...HLASV
ENSMUSP00000057209  ..................................................DRAVTCIAFSKs..N.GGG-...HLCAV
ENSMUSP00000112491  ..................................................DRAVCCVAFSKs..N.GG--...NLLCA
ENSMUSP00000105486  ..................................................DRAVTCIAFSKs..N.GGG-...HLCAV
ENSMUSP00000069279  ..................................................DAVKSSPAVDPt..T.G---...LIYVG
ENSMUSP00000113792  ..................................................DAVKSSPAVDPt..T.G---...LIYVG
ENSMUSP00000105483  ..................................................DRAVTCIAFSKs..N.GGG-...HLCAV
ENSMUSP00000037654  ..................................................DRAVCCVAFSKs..N.GG--...NLLCA
ENSMUSP00000131842  ..................................................GGFAYSLAFSPv..DvG---...SLAIG
ENSMUSP00000093960  ..................................................ERGVGALAFSAad.Q.GA--...FLCVV
ENSMUSP00000078426  ..................................................TDKVSALALNG...S.D---...TLLAS
ENSMUSP00000124804  ..................................................TAEVKCVRVFA...Q.G---...TLAIS
ENSMUSP00000052465  ..................................................-----------...-.----...-----
ENSMUSP00000125092  ..................................................TAEVKCVRVFA...Q.G---...TLAIS
ENSMUSP00000113309  ..................................................GNGMRSIAITR...D.S---...KFLAT
ENSMUSP00000029347  ..................................................CGAVLAGRWNY...E.G---...TALVT
ENSMUSP00000103442  ..................................................CGAVLAGRWNY...E.G---...TALVT
ENSMUSP00000133263  ..................................................CGAVLAGRWNY...E.G---...TALVT
ENSMUSP00000072509  ..................................................GIQFYQFSVGNqq.E.G---...RLLCH
ENSMUSP00000117710  ..................................................KKTITAISWCP...H.NP--...DLFAS
ENSMUSP00000126736  ..................................................HQLITAVVFGNqi.D.----...PLLLC
ENSMUSP00000065643  ..................................................SKGVCSVSFSA...T.G---...KLLLS
ENSMUSP00000117489  ..................................................DAVKSSPAVDPt..T.G---...LIYVG
ENSMUSP00000119362  ..................................................-----------...-.----...-----
ENSMUSP00000120285  ..................................................---ISCLCFNPe..T.----...KMLLS
ENSMUSP00000045812  ..................................................KYNIKCVGLSP...D.G---...RLAII
ENSMUSP00000124712  ..................................................-----------...-.----...-----
ENSMUSP00000139411  ..................................................-----------...-.----...-----
ENSMUSP00000074387  ..................................................-----------...-.----...-----
ENSMUSP00000071863  ..................................................VQKFTSMAFSP...D.SK--...YLLTQ
ENSMUSP00000080592  ..................................................VQKFTSMAFSP...D.SK--...YLLTQ
ENSMUSP00000027139  ..................................................-----------...-.----...-----
ENSMUSP00000085379  ..................................................-----------...-.----...-----
ENSMUSP00000102413  ..................................................PTHVEEPAFLPdpnD.----...-----
ENSMUSP00000034093  ..................................................SSSLSKPEVFG...N.----...KMIIP
ENSMUSP00000001059  ..................................................PTHVEEPAFLPdpnD.----...-----
ENSMUSP00000110639  ..................................................SPLLQVPDIDGdg.D.GTPD...LLILA
ENSMUSP00000113418  ..................................................SPLLQVPDIDGdg.D.GTPD...LLILA
ENSMUSP00000033153  ..................................................PMYVTEMAFLS...-.----...-----
ENSMUSP00000107982  ..................................................-----------...-.----...-----
ENSMUSP00000094528  ..................................................-----------...-.----...-----
ENSMUSP00000041880  ..................................................-----------...-.----...-----
ENSMUSP00000124833  ..................................................-----------...-.----...RLVAG
ENSMUSP00000112491  ..................................................-----------...-.----...-----
ENSMUSP00000112447  ..................................................-----------...-.----...-----
ENSMUSP00000119471  ..................................................----------P...Q.G---...YLWVG
ENSMUSP00000051080  ..................................................-----------...-.----...-----
ENSMUSP00000049034  ..................................................EGAVDAMLVHG...Q.D---...AITVS
ENSMUSP00000137103  ..................................................EGAVDAMLVHG...Q.D---...AITVS
ENSMUSP00000080888  ..................................................EGAVDAMLVHG...Q.D---...AITVS
ENSMUSP00000107546  ..................................................APVVVLPDLDE...D.GVRD...LVVLA
ENSMUSP00000107547  ..................................................APVVVLPDLDE...D.GVRD...LVVLA
ENSMUSP00000117676  ..................................................-----------...-.----...-----
ENSMUSP00000102412  ..................................................PTHVEEPAFLPdpnD.G---...SLYTL
ENSMUSP00000025649  ..................................................-----------...-.----...-----
ENSMUSP00000102411  ..................................................-----------...-.----...-----
ENSMUSP00000055321  ..................................................LEVS-------...-.GQFDvefRLTAA
ENSMUSP00000039427  mqpslsprspgqqrpptpetdypellasypeedyspvgsfsdpgpasplvA----------...-.----...-----
ENSMUSP00000102639  mqpslsprspgqqrpptpetdypellasypeedyspvgsfsdpgpasplvA----------...-.----...-----


                           180                                                                      
                             |                                                                      
d1flga_               HGSSGDEFGV....................................................................
ENSMUSP00000045812  GGD-------....................................................................
ENSMUSP00000065004  AGY-------....................................................................
ENSMUSP00000136287  AGY-------....................................................................
ENSMUSP00000122326  ATS-------....................................................................
ENSMUSP00000135805  ATS-------....................................................................
ENSMUSP00000115550  ATS-------....................................................................
ENSMUSP00000117710  ATS-------....................................................................
ENSMUSP00000041880  DDSN------....................................................................
ENSMUSP00000107982  DDSN------....................................................................
ENSMUSP00000094528  DDSN------....................................................................
ENSMUSP00000118325  DDSN------....................................................................
ENSMUSP00000116772  GENGH-----....................................................................
ENSMUSP00000103825  GENGH-----....................................................................
ENSMUSP00000068516  VYN-------....................................................................
ENSMUSP00000048489  GSA-------....................................................................
ENSMUSP00000051080  GLDA------....................................................................
ENSMUSP00000057209  DDSN------....................................................................
ENSMUSP00000112491  VDESN-----....................................................................
ENSMUSP00000105486  DDSN------....................................................................
ENSMUSP00000069279  SH--------....................................................................
ENSMUSP00000113792  SH--------....................................................................
ENSMUSP00000105483  DDSN------....................................................................
ENSMUSP00000037654  VDESN-----....................................................................
ENSMUSP00000131842  VG--------....................................................................
ENSMUSP00000093960  DDSN------....................................................................
ENSMUSP00000078426  AQVQP-----....................................................................
ENSMUSP00000124804  ASK-------....................................................................
ENSMUSP00000052465  ----------....................................................................
ENSMUSP00000125092  ASK-------....................................................................
ENSMUSP00000113309  ISD-SATQKVciwkwtlavetpactlelpkeygfqdnlvfnpannkelvsnsktqaiyycwfedkgilahsapvltek
ENSMUSP00000029347  VGE-------....................................................................
ENSMUSP00000103442  VGE-------....................................................................
ENSMUSP00000133263  VGE-------....................................................................
ENSMUSP00000072509  GH--------....................................................................
ENSMUSP00000117710  SST-------....................................................................
ENSMUSP00000126736  SAS-------....................................................................
ENSMUSP00000065643  VGL-DP----....................................................................
ENSMUSP00000117489  SH--------....................................................................
ENSMUSP00000119362  ----------....................................................................
ENSMUSP00000120285  GI--------....................................................................
ENSMUSP00000045812  VDE-------....................................................................
ENSMUSP00000124712  ----------....................................................................
ENSMUSP00000139411  ----------....................................................................
ENSMUSP00000074387  ----------....................................................................
ENSMUSP00000071863  TSPP------....................................................................
ENSMUSP00000080592  TSPP------....................................................................
ENSMUSP00000027139  ----------....................................................................
ENSMUSP00000085379  ----------....................................................................
ENSMUSP00000102413  ----------....................................................................
ENSMUSP00000034093  SL--------....................................................................
ENSMUSP00000001059  ----------....................................................................
ENSMUSP00000110639  QEGQEV----....................................................................
ENSMUSP00000113418  QEGQEV----....................................................................
ENSMUSP00000033153  DPA-------....................................................................
ENSMUSP00000107982  ----------....................................................................
ENSMUSP00000094528  ----------....................................................................
ENSMUSP00000041880  ----------....................................................................
ENSMUSP00000124833  FS--------....................................................................
ENSMUSP00000112491  ----------....................................................................
ENSMUSP00000112447  ----------....................................................................
ENSMUSP00000119471  GGQEGA----....................................................................
ENSMUSP00000051080  ----------....................................................................
ENSMUSP00000049034  NG--------....................................................................
ENSMUSP00000137103  NG--------....................................................................
ENSMUSP00000080888  NG--------....................................................................
ENSMUSP00000107546  IGELQP----....................................................................
ENSMUSP00000107547  IGELQP----....................................................................
ENSMUSP00000117676  ----------....................................................................
ENSMUSP00000102412  GG--------....................................................................
ENSMUSP00000025649  ----------....................................................................
ENSMUSP00000102411  ----------....................................................................
ENSMUSP00000055321  CR--------....................................................................
ENSMUSP00000039427  ----------....................................................................
ENSMUSP00000102639  ----------....................................................................


                                                     190                     200       210          
                                                       |                       |         |          
d1flga_               ..........................VGRLFARDP....D..TGE........EIWMRPFVEGHMGRLNGKDST....
ENSMUSP00000045812  ..........................DGKVKVWNT....L..SGF........CFVTLT--------------E....
ENSMUSP00000065004  ..........................DHTVRFWQA....H..SGI........CTRTVQ--------------H....
ENSMUSP00000136287  ..........................DHTVRFWQA....H..SGI........CTRTVQ--------------H....
ENSMUSP00000122326  ..........................RNGAFIWDI....Q..KGK........IIQRFN--------------Eh...
ENSMUSP00000135805  ..........................RNGAFIWDI....Q..KGK........IIQRFN--------------Eh...
ENSMUSP00000115550  ..........................RNGAFIWDI....Q..KGK........IIQRFN--------------Eh...
ENSMUSP00000117710  ..........................RNGAFIWDI....Q..KGK........IIQRFN--------------Eh...
ENSMUSP00000041880  ..........................EHMLTVWDW....Q..KKS........KIAEIK--------------T....
ENSMUSP00000107982  ..........................EHMLTVWDW....Q..KKS........KIAEIK--------------T....
ENSMUSP00000094528  ..........................EHMLTVWDW....Q..KKS........KIAEIK--------------T....
ENSMUSP00000118325  ..........................DHVLSVWDW....Q..KEE........RLADVK--------------C....
ENSMUSP00000116772  ..........................RPAVRIWDV....E..EKT........QVAEML--------------G....
ENSMUSP00000103825  ..........................RPAVRIWDV....E..EKT........QVAEML--------------G....
ENSMUSP00000068516  ..........................DHSIYVWDV....R..DPK........KVGKVY--------------Saly.
ENSMUSP00000048489  ..........................DRTIKLWRL....Sg.TGE........ALPSVP--------------Gvvlg
ENSMUSP00000051080  ..........................KNTVCIWDW....R..KGK........LLASAT--------------G....
ENSMUSP00000057209  ..........................DHVLSVWDW....Q..KEE........RLADVK--------------C....
ENSMUSP00000112491  ..........................DHVLSVWDW....A..KES........KVVDSK--------------C....
ENSMUSP00000105486  ..........................DHVLSVWDW....Q..KEE........RLADVK--------------C....
ENSMUSP00000069279  ..........................DQHAYALDI....Y..EKK........CVWKLN--------------C....
ENSMUSP00000113792  ..........................DQHAYALDI....Y..EKK........CVWKLN--------------C....
ENSMUSP00000105483  ..........................DHVLSVWDW....Q..KEE........RLADVK--------------C....
ENSMUSP00000037654  ..........................DHVLSVWDW....A..KES........KVVDSK--------------C....
ENSMUSP00000131842  ..........................DGMIRVWNTlsikN..NYD........VKNFWQ--------------G....
ENSMUSP00000093960  ..........................EHMLSVWDC....S..RGV........KLAEIK--------------S....
ENSMUSP00000078426  ..........................PSMVRLWDF....Q..TGS........CLSLFR--------------S....
ENSMUSP00000124804  ..........................DHTLRLWSL....L..SGQ........EKVTIL-DGGSQNP-------....
ENSMUSP00000052465  ..........................---------....-..---........---------------------....
ENSMUSP00000125092  ..........................DHTLRLWSL....L..SGQ........EKVTIL-DGGSQNP-------....
ENSMUSP00000113309  tfnklvgkfsqsvfhlklpqvlsatkEGKLVVWDI....-..---........--------------------H....
ENSMUSP00000029347  ..........................DGQVKIWS-....K..TGM........LRSTLA--------------Q....
ENSMUSP00000103442  ..........................DGQVKIWS-....K..TGM........LRSTLA--------------Q....
ENSMUSP00000133263  ..........................DGQVKIWS-....K..TGM........LRSTLA--------------Q....
ENSMUSP00000072509  ..........................YPEILVVDA....T..SLE........VLYSLV--------------Ski..
ENSMUSP00000117710  ..........................DNLVIIWNV....A..EQK........VIAKLD--------------N....
ENSMUSP00000126736  ..........................EDYIIMWNV....A..ECRektlkgltPRGTIL--------------Gs...
ENSMUSP00000065643  ..........................EHTVTIWRW....Q..EGA........KIASRG--------------G....
ENSMUSP00000117489  ..........................DQHAYALDI....Y..EKK........CVWKLN--------------C....
ENSMUSP00000119362  ..........................---------....-..---........---------------------....
ENSMUSP00000120285  ..........................LGGVVTWNI....Eq.TGK........GLRMLQISPIS----------....
ENSMUSP00000045812  ..........................GGAALLVSL....V..CRS........VLHHFH---------------....
ENSMUSP00000124712  ..........................EGSLSVWNTedi.S..NPQ........LTEDFD--------------Crk..
ENSMUSP00000139411  ..........................---------....-..---........---------------------....
ENSMUSP00000074387  ..........................---------....-..---........---------------------....
ENSMUSP00000071863  ..........................DSNLVYWLW....E..KQK........VMAIIK--------------Ads..
ENSMUSP00000080592  ..........................DSNLVYWLW....E..KQK........VMAIIK--------------Ads..
ENSMUSP00000027139  ..........................---------....-..---........---------------------....
ENSMUSP00000085379  ..........................---------....-..---........---------------------....
ENSMUSP00000102413  ..........................-GSLYTLGG....K..NNE........GLTKLP--------------Ft...
ENSMUSP00000034093  ..........................DGDLFQWD-....R..DRE........SMEAVP--------------F....
ENSMUSP00000001059  ..........................-GSLYTLGG....K..NNE........GLTKLP--------------Ft...
ENSMUSP00000110639  ..........................--SGALYSG....S..TGY........QIGHRG--------------S....
ENSMUSP00000113418  ..........................--SGALYSG....S..TGY........QIGHRG--------------S....
ENSMUSP00000033153  ..........................DGSLYVLGT....Q..KQQ........GLMKLP--------------Ft...
ENSMUSP00000107982  ..........................---------....-..---........---------------------....
ENSMUSP00000094528  ..........................---------....-..---........---------------------....
ENSMUSP00000041880  ..........................---------....-..---........---------------------....
ENSMUSP00000124833  ..........................SGSIALVSA....G..EDR........LLEKLP---------------....
ENSMUSP00000112491  ..........................---------....-..---........---------------------....
ENSMUSP00000112447  ..........................---------....-..---........---------------------....
ENSMUSP00000119471  ..........................GGQVEIFSL....NrpSPR........TVKSFP---------------....
ENSMUSP00000051080  ..........................---------....-..---........---------------------....
ENSMUSP00000049034  ..........................GRLMRSWET....N..IGG........LNWEIT--------------L....
ENSMUSP00000137103  ..........................GRLMRSWET....N..IGG........LNWEIT--------------L....
ENSMUSP00000080888  ..........................GRLMRSWET....N..IGG........LNWEIT--------------L....
ENSMUSP00000107546  ..........................DLCFLLVSG....R..TGS........PVGRPV---------------....
ENSMUSP00000107547  ..........................DLCFLLVSG....R..TGS........PVGRPV---------------....
ENSMUSP00000117676  ..........................---------....-..---........---------------------....
ENSMUSP00000102412  ..........................---------....-..---........---------------------....
ENSMUSP00000025649  ..........................---------....-..---........---------------------....
ENSMUSP00000102411  ..........................---------....-..---........---------------------....
ENSMUSP00000055321  ..........................NGSIYILRR....D..SKH........PKYCIE---------------....
ENSMUSP00000039427  ..........................---------....-..---........---------------------....
ENSMUSP00000102639  ..........................---------....-..---........---------------------....


                        220                              230         240                            
                          |                                |           |                            
d1flga_               .VTGDVKAPSWPD.......................DRNSPTG..KVESWSHGG........................
ENSMUSP00000045812  .HSSGVTGVTFTT.......................-------..---------........................
ENSMUSP00000065004  .QDSQVNALEITP.......................-------..---------........................
ENSMUSP00000136287  .QDSQVNALEITP.......................-------..---------........................
ENSMUSP00000122326  .GKNGIFYIAWSH.......................-------..---------........................
ENSMUSP00000135805  .GKNGIFYIAWSH.......................-------..---------........................
ENSMUSP00000115550  .GKNGIFYIAWSH.......................-------..---------........................
ENSMUSP00000117710  .GKNGIFYIAWSH.......................-------..---------........................
ENSMUSP00000041880  .TNEVVLAVEFHPtdantiitcgks...........HIFFWTWs.GNSLTRKQGifgkyek.................
ENSMUSP00000107982  .TNEVVLAVEFHPtdantiitcgks...........HIFFWTWs.GNSLTRKQGifgkyek.................
ENSMUSP00000094528  .TNEVVLAVEFHPtdantiitcgks...........HIFFWTWs.GNSLTRKQGifgkyek.................
ENSMUSP00000118325  .SNEAVFAADFHP.......................-------..---------........................
ENSMUSP00000116772  .HKYGVACVAFSP.......................N------..MKHIVSMGY........................
ENSMUSP00000103825  .HKYGVACVAFSP.......................N------..MKHIVSMGY........................
ENSMUSP00000068516  .HSSCVWSVEVYPeikdshqaclppssfitcss...DNTIRLWn.TESSGVHGStlhrnils................
ENSMUSP00000048489  pEELPVEVLQFHP.......................-------..---------........................
ENSMUSP00000051080  .HSDRIFDISWDP.......................-------..---------........................
ENSMUSP00000057209  .SNEAVFAADFHPtdtniivtcgks...........H------..----LYFWTlegnslnkkqglfekqek......
ENSMUSP00000112491  .SNEAVLVATFHPtdpsllitcgks...........HIYFWSLe.GGSLSKRQGlfekhek.................
ENSMUSP00000105486  .SNEAVFAADFHPtdtniivtcgks...........H------..----LYFWTlegnslnkkqglfekqek......
ENSMUSP00000069279  .EGALFSSPCVSL.......................-------..---------........................
ENSMUSP00000113792  .EGALFSSPCVSL.......................-------..---------........................
ENSMUSP00000105483  .SNEAVFAADFHP.......................-------..---------........................
ENSMUSP00000037654  .SNEAVLVATFHP.......................-------..---------........................
ENSMUSP00000131842  .VKSKVTALCWHP.......................N------..---------........................
ENSMUSP00000093960  .TNDSVLAVGFSPrdsscivtsgks...........H------..----VHFWNwsggtgapgngllarkqgvfgkyk
ENSMUSP00000078426  .PLHTICSLSFSGsgallcgvgkdrhg.........RTVVVAW..STEQAGLGG........................
ENSMUSP00000124804  .TEPQSWDLHVDE.......................-------..---------........................
ENSMUSP00000052465  .------------.......................-------..---------........................
ENSMUSP00000125092  .TEPQSWDLHVDE.......................-------..---------........................
ENSMUSP00000113309  .YPSSTSSSAISAfpfikprklvhlqkeaitvlmtiDSYIVTGdiKGNIKFYDHtlsvvnwysnfklgairtlsfskt
ENSMUSP00000029347  .QGTPVYSVAWGP.......................D------..---------........................
ENSMUSP00000103442  .QGTPVYSVAWGP.......................D------..---------........................
ENSMUSP00000133263  .QGTPVYSVAWGP.......................D------..---------........................
ENSMUSP00000072509  .SPDWISSMSIIRsqrtqe.................DTVVALS..VTGILKVWIvtsems..................
ENSMUSP00000117710  .IKETPACLGWCWnth....................D------..---------........................
ENSMUSP00000126736  .LLQTVLCLRFSL.......................-------..---------........................
ENSMUSP00000065643  .HNQRIFVAEFRP.......................D------..---------........................
ENSMUSP00000117489  .EGALFSSPCVSL.......................-------..---------........................
ENSMUSP00000119362  .------------.......................-------..---------........................
ENSMUSP00000120285  .GDEVVQNIALNG.......................-------..---------........................
ENSMUSP00000045812  .FKGSVHSVSFSP.......................-------..---------........................
ENSMUSP00000124712  .EDSEVVSIELSE.......................-------..---------........................
ENSMUSP00000139411  .------------.......................-------..---------........................
ENSMUSP00000074387  .------------.......................-------..---------........................
ENSMUSP00000071863  .QNNPIYQVSISS.......................-------..---------........................
ENSMUSP00000080592  .QNNPIYQVSISS.......................-------..---------........................
ENSMUSP00000027139  .TQTELTKAAFGC.......................-------..---------........................
ENSMUSP00000085379  .------------.......................-------..---------........................
ENSMUSP00000102413  .IPELVQASPCRS.......................-------..---------........................
ENSMUSP00000034093  .TVESLLESSYKF.......................-------..---------........................
ENSMUSP00000001059  .IPELVQASPCRS.......................-------..---------........................
ENSMUSP00000110639  .LGVD--------.......................-------..--------Gdgvallhvtrtgaqyillpcasal
ENSMUSP00000113418  .LGVD--------.......................-------..--------Gdgvallhvtrtgaqyillpcasal
ENSMUSP00000033153  .IPELVHASPCRS.......................-------..---------........................
ENSMUSP00000107982  .------------.......................-------..---------........................
ENSMUSP00000094528  .------------.......................-------..---------........................
ENSMUSP00000041880  .------------.......................-------..---------........................
ENSMUSP00000124833  .--EAVGFLVVSE.......................-------..---------........................
ENSMUSP00000112491  .------------.......................-------..---------........................
ENSMUSP00000112447  .------------.......................-------..---------........................
ENSMUSP00000119471  .VAAPVLCIEYIP.......................-------..---------........................
ENSMUSP00000051080  .------------.......................-------..---------........................
ENSMUSP00000049034  .DTGSFQALGLVG.......................-------..---------........................
ENSMUSP00000137103  .DTGSFQALGLVG.......................-------..---------........................
ENSMUSP00000080888  .DTGSFQALGLVG.......................-------..---------........................
ENSMUSP00000107546  .-KYNIVGVGNLI.......................-------..---------........................
ENSMUSP00000107547  .-KYNIVGVGNLI.......................-------..---------........................
ENSMUSP00000117676  .------------.......................-------..---------........................
ENSMUSP00000102412  .------------.......................-------..---------........................
ENSMUSP00000025649  .------------.......................-------..--------Nvahqqliqitsasvrlvsqepkal
ENSMUSP00000102411  .------------.......................-------..---------........................
ENSMUSP00000055321  .LSAQPVGLVR--.......................-------..---------........................
ENSMUSP00000039427  .------------.......................-------..---------........................
ENSMUSP00000102639  .------------.......................-------..---------........................


                                              250       260                                         
                                                |         |                                         
d1flga_               .....................GAPWQSASFDAETNTIIVG......................................
ENSMUSP00000045812  .....................-------------------......................................
ENSMUSP00000065004  .....................-------------------......................................
ENSMUSP00000136287  .....................-------------------......................................
ENSMUSP00000122326  .....................-------------------......................................
ENSMUSP00000135805  .....................-------------------......................................
ENSMUSP00000115550  .....................-------------------......................................
ENSMUSP00000117710  .....................-------------------......................................
ENSMUSP00000041880  .....................PKFVQCLAFL---------......................................
ENSMUSP00000107982  .....................PKFVQCLAFL---------......................................
ENSMUSP00000094528  .....................PKFVQCLAFL---------......................................
ENSMUSP00000118325  .....................-------------------......................................
ENSMUSP00000116772  .....................QHDMVLNVWDWKKDIVVAS......................................
ENSMUSP00000103825  .....................QHDMVLNVWDWKKDIVVAS......................................
ENSMUSP00000068516  .....................NDLIKIIYVDGNTQALLDTelpggdkadgsl..........................
ENSMUSP00000048489  .....................-------------------......................................
ENSMUSP00000051080  .....................-------------------......................................
ENSMUSP00000057209  .....................PKFVLCVTFSENGDTITG-......................................
ENSMUSP00000112491  .....................PKYVLCVTFL---------......................................
ENSMUSP00000105486  .....................PKFVLCVTFSENGDTITG-......................................
ENSMUSP00000069279  .....................-------------------......................................
ENSMUSP00000113792  .....................-------------------......................................
ENSMUSP00000105483  .....................-------------------......................................
ENSMUSP00000037654  .....................-------------------......................................
ENSMUSP00000131842  .....................-------------------......................................
ENSMUSP00000093960  ....................kPKFIPCFVFLPDGD-----......................................
ENSMUSP00000078426  .....................-------------EVVVLAkvhtdfdirafqvaffdetrmascgrgsvrlwrlrggv
ENSMUSP00000124804  .....................-------------------......................................
ENSMUSP00000052465  .....................-----------EGRLLRFR......................................
ENSMUSP00000125092  .....................-------------------......................................
ENSMUSP00000113309  ...............ipslptEKSNLPTDCTLRGDLFVVRnfii..................................
ENSMUSP00000029347  .....................-------------------......................................
ENSMUSP00000103442  .....................-------------------......................................
ENSMUSP00000133263  .....................-------------------......................................
ENSMUSP00000072509  .....................GMQDTEPIFEEESKPIYCQncqsisfcaf............................
ENSMUSP00000117710  .....................----AVAFVSQKGPLLIWTisgpdsgvsvhkeahsfasdicifrwht..........
ENSMUSP00000126736  .....................-------------------......................................
ENSMUSP00000065643  .....................-------------------......................................
ENSMUSP00000117489  .....................-------------------......................................
ENSMUSP00000119362  .....................-------------------......................................
ENSMUSP00000120285  .....................-------------------......................................
ENSMUSP00000045812  .....................-------------------......................................
ENSMUSP00000124712  .....................-----------DQSAILICkalsielldtgmwkvaekfr..................
ENSMUSP00000139411  .....................-------------------......................................
ENSMUSP00000074387  .....................-------------------......................................
ENSMUSP00000071863  .....................-------------------......................................
ENSMUSP00000080592  .....................-------------------......................................
ENSMUSP00000027139  .....................-------------------......................................
ENSMUSP00000085379  .....................-------------------......................................
ENSMUSP00000102413  .....................-------------------......................................
ENSMUSP00000034093  .....................-------------------......................................
ENSMUSP00000001059  .....................-------------------......................................
ENSMUSP00000110639  cgfsvkslyeritgrdghfkeDPYWENMLNHSVHRRLLHR......................................
ENSMUSP00000113418  cgfsvkslyeritgrdghfkeDPYWENMLNHSVHRRLLHR......................................
ENSMUSP00000033153  .....................-------------------......................................
ENSMUSP00000107982  .....................-------------------......................................
ENSMUSP00000094528  .....................-------------------......................................
ENSMUSP00000041880  .....................-------------------......................................
ENSMUSP00000124833  .....................-------------------......................................
ENSMUSP00000112491  .....................-------------------......................................
ENSMUSP00000112447  .....................-------------------......................................
ENSMUSP00000119471  .....................-----------DPEEEAEGaeesraatdpsv..........................
ENSMUSP00000051080  .....................-------------------......................................
ENSMUSP00000049034  .....................-------------------......................................
ENSMUSP00000137103  .....................-------------------......................................
ENSMUSP00000080888  .....................-------------------......................................
ENSMUSP00000107546  .....................------------GPQVYITasgavyilfgfgniqavalrdifvqaqnrdssppslqi
ENSMUSP00000107547  .....................------------GPQVYITasgavyilfgfgniqavalrdifvqaqnrdssppslqi
ENSMUSP00000117676  .....................-------------------......................................
ENSMUSP00000102412  .....................-------------------......................................
ENSMUSP00000025649  .............vsewkepqGKNISVASCNSSQVVVAVGralyylqihpqelrqishtemehevaclditplgdsng
ENSMUSP00000102411  .....................-------------------......................................
ENSMUSP00000055321  .....................-------------------......................................
ENSMUSP00000039427  .....................-------------------......................................
ENSMUSP00000102639  .....................-------------------......................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  lrscavdlgeycsleltdlafaqaldghcapsagtlfvcshsghileidhqrmsvqhvrrllparspgaplaekqnfs
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  eepewekhrsvnlselidvysdgvellqlvka..............................................
ENSMUSP00000107547  eepewekhrsvnlselidvysdgvellqlvka..............................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  lsplcaiglwtdisarilklpsfellhkem................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                          270       280        290                        300          310          
                            |         |          |                          |            |          
d1flga_               AGNPGPWNTWARTAKGGNPHDYD.SLYTSGQVGV.................DPSSG...EVKWFYQHTPNDAW.....
ENSMUSP00000045812  --------------------TGH.VIVTSSLDGTvraf.............DLHRY...RNFRTFTSPRP---.....
ENSMUSP00000065004  --------------------DRS.MIAAAGYQHIrmydl............NSNNP...NPIISYDGVS----.....
ENSMUSP00000136287  --------------------DRS.MIAAAGYQHIrmydl............NSNNP...NPIISYDGVS----.....
ENSMUSP00000122326  -------------K------DSK.RIATCSGDGFcii..............RTVDG...KLLHKYKHP-----.....
ENSMUSP00000135805  -------------K------DSK.RIATCSGDGFcii..............RTVDG...KLLHKYKHP-----.....
ENSMUSP00000115550  -------------K------DSK.RIATCSGDGFcii..............RTVDG...KLLHKYKHP-----.....
ENSMUSP00000117710  -------------K------DSK.RIATCSGDGFcii..............RTVDG...KLLHKYKHP-----.....
ENSMUSP00000041880  --------------------GNG.DVLTGDSGGVmliwsktmvepppg...KGPKGvy.QINRQIKAHD----.....
ENSMUSP00000107982  --------------------GNG.DVLTGDSGGVmliwsktmvepppg...KGPKGvy.QINRQIKAHD----.....
ENSMUSP00000094528  --------------------GNG.DVLTGDSGGVmliwsktmvepppg...KGPKGvy.QINRQIKAHD----.....
ENSMUSP00000118325  --------------------TDT.NIIVTCGKSHlyfwtlegn........SLNKK...QGLFEKQEKP----.....
ENSMUSP00000116772  NKVSCRVIALSFSE------DSS.YFVTVGNRHVrfwflea..........STE-A...KVTSTVPLVGRSGIlgelh
ENSMUSP00000103825  NKVSCRVIALSFSE------DSS.YFVTVGNRHVrfwflea..........STE-A...KVTSTVPLVGRSGIlgelh
ENSMUSP00000068516  MDPRVGIRSVCISP------NGQ.HLASGDRMGTlrih.............ELQSL...SEMLKVEAHD----.....
ENSMUSP00000048489  --------------------TVD.GVLVSTAGKTvkvw.............DVAKQ...QPLTELEAHK----.....
ENSMUSP00000051080  --------------------YQPnRMVSCGVKHIkfwtlcgnaltakrgi.FGKTG...DL------------.....
ENSMUSP00000057209  ------------DS------SGN.ILVWGK----.................----G...TNRISYAVQGAHE-.....
ENSMUSP00000112491  --------------------EGG.DVVTGDSGGNlyv..............WGKGG...NRITQEVQGAHD--.....
ENSMUSP00000105486  ------------DS------SGN.ILVWGK----.................----G...TNRISYAVQGAHE-.....
ENSMUSP00000069279  --------------------SPH.HLYCATLGGLllal.............NPASG...STVWKRSCGK----.....
ENSMUSP00000113792  --------------------SPH.HLYCATLGGLllal.............NPASG...STVWKRSCGK----.....
ENSMUSP00000105483  --------------------TDT.NIIVTCGKSHlyfwtlegn........SLNKK...QGLFEKQEKP----.....
ENSMUSP00000037654  --------------------TDPsLLITCGKSHIyfw..............SLEGGslsKRQGLFEKHEKP--.....
ENSMUSP00000131842  --------------------KEG.CLAFGTDDGKvgly.............DTCSN...KPPQISSTYHK---.....
ENSMUSP00000093960  -----------------------.ILTGDSEGNIltwgrsvsdsktpgrggAKETY...TIVAQAHAHE----.....
ENSMUSP00000078426  VGSGIAISSLSV--------STA.TCAVGSEDGYlrl..............WPLDF...SSVLLEAEHD----.....
ENSMUSP00000124804  --------------------RNN.VVYSTSGARInmw..............NLETS...KLVFCITGDVS---.....
ENSMUSP00000052465  MGHSASLTKIRYYGQ-----NGQ.QILSASQDGTlq...............SFSTV...HEKFNKSLGHGLVNkkivk
ENSMUSP00000125092  --------------------RNN.VVYSTSGARInmw..............NLETS...KLVFCITGDVSDPWvcval
ENSMUSP00000113309  GTFDATVYHMTVDG---------.----------.................----T...KLEKLFVEPR----.....
ENSMUSP00000029347  --------------------SEK.VLYTAGKQLIik...............PLQPN...AKVLQWKAHD----.....
ENSMUSP00000103442  --------------------SEK.VLYTAGKQLIik...............PLQPN...AKVLQWKAHD----.....
ENSMUSP00000133263  --------------------SEK.VLYTAGKQLIik...............PLQPN...AKVLQWKAHD----.....
ENSMUSP00000072509  T-------------------QRS.LLVVCSKYWRvf...............DAGDY...SLLCSGPSENGQTWtggdf
ENSMUSP00000117710  Q-------------------KKG.KVAFGHIDGSisifqp...........DEE--...--------------.....
ENSMUSP00000126736  --------------------DDR.AIAVCAGNKIsvm..............DVEKQ...SVLVELKGHQ----.....
ENSMUSP00000065643  --------------------SDT.QFVSVGIKHVkf...............WTLAG...RALLSKKGLLSSLE.....
ENSMUSP00000117489  --------------------SPH.HLYCATLGGL.................LLA-L...NPVWRFAAGG----.....
ENSMUSP00000119362  -----------------------.----------.................-----...--------------.....
ENSMUSP00000120285  --------------------PNG.CILALCESTLrvlehqg..........Q---G...QLEESKRFVATNC-.....
ENSMUSP00000045812  --------------------DGR.KFVVTK----.................----G...NIAQMYHAPGKKREfnafv
ENSMUSP00000124712  ARHNERFVSAVLSK------NGD.CIIATMENTPavffw............RRDTG...QCLASLQESS----.....
ENSMUSP00000139411  -----------------------.----------.................-----...-----FALHS----.....
ENSMUSP00000074387  -----------------------.----------.................-----...--------------.....
ENSMUSP00000071863  --------------------QDN.SQVCITGSGVfkllrfa..........EGT-L...KQINFQRGES----.....
ENSMUSP00000080592  --------------------QDN.SQVCITGSGVfkllrfa..........EGT-L...KQINFQRGES----.....
ENSMUSP00000027139  --------------------SGT.WLATVEQRQEnenelelqmklwnys..KKTQG...FVLNTKIAMPHD--.....
ENSMUSP00000085379  -----------------------.----------.................-----...--------------.....
ENSMUSP00000102413  --------------------SDG.ILYMGKKQDIwyvi.............DLLTG...EKQQTLSS------.....
ENSMUSP00000034093  --------------------GDD.VVLVGGKSLTtygl.............SAYSG...KLRYICSALG----.....
ENSMUSP00000001059  --------------------SDG.ILYMGKKQDIwyvi.............DLLTG...EKQQTLSS------.....
ENSMUSP00000110639  LGAVRYLMNIPGKA------GQD.LLLVTSEACVll...............DGQDL...EPRWTLGEV-----.....
ENSMUSP00000113418  LGAVRYLMNIPGKA------GQD.LLLVTSEACVll...............DGQDL...EPRWTLGEV-----.....
ENSMUSP00000033153  --------------------SDG.VFYTGRKQDAwfvv.............DPESG...ETQMTLTTEGL---.....
ENSMUSP00000107982  -----------------------.----------.................-----...--------------.....
ENSMUSP00000094528  -----------------------.----------.................-----...--------------.....
ENSMUSP00000041880  -----------------------.----------.................-----...--------------.....
ENSMUSP00000124833  --------------------DDS.LLVAGFGRFVrifla............DSQGFh..RFMASDLEHE----.....
ENSMUSP00000112491  -----------------------.----------.................-----...--------------.....
ENSMUSP00000112447  -----------------------.----------.................-----...--------------.....
ENSMUSP00000119471  TVHPTVCLGLQ---------DGS.ILLYGS----.................-VDTGt..QCLATCKSPGP---.....
ENSMUSP00000051080  -----------------------.----------.................-----...--------------.....
ENSMUSP00000049034  ------------LQ------ESV.RYIAVLKKTTltlh.............HLSSG...HLKWVEHLPESD--.....
ENSMUSP00000137103  ------------LQ------ESV.RYIAVLKKTTltlh.............HLSSG...HLKWVEHLPESD--.....
ENSMUSP00000080888  ------------LQ------ESV.RYIAVLKKTTltlh.............HLSSG...HLKWVEHLPESD--.....
ENSMUSP00000107546  P-----------DS------NSS.SLLITTRQGLvll..............RGQDL...TPHWKLNLQGLR--.....
ENSMUSP00000107547  P-----------DS------NSS.SLLITTRQGLvll..............RGQDL...TPHWKLNLQGLR--.....
ENSMUSP00000117676  -----------------------.----------.................-----...--------------.....
ENSMUSP00000102412  -----------------------.----------.................-----...--------------.....
ENSMUSP00000025649  LGGEIIPRSILMTTFE----SSH.YLLCALGDGAlfyfgl...........NIETG...LLSDRKKVTLGTQPtvlrt
ENSMUSP00000102411  -----------------------.----------.................-----...--------------.....
ENSMUSP00000055321  --------------------VHK.VLVVGSTQESlhg..............FTHKG...KKLWTVQMP-----.....
ENSMUSP00000039427  -----------------------.----------.................-----...--------------.....
ENSMUSP00000102639  -----------------------.----------.................-----...--------------.....


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  nnifcgvacgrgrmagntfcvsysgllcqfnekrvldkwinlkvslssclcvsdelifcgctdgivrifqahsllylt
ENSMUSP00000103825  nnifcgvacgrgrmagntfcvsysgllcqfnekrvldkwinlkvslssclcvsdelifcgctdgivrifqahsllylt
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  rkglqntmsvrlppitqfaaeearqsdwdgiiachqgkrscstwnyqrstigayflkprgvktn..............
ENSMUSP00000125092  laaqglllalskggqvslwssamgklqekhqlssikeetptcavsiqsrarlvagfssgsialvsagedrlleklpea
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  vsadkviiwtengqsyiyklpasclpasdsfrsdvgkavenlippvqhslldqk........................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ldktyfg.......................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  frslsttnvfacsdrptviyssnhklvfsnvnlkevnymcplns..................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  nlpkphylgvdvahgldssflfhrkaeavypdtvaltfdpvhqwlscvykdhsiyiwdvkdidevskiwselfhssfv
ENSMUSP00000103825  nlpkphylgvdvahgldssflfhrkaeavypdtvaltfdpvhqwlscvykdhsiyiwdvkdidevskiwselfhssfv
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  vgflvvseddsllvagfgrfvrifladsqgfhrfmasdle......................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  wnvevypefedqraclpsgtfltcssdntirfwnldsasdtrwqknifsdsllkvvyvendiqhlqdlshfpdrgsen
ENSMUSP00000103825  wnvevypefedqraclpsgtfltcssdntirfwnldsasdtrwqknifsdsllkvvyvendiqhlqdlshfpdrgsen
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                             320                                                                    
                               |                                                                    
d1flga_               .....DFSGNNELVLFD.............................................................
ENSMUSP00000045812  .....--TQFSCVAVDS.............................................................
ENSMUSP00000065004  .....--KNIASVGFHE.............................................................
ENSMUSP00000136287  .....--KNIASVGFHE.............................................................
ENSMUSP00000122326  .....--AAVFGCDWSQ.............................................................
ENSMUSP00000135805  .....--AAVFGCDWSQ.............................................................
ENSMUSP00000115550  .....--AAVFGCDWSQ.............................................................
ENSMUSP00000117710  .....--AAVFGCDWSQ.............................................................
ENSMUSP00000041880  .....--GSVFTLCQMR.............................................................
ENSMUSP00000107982  .....--GSVFTLCQMR.............................................................
ENSMUSP00000094528  .....--GSVFTLCQMR.............................................................
ENSMUSP00000118325  .....--KFVLCVTFSE.............................................................
ENSMUSP00000116772  gtpmdMKAGVRVMQVSP.............................................................
ENSMUSP00000103825  gtpmdMKAGVRVMQVSP.............................................................
ENSMUSP00000068516  .....--SEILCLEYSK.............................................................
ENSMUSP00000048489  .....--DLVQSAVWSR.............................................................
ENSMUSP00000051080  .....--QTILCLACA-.............................................................
ENSMUSP00000057209  .....--GGIFALCMLR.............................................................
ENSMUSP00000112491  .....--GGVFALCALR.............................................................
ENSMUSP00000105486  .....--GGIFALCMLR.............................................................
ENSMUSP00000069279  .....--PLFSSPRC--.............................................................
ENSMUSP00000113792  .....--PLFSSPRC--.............................................................
ENSMUSP00000105483  .....--KFVLCVTFSE.............................................................
ENSMUSP00000037654  .....--KYVLCVTFLE.............................................................
ENSMUSP00000131842  .....--KTVYRLAWGPpvppmslggegdrpsltlyscggegvvlqhnpwklsgeafdinklvrdtnsiryklpvhte
ENSMUSP00000093960  .....--GSIFALCLRR.............................................................
ENSMUSP00000078426  .....--GPVSSVSFSP.............................................................
ENSMUSP00000124804  .....--DPWVCVALLA.............................................................
ENSMUSP00000052465  .....SNLTATAVDITS.............................................................
ENSMUSP00000125092  .....HEDMVETAVLGP.............................................................
ENSMUSP00000113309  .....--DAVYAVSCHP.............................................................
ENSMUSP00000029347  .....--GIILKVDWNS.............................................................
ENSMUSP00000103442  .....--GIILKVDWNS.............................................................
ENSMUSP00000133263  .....--GIILKVDWNS.............................................................
ENSMUSP00000072509  .....DKELVICPPVTR.............................................................
ENSMUSP00000117710  .....--DPVTALEWDP.............................................................
ENSMUSP00000126736  .....--GSVTAVEFCP.............................................................
ENSMUSP00000065643  .....DARMQTMLAVAF.............................................................
ENSMUSP00000117489  .....--PIFSSPCVSA.............................................................
ENSMUSP00000119362  .....------------.............................................................
ENSMUSP00000120285  .....--CSPITCCFTS.............................................................
ENSMUSP00000045812  .....PYDETTCIDWTD.............................................................
ENSMUSP00000124712  .....--GTIVKLVKSS.............................................................
ENSMUSP00000139411  .....--ASVFCVSLDP.............................................................
ENSMUSP00000074387  .....-------VCFNH.............................................................
ENSMUSP00000071863  .....--SNYLAHAWV-.............................................................
ENSMUSP00000080592  .....--SNYLAHAWV-.............................................................
ENSMUSP00000027139  .....--DHITALCFNN.............................................................
ENSMUSP00000085379  .....-------VCFNH.............................................................
ENSMUSP00000102413  .....--AFADSLCP--.............................................................
ENSMUSP00000034093  .....--CRRWDSDEME.............................................................
ENSMUSP00000001059  .....--AFADSLCP--.............................................................
ENSMUSP00000110639  .....--QVLRKPILGH.............................................................
ENSMUSP00000113418  .....--QVLRKPILGH.............................................................
ENSMUSP00000033153  .....------------.............................................................
ENSMUSP00000107982  .....------------.............................................................
ENSMUSP00000094528  .....------------.............................................................
ENSMUSP00000041880  .....------------.............................................................
ENSMUSP00000124833  .....--DMVETAVLGP.............................................................
ENSMUSP00000112491  .....------------.............................................................
ENSMUSP00000112447  .....------------.............................................................
ENSMUSP00000119471  .....--QPVLCLRHSP.............................................................
ENSMUSP00000051080  .....-------MKFSP.............................................................
ENSMUSP00000049034  .....--SILYQMVYSY.............................................................
ENSMUSP00000137103  .....--SILYQMVYSY.............................................................
ENSMUSP00000080888  .....--SILYQMVYSY.............................................................
ENSMUSP00000107546  .....--SQPTPGYFTD.............................................................
ENSMUSP00000107547  .....--SQPTPGYFTD.............................................................
ENSMUSP00000117676  .....------------.............................................................
ENSMUSP00000102412  .....------------.............................................................
ENSMUSP00000025649  .....D-GYPDSLALAN.............................................................
ENSMUSP00000102411  .....------------.............................................................
ENSMUSP00000055321  .....--AAILTMNLLE.............................................................
ENSMUSP00000039427  .....------------.............................................................
ENSMUSP00000102639  .....------------.............................................................


                        330        340                                                              
                          |          |                                                              
d1flga_               ..YKAK.DGKIVKATAHADR.N........................................................
ENSMUSP00000045812  ..----.SGE---IVSAGAQ.D........................................................
ENSMUSP00000065004  ..----.DGR---WMYTGGE.D........................................................
ENSMUSP00000136287  ..----.DGR---WMYTGGE.D........................................................
ENSMUSP00000122326  ..N---.NKD---MIATGCE.D........................................................
ENSMUSP00000135805  ..N---.NKD---MIATGCE.D........................................................
ENSMUSP00000115550  ..N---.NKD---MIATGCE.D........................................................
ENSMUSP00000117710  ..N---.NKD---MIATGCE.D........................................................
ENSMUSP00000041880  ..----.NGM---LLTGGGK.D........................................................
ENSMUSP00000107982  ..----.NGM---LLTGGGK.D........................................................
ENSMUSP00000094528  ..----.NGM---LLTGGGK.D........................................................
ENSMUSP00000118325  ..----.NGD----TITGDS.S........................................................
ENSMUSP00000116772  ..----.DGQ---HLASGDR.S........................................................
ENSMUSP00000103825  ..----.DGQ---HLASGDR.S........................................................
ENSMUSP00000068516  ..----.PDTGLKLLASASR.D........................................................
ENSMUSP00000048489  ..----.DGA---IVGTACK.D........................................................
ENSMUSP00000051080  ..----.KED---ITYSGAL.N........................................................
ENSMUSP00000057209  ..----.DGT----LVSGGGkD........................................................
ENSMUSP00000112491  ..----.DGT----LVSGGGrD........................................................
ENSMUSP00000105486  ..----.DGT----LVSGGGkD........................................................
ENSMUSP00000069279  ..----.YQQ---YICIGCV.D........................................................
ENSMUSP00000113792  ..----.YQQ---YICIGCV.D........................................................
ENSMUSP00000105483  ..----.NGD----TITGDS.S........................................................
ENSMUSP00000037654  ..----.GGD----VVTGDS.G........................................................
ENSMUSP00000131842  isWKG-.DGK---VLALGNE.D........................................................
ENSMUSP00000093960  ..----.DGT---VLSGGGR.D........................................................
ENSMUSP00000078426  ..----.DGL---RVLSTTT.S........................................................
ENSMUSP00000124804  ..----.AQG---LLLALSK.G........................................................
ENSMUSP00000052465  ..----.CGN---FAIIGLS.S........................................................
ENSMUSP00000125092  ..----.ENN---LIITGSR.D........................................................
ENSMUSP00000113309  ..----.YQP---LIAVGSV.C........................................................
ENSMUSP00000029347  ..----.VND---LILSAGE.D........................................................
ENSMUSP00000103442  ..----.VND---LILSAGE.D........................................................
ENSMUSP00000133263  ..----.VND---LILSAGE.D........................................................
ENSMUSP00000072509  ..FFYGcKEYLHKLLIQGDS.S........................................................
ENSMUSP00000117710  ..L---.STD---YLLVANL.H........................................................
ENSMUSP00000126736  ..W---.QAH---TLISVSE.D........................................................
ENSMUSP00000065643  ..G---.ANN---LTFTGTI.S........................................................
ENSMUSP00000117489  ..----.AEQ---EIFFGSH.D........................................................
ENSMUSP00000119362  ..----.-------------.-........................................................
ENSMUSP00000120285  ..L---.EEN---LLYAGNK.V........................................................
ENSMUSP00000045812  ..----.DSK---CFVVGSK.D........................................................
ENSMUSP00000124712  ..----.HHN---MLLSLST.S........................................................
ENSMUSP00000139411  ..K---.TNT---LAVTGGE.D........................................................
ENSMUSP00000074387  ..----.DNT---LLATGGT.D........................................................
ENSMUSP00000071863  ..----.SED---RVIVGTD.T........................................................
ENSMUSP00000080592  ..----.SED---RVIVGTD.T........................................................
ENSMUSP00000027139  ..A---.ESYEKPILVTASR.D........................................................
ENSMUSP00000085379  ..----.DNT---LLATGGT.D........................................................
ENSMUSP00000102413  ..----.STS---LLYLGRT.E........................................................
ENSMUSP00000034093  ..E---.EED---ILLLQRT.Q........................................................
ENSMUSP00000001059  ..----.STS---LLYLGRT.E........................................................
ENSMUSP00000110639  ..Y---.KPD---TLAVVIE.N........................................................
ENSMUSP00000113418  ..Y---.KPD---TLAVVIE.N........................................................
ENSMUSP00000033153  ..----.---STPQLFIGRT.Q........................................................
ENSMUSP00000107982  ..----.-------------.-........................................................
ENSMUSP00000094528  ..----.-------------.-........................................................
ENSMUSP00000041880  ..----.-------------.-........................................................
ENSMUSP00000124833  ..----.ENN---LIITGSR.D........................................................
ENSMUSP00000112491  ..----.-------------.-........................................................
ENSMUSP00000112447  ..----.-------------.-........................................................
ENSMUSP00000119471  ..F---.------YLLAGLQ.D........................................................
ENSMUSP00000051080  ..----.DGS---YLAVGSN.D........................................................
ENSMUSP00000049034  ..----.GSG---VVWALGI.V........................................................
ENSMUSP00000137103  ..----.GSG---VVWALGI.V........................................................
ENSMUSP00000080888  ..----.GSG---VVWALGI.V........................................................
ENSMUSP00000107546  ..----.DQ-TLDFLLQTQDgD........................................................
ENSMUSP00000107547  ..----.DQ-TLDFLLQTQDgD........................................................
ENSMUSP00000117676  ..----.-------------.-........................................................
ENSMUSP00000102412  ..----.-------------.-........................................................
ENSMUSP00000025649  ..----.NST----LTIGTI.Deiqklhirtvplyesprkicyqevsqcfgvlssrievqdssggttalrpsastqal
ENSMUSP00000102411  ..----.-------------.-........................................................
ENSMUSP00000055321  ..Q---.RSRGLQAVMAALA.N........................................................
ENSMUSP00000039427  ..----.-------------.-........................................................
ENSMUSP00000102639  ..----.-------------.-........................................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  sssvsssklfssstaphetsfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvype
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                   350                          360                                 
                                     |                            |                                 
d1flga_               ......GF.....FYVV......DR..........S..NG.KLQNAF...............................
ENSMUSP00000045812  ......SFe....IFVW......SM..........Q..TG.RLLDV-...............................
ENSMUSP00000065004  ......CT.....ARIW......DL..........R..SR.NLQCQR...............................
ENSMUSP00000136287  ......CT.....ARIW......DL..........R..SR.NLQCQR...............................
ENSMUSP00000122326  ......KN.....IRVF......YV..........AtsSN.QPLKV-...............................
ENSMUSP00000135805  ......KN.....IRVF......YV..........AtsSN.QPLKV-...............................
ENSMUSP00000115550  ......KN.....IRVF......YV..........AtsSN.QPLKV-...............................
ENSMUSP00000117710  ......KN.....IRVF......YV..........AtsSN.QPLKV-...............................
ENSMUSP00000041880  ......RK.....IILW......D-..........H..DL.NLEREI...............................
ENSMUSP00000107982  ......RK.....IILW......D-..........H..DL.NLEREI...............................
ENSMUSP00000094528  ......RK.....IILW......D-..........H..DL.NLEREI...............................
ENSMUSP00000118325  ......GN.....ILVW......GK..........G..TN.RISYA-...............................
ENSMUSP00000116772  ......GN.....LRIH......EL..........H..FM.DELIK-...............................
ENSMUSP00000103825  ......GN.....LRIH......EL..........H..FM.DELIK-...............................
ENSMUSP00000068516  ......RL.....IHVL......DA..........Gr.EY.SLQQT-...............................
ENSMUSP00000048489  ......KQ.....LRIF......DP..........R..AR.TQASQStqahennrdirlawtgiqehlvstgfnqmre
ENSMUSP00000051080  ......GD.....IYVW......--..........K..GL.TLVRT-...............................
ENSMUSP00000057209  ......RR.....LISW......N-..........G..NY.QKLHKA...............................
ENSMUSP00000112491  ......RR.....VVLW......G-..........S..DY.SKVQEV...............................
ENSMUSP00000105486  ......RR.....LISW......N-..........G..NY.QKLHKA...............................
ENSMUSP00000069279  ......GS.....LLCF......T-..........H..SG.EQVWR-...............................
ENSMUSP00000113792  ......GS.....LLCF......T-..........H..SG.EQVWR-...............................
ENSMUSP00000105483  ......GN.....ILVW......GK..........G..TN.RISYA-...............................
ENSMUSP00000037654  ......GN.....LYVW......G-..........K..GG.NRITQE...............................
ENSMUSP00000131842  ......GS.....IEIF......QV..........P..NL.RLLCT-...............................
ENSMUSP00000093960  ......RR.....LVQW......G-..........P..GL.VALQEA...............................
ENSMUSP00000078426  ......GH.....LGFL......DV..........P..SR.EYTVL-...............................
ENSMUSP00000124804  ......GQ.....VSLW......SS..........A..MG.KLQEKHqlssikeetptcav.................
ENSMUSP00000052465  ......GA.....VDVY......NM..........Q..SG.IHRGN-...............................
ENSMUSP00000125092  ......AL.....IQVW......SL..........Se.QG.TLLNV-...............................
ENSMUSP00000113309  ......GM.....IKVW......DF..........E..KK.VYLFSR...............................
ENSMUSP00000029347  ......CK.....YKVW......D-..........S..YG.RVLYG-...............................
ENSMUSP00000103442  ......CK.....YKVW......D-..........S..YG.RVLYG-...............................
ENSMUSP00000133263  ......CK.....YKVW......D-..........S..YG.RVLYG-...............................
ENSMUSP00000072509  ......GR.....LNIW......NI..........A..DI.AEKQE-...............................
ENSMUSP00000117710  ......FG.....IRLL......DS..........E..SL.YCITTF...............................
ENSMUSP00000126736  ......RS.....FKVW......DF..........C..VG.SLIYSS...............................
ENSMUSP00000065643  ......GD.....VCVW......K-..........D..HI.LCRVV-...............................
ENSMUSP00000117489  ......CF.....IYCC......S-..........K..EG.HLRWK-...............................
ENSMUSP00000119362  ......--.....----......--..........-..--.------...............................
ENSMUSP00000120285  ......GE.....VYVW......TF..........P..QS.QSLHS-...............................
ENSMUSP00000045812  ......MS.....TWVF......GA..........E..RW.DNLIYY...............................
ENSMUSP00000124712  ......GV.....LSIW......DIdiitamsnidK..TG.KPIQSL...............................
ENSMUSP00000139411  ......DK.....AFVW......RL..........G..DG.ELLFE-...............................
ENSMUSP00000074387  ......GH.....VRVW......KV..........P..SL.EKVLE-...............................
ENSMUSP00000071863  ......GK.....LFLF......--..........E..SG.DQRWETsimvkestssrsleviqesesliefpplssp
ENSMUSP00000080592  ......GK.....LFLF......--..........E..SG.DQRWETsimvkestssrsleviqesesliefpplssp
ENSMUSP00000027139  ......GH.....FKVWiltddsDI..........Y..KK.AIAWTC...............................
ENSMUSP00000085379  ......GH.....VRVW......KV..........P..SL.EKVLE-...............................
ENSMUSP00000102413  ......YT.....ITMY......DT..........K..TR.ELRWNA...............................
ENSMUSP00000034093  ......KT.....VRAV......GP..........R..SG.SEKWN-...............................
ENSMUSP00000001059  ......YT.....ITMY......DT..........K..TR.ELRWNA...............................
ENSMUSP00000110639  ......GTsidrqILLL......DL..........S..TG.SILWSQ...............................
ENSMUSP00000113418  ......GTsidrqILLL......DL..........S..TG.SILWSQ...............................
ENSMUSP00000033153  ......YT.....VSMH......DL..........R..TP.ALRWNT...............................
ENSMUSP00000107982  ......--.....----......--..........-..--.------...............................
ENSMUSP00000094528  ......--.....----......--..........-..--.------...............................
ENSMUSP00000041880  ......--.....----......--..........-..--.------...............................
ENSMUSP00000124833  ......AL.....IQVW......SL..........Se.QG.TLLNV-...............................
ENSMUSP00000112491  ......--.....----......--..........-..--.------...............................
ENSMUSP00000112447  ......--.....----......--..........-..--.------...............................
ENSMUSP00000119471  ......GT.....LAAY......PR..........T..SG.DIPWD-...............................
ENSMUSP00000051080  ......GP.....VDVY......AV..........A..QRyKKIGE-...............................
ENSMUSP00000049034  ......PFshvn.IVKF......NV..........E..DG.EIVQQ-...............................
ENSMUSP00000137103  ......PFshvn.IVKF......NV..........E..DG.EIVQQ-...............................
ENSMUSP00000080888  ......PFshvn.IVKF......NV..........E..DG.EIVQQ-...............................
ENSMUSP00000107546  ......GMkk...MTVV......DG..........G..SG.SIVWSY...............................
ENSMUSP00000107547  ......GMkk...MTVV......DG..........G..SG.SIVWSY...............................
ENSMUSP00000117676  ......--.....----......--..........-..--.------...............................
ENSMUSP00000102412  ......--.....----......--..........-..--.------...............................
ENSMUSP00000025649  eaepkqGR.....IVVF......QY..........S..DG.KLQTVA...............................
ENSMUSP00000102411  ......--.....----......--..........-..--.------...............................
ENSMUSP00000055321  ......GE.....VRIY......--..........R..DK.ALLNV-...............................
ENSMUSP00000039427  ......--.....----......--..........-..--.------...............................
ENSMUSP00000102639  ......--.....----......--..........-..--.------...............................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  reaklwdtrlfssalasvtldtspgpliplldpdsgllvlagkgenqlycyevtpqqpalspvtqcilenvlrgaalv
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  vs............................................................................
ENSMUSP00000080592  vs............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  prralavmscevlqvlqlsdtaiipishhvprkavefhedlfpdtagsvpasdahmwwagdnqqvqkvslnparrphp
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  cftsslvptmepapdmvqpaempradtdlsegfsspsslmspstpsslgpslsstsgigtspsqrslqsllgpsskfr
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                                            370     
                                                                                              |     
d1flga_               .................................................................PFVDNITWASHI.
ENSMUSP00000045812  .................................................................-LSG--------.
ENSMUSP00000065004  .................................................................IFQV--------.
ENSMUSP00000136287  .................................................................IFQV--------.
ENSMUSP00000122326  .................................................................-FSG--------.
ENSMUSP00000135805  .................................................................-FSG--------.
ENSMUSP00000115550  .................................................................-FSG--------.
ENSMUSP00000117710  .................................................................-FSG--------.
ENSMUSP00000041880  .................................................................EVPDQYGTIRAVa
ENSMUSP00000107982  .................................................................EVPDQYGTIRAVa
ENSMUSP00000094528  .................................................................EVPDQYGTIRAVa
ENSMUSP00000118325  .................................................................-VQG--------.
ENSMUSP00000116772  .................................................................-VEA--------.
ENSMUSP00000103825  .................................................................-VEA--------.
ENSMUSP00000068516  .................................................................-LDE--------.
ENSMUSP00000048489  htqgsllhrdshitnlkglnlttpgesdgfcanrlrvavpllssggqvavlelqkpgrlpdtalpTLQN--------.
ENSMUSP00000051080  .................................................................-IQG--------.
ENSMUSP00000057209  .................................................................EIPEQFGPIRTVa
ENSMUSP00000112491  .................................................................EVPEDFGPVRTVa
ENSMUSP00000105486  .................................................................EIPEQFGPIRTVa
ENSMUSP00000069279  .................................................................-FAA--------.
ENSMUSP00000113792  .................................................................-FAA--------.
ENSMUSP00000105483  .................................................................-VQG--------.
ENSMUSP00000037654  .................................................................VQGA--------.
ENSMUSP00000131842  .................................................................-IQQ--------.
ENSMUSP00000093960  .................................................................EIPEHFGAVRAIa
ENSMUSP00000078426  .................................................................-ARS--------.
ENSMUSP00000124804  .................................................................S----------Iq
ENSMUSP00000052465  .................................................................-FGD--------.
ENSMUSP00000125092  .................................................................-LEG--------.
ENSMUSP00000113309  .................................................................TFEK--------.
ENSMUSP00000029347  .................................................................-SQP--------.
ENSMUSP00000103442  .................................................................-SQP--------.
ENSMUSP00000133263  .................................................................-SQP--------.
ENSMUSP00000072509  .................................................................-ADEGLKMTTCIs
ENSMUSP00000117710  .................................................................NLPS--------.
ENSMUSP00000126736  .................................................................SILT--------.
ENSMUSP00000065643  .................................................................-ARA--------.
ENSMUSP00000117489  .................................................................-FET--------.
ENSMUSP00000119362  .................................................................------------.
ENSMUSP00000120285  .................................................................-FRA--------.
ENSMUSP00000045812  .................................................................ALSG--------.
ENSMUSP00000124712  .................................................................VLPA--------.
ENSMUSP00000139411  .................................................................-CAG--------.
ENSMUSP00000074387  .................................................................-FKA--------.
ENSMUSP00000071863  .................................................................S----------Ve
ENSMUSP00000080592  .................................................................S----------Ve
ENSMUSP00000027139  .................................................................DFVG--------.
ENSMUSP00000085379  .................................................................-FKA--------.
ENSMUSP00000102413  .................................................................TYFD--------.
ENSMUSP00000034093  .................................................................-FSV--------.
ENSMUSP00000001059  .................................................................TYFD--------.
ENSMUSP00000110639  .................................................................PLPS--------.
ENSMUSP00000113418  .................................................................PLPS--------.
ENSMUSP00000033153  .................................................................TYRR--------.
ENSMUSP00000107982  .................................................................------------.
ENSMUSP00000094528  .................................................................------------.
ENSMUSP00000041880  .................................................................------------.
ENSMUSP00000124833  .................................................................-LEG--------.
ENSMUSP00000112491  .................................................................------------.
ENSMUSP00000112447  .................................................................------------.
ENSMUSP00000119471  .................................................................------------.
ENSMUSP00000051080  .................................................................-CNK--------.
ENSMUSP00000049034  .................................................................-VRV--------.
ENSMUSP00000137103  .................................................................-VRV--------.
ENSMUSP00000080888  .................................................................-VRV--------.
ENSMUSP00000107546  .................................................................SIPC--------.
ENSMUSP00000107547  .................................................................SIPC--------.
ENSMUSP00000117676  .................................................................------------.
ENSMUSP00000102412  .................................................................------------.
ENSMUSP00000025649  .................................................................EKEV--------.
ENSMUSP00000102411  .................................................................------------.
ENSMUSP00000055321  .................................................................-IHA--------.
ENSMUSP00000039427  .................................................................------------.
ENSMUSP00000102639  .................................................................------------.


                                                                                             380    
                                                                                               |    
d1flga_               ....................................................................DLKTGRPVER
ENSMUSP00000045812  ....................................................................----------
ENSMUSP00000065004  ....................................................................----------
ENSMUSP00000136287  ....................................................................----------
ENSMUSP00000122326  ....................................................................----------
ENSMUSP00000135805  ....................................................................----------
ENSMUSP00000115550  ....................................................................----------
ENSMUSP00000117710  ....................................................................----------
ENSMUSP00000041880  .................................................egraeqflvgtsrnfilrgTFNDGFQIEV
ENSMUSP00000107982  .................................................egraeqflvgtsrnfilrgTFNDGFQIEV
ENSMUSP00000094528  .................................................egraeqflvgtsrnfilrgTFNDGFQIEV
ENSMUSP00000118325  ....................................................................-------A--
ENSMUSP00000116772  ....................................................................----------
ENSMUSP00000103825  ....................................................................----------
ENSMUSP00000068516  ....................................................................----------
ENSMUSP00000048489  ....................................................................----------
ENSMUSP00000051080  ....................................................................-------A--
ENSMUSP00000057209  .............................................egkgnviligttrnfvlqgtlsgDFT-------
ENSMUSP00000112491  .................................................egrgdtlyvgttrnsillgSVHTGFSLLV
ENSMUSP00000105486  .............................................egkgnviligttrnfvlqgtlsgDFT-------
ENSMUSP00000069279  ....................................................................----------
ENSMUSP00000113792  ....................................................................----------
ENSMUSP00000105483  ....................................................................-------A--
ENSMUSP00000037654  ....................................................................----------
ENSMUSP00000131842  ....................................................................----------
ENSMUSP00000093960  .................................................eglgsellvgttknallrgDLAQGFSP--
ENSMUSP00000078426  ....................................................................----------
ENSMUSP00000124804  srarlvagfssgsialvsagedrlleklpeavgflvvseddsllvagfgrfvrifladsqgfhrfmasDLE-------
ENSMUSP00000052465  ....................................................................----------
ENSMUSP00000125092  ....................................................................----------
ENSMUSP00000113309  ....................................................................----------
ENSMUSP00000029347  ....................................................................----------
ENSMUSP00000103442  ....................................................................----------
ENSMUSP00000133263  ....................................................................----------
ENSMUSP00000072509  ....................................................lqeafdklkpcpagiiDQLSVIPNSN
ENSMUSP00000117710  ....................................................................----------
ENSMUSP00000126736  ....................................................................----------
ENSMUSP00000065643  ....................................................................----------
ENSMUSP00000117489  ....................................................................----------
ENSMUSP00000119362  ....................................................................----------
ENSMUSP00000120285  ....................................................................----------
ENSMUSP00000045812  ....................................................................----------
ENSMUSP00000124712  ....................................................................----------
ENSMUSP00000139411  ....................................................................----------
ENSMUSP00000074387  ....................................................................----------
ENSMUSP00000071863  ...........rmdittntqqqampqvfaiaayskgfacsagpgrvllfekveekdfyresreiriptD---------
ENSMUSP00000080592  ...........rmdittntqqqampqvfaiaayskgfacsagpgrvllfekveekdfyresreiriptD---------
ENSMUSP00000027139  ....................................................................----------
ENSMUSP00000085379  ....................................................................----------
ENSMUSP00000102413  ....................................................................----------
ENSMUSP00000034093  ....................................................................--GHFELRYI
ENSMUSP00000001059  ....................................................................----------
ENSMUSP00000110639  ....................................................................----------
ENSMUSP00000113418  ....................................................................----------
ENSMUSP00000033153  ....................................................................----------
ENSMUSP00000107982  ....................................................................----------
ENSMUSP00000094528  ....................................................................----------
ENSMUSP00000041880  ....................................................................----------
ENSMUSP00000124833  ....................................................................----------
ENSMUSP00000112491  ....................................................................----------
ENSMUSP00000112447  ....................................................................----------
ENSMUSP00000119471  ....................................................................----------
ENSMUSP00000051080  ....................................................................----------
ENSMUSP00000049034  ....................................................................----------
ENSMUSP00000137103  ....................................................................----------
ENSMUSP00000080888  ....................................................................----------
ENSMUSP00000107546  ....................................................................----------
ENSMUSP00000107547  ....................................................................----------
ENSMUSP00000117676  ....................................................................----------
ENSMUSP00000102412  ....................................................................----------
ENSMUSP00000025649  ....................................................................----------
ENSMUSP00000102411  ....................................................................----------
ENSMUSP00000055321  ....................................................................----------
ENSMUSP00000039427  ....................................................................----------
ENSMUSP00000102639  ....................................................................----------


                         390       400       410         420               430                      
                           |         |         |           |                 |                      
d1flga_               EGQRPPLPEPGQKHGKAVEVSPPFLGGKNW..NPMAYSQ.......DTG.LFYVPAN.H......WKEDYWT......
ENSMUSP00000045812  -----------------------H--EGPV..SGLCFNP.......MKS.ILASASW.D......KTVRLWD......
ENSMUSP00000065004  --------------------------NAPI..NCVCLHP.......NQA.ELIVGDQ.S......GAIHIWD......
ENSMUSP00000136287  --------------------------NAPI..NCVCLHP.......NQA.ELIVGDQ.S......GAIHIWD......
ENSMUSP00000122326  -----------------------H--TARV..FHVKWSPl......REG.ILCSGSD.D......GSVRIWD......
ENSMUSP00000135805  -----------------------H--TARV..FHVKWSPl......REG.ILCSGSD.D......GSVRIWD......
ENSMUSP00000115550  -----------------------H--TARV..FHVKWSPl......REG.ILCSGSD.D......GSVRIWD......
ENSMUSP00000117710  -----------------------H--TARV..FHVKWSPl......REG.ILCSGSD.D......GSVRIWD......
ENSMUSP00000041880  QG---------------------H--TDEL..WGLATHP.......FKD.LLLTCAQ.D......RQVCMWN......
ENSMUSP00000107982  QG---------------------H--TDEL..WGLATHP.......FKD.LLLTCAQ.D......RQVCMWN......
ENSMUSP00000094528  QG---------------------H--TDEL..WGLATHP.......FKD.LLLTCAQ.D......RQVCMWN......
ENSMUSP00000118325  -----------------------H--EGGI..FALCMLR.......DGT.LVSGGGK.D......RRLISWN......
ENSMUSP00000116772  -----------------------H--DAEV..LCLEYSKpet....GVT.LLASASR.D......RLIHVLN......
ENSMUSP00000103825  -----------------------H--DAEV..LCLEYSKpet....GVT.LLASASR.D......RLIHVLN......
ENSMUSP00000068516  -----------------------H--SSSI..TAVKFAAs......DGQvRMISCGA.D......KSIYFRT......
ENSMUSP00000048489  --------------------------GTAV..MDLVWDPf......DPH.RLAVAGE.D......ARIRLWR......
ENSMUSP00000051080  -----------------------H--SAGI..FSLYAC-.......-EE.GFATGGR.D......GCIRLWD......
ENSMUSP00000057209  ------------------PITQGH--TDEL..WGLAIHA.......SKP.QFLTCGH.D......KHATLWD......
ENSMUSP00000112491  QG---------------------H--VEEL..WGLATHP.......SRA.QFVTCGQ.D......KLVHLWS......
ENSMUSP00000105486  ------------------PITQGH--TDEL..WGLAIHA.......SKP.QFLTCGH.D......KHATLWD......
ENSMUSP00000069279  --------------------------GGPIf.SSPCVSA.......AEQ.EIFFGSH.D......CFIYCCS......
ENSMUSP00000113792  --------------------------GGPIf.SSPCVSA.......AEQ.EIFFGSH.D......CFIYCCS......
ENSMUSP00000105483  -----------------------H--EGGI..FALCMLR.......DGT.LVSGGGK.D......RRLISWN......
ENSMUSP00000037654  -----------------------H--DGGV..FALCALR.......DGT.LVSGGGR.D......RRVVLWG......
ENSMUSP00000131842  -----------------------H--HKLV..NAIVWHHehgsrpeLSC.LLASGSN.N......AVIYVHN......
ENSMUSP00000093960  -------------------VIQGH--TDEL..WGLCTHP.......SQN.RFLTCGH.D......RQLCLWD......
ENSMUSP00000078426  -----------------------H--MAPV..LALSTEP.......NRG.QMATVSL.D......HTVRIWD......
ENSMUSP00000124804  -----------------------H--EDMV..ETAVLGP.......ENN.LIITGSR.D......ALIQVWD......
ENSMUSP00000052465  --------------------DKAH--TGSV..RGVAVDG.......LNQ.LVVTAGS.E......RLLKFWN......
ENSMUSP00000125092  --------------------------VGAP..VSLLVR-.......GGT.LVVSASRkS......SSFKVWD......
ENSMUSP00000113309  --------------------------GLGV..QCLTYNP.......EGA.LLGAGFT.E......GTVYILD......
ENSMUSP00000029347  -----------------------H--EHPI..TSVAWAP.......DGE.LFAVGSF.-......HTLRLCD......
ENSMUSP00000103442  -----------------------H--EHPI..TSVAWAP.......DGE.LFAVGSF.-......HTLRLCD......
ENSMUSP00000133263  -----------------------H--EHPI..TSVAWAP.......DGE.LFAVGSF.-......HTLRLCD......
ENSMUSP00000072509  E-------------------------PLKV..TASVYIP.......AHG.RLVCGRE.D......GSIIIVP......
ENSMUSP00000117710  -----------------------A--AVSV..QCLAWVPs......APG.MFITGDSqV......GVLRIWN......
ENSMUSP00000126736  --------------------------AYPL..LNLLINE.......ENQ.QLVTGSA.D......GQLWIFSlmeghh
ENSMUSP00000065643  -----------------------H--NGPV..FAMYTTL.......RDG.LIVTGGK.ErpskegGAVKLWD......
ENSMUSP00000117489  --------------------------TARVyaTPFAFSNhprs...DDA.LLAAAST.D......GKLWVLE......
ENSMUSP00000119362  -----------------------------A..WTLAFSP.......DSQ.YLATGTH.M......GKVNIFG......
ENSMUSP00000120285  -----------------------H--PTVV..VCIQSRA.......EPH.TLLTAGK.E......GIIKEWN......
ENSMUSP00000045812  -----------------------H--KDAI..VACFFES.......NSL.DLYSLSQ.D......GALCVWQ......
ENSMUSP00000124712  ------------------------------..-------.......RGE.IIYSLDG.S......DCVHKWN......
ENSMUSP00000139411  -----------------------H--KDSV..TCAGFSH.......DST.LVATGDM.S......GLLKVWQ......
ENSMUSP00000074387  -----------------------H--EGEI..GDLTLGP.......DGK.LVTVGWD.-......FKASVWQ......
ENSMUSP00000071863  --QQSNDPSQS------------D--KQDV..LCLCFSP.......SEE.TLIASTN.K......NQLYSIT......
ENSMUSP00000080592  --QQSNDPSQS------------D--KQDV..LCLCFSP.......SEE.TLIASTN.K......NQLYSIT......
ENSMUSP00000027139  ---------------------SYH--KYQA..TNCCFSE.......DGS.LLAVSFE.-......EIVTIWD......
ENSMUSP00000085379  -----------------------H--EGEI..GDLTLGP.......DGK.LVTVGWD.-......FKASVWQ......
ENSMUSP00000102413  -----------------------Y--AASL..PEDDVDY.......KMS.HFVSNG-.D......GLVVTVD......
ENSMUSP00000034093  PDMETRAGFI--------------------..-------.......---.-------.-......-------......
ENSMUSP00000001059  -----------------------Y--AASL..PEDDVDY.......KMS.HFVSNG-.D......GLVVTVD......
ENSMUSP00000110639  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000113418  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000033153  -----------------------Y--SAPL..LNGSPGK.......YMS.HLTSCGM.-......GLLLTVD......
ENSMUSP00000107982  -------------------KCTGH--SSYI..THLDWSP.......DNK.HIMSNSG.D......YEILYWD......
ENSMUSP00000094528  -------------------KCTGH--SSYI..THLDWSP.......DNK.HIMSNSG.D......YEILYWD......
ENSMUSP00000041880  --------------------CTGH--SSYI..THLDWSP.......DNK.HIMSNSG.D......YEILYWD......
ENSMUSP00000124833  --------------------------VGAP..VSLLVR-.......GGT.LVVSASRkS......SSFKVWD......
ENSMUSP00000112491  --------------------CSGH--SSFI..THLDWAQ.......DST.CFVTNSG.D......YEILYWD......
ENSMUSP00000112447  --------------------CSGH--SSFI..THLDWAQ.......DST.CFVTNSG.D......YEILYWD......
ENSMUSP00000119471  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000051080  -----------------------S--LSFI..THIDWSL.......DSK.YLQTNDG.A......GERLFYK......
ENSMUSP00000049034  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000137103  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000080888  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000107546  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000107547  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000117676  --------------------------HGHI..IGMGLSP.......DNR.YLYVNSR.-......-------......
ENSMUSP00000102412  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000025649  --------------------------KGAV..YSMVEF-.......NGK.LLAS---.-......-------......
ENSMUSP00000102411  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000055321  --------------------------PDAV..TSLCFGRygr....EDN.TLIMT--.-......-------......
ENSMUSP00000039427  ------------------------------..-------.......---.-------.-......-------......
ENSMUSP00000102639  ------------------------------..-------.......---.-------.-......-------......


                                                                                                   4
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  yhcvahvdvrkkretfttrrmmaeqcslpedhqcrcrheadkrgeaeatfpilslapcdlclpdsqrgafasectkcl
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                      40         450                                                                
                       |           |                                                                
d1flga_               .EEVS..YTKGSAYLG..............................................................
ENSMUSP00000045812  .MF--..---------..............................................................
ENSMUSP00000065004  .LKTD..HNEQLIPEPessitsahi.....................................................
ENSMUSP00000136287  .LKTD..HNEQLIPEPessitsahi.....................................................
ENSMUSP00000122326  .YT--..---------..............................................................
ENSMUSP00000135805  .YT--..---------..............................................................
ENSMUSP00000115550  .YT--..---------..............................................................
ENSMUSP00000117710  .YT--..---------..............................................................
ENSMUSP00000041880  .SVEH..RLEWTRLVDepghcadf......................................................
ENSMUSP00000107982  .SVEH..RLEWTRLVDepghcadf......................................................
ENSMUSP00000094528  .SVEH..RLEWTRLVDepghcadf......................................................
ENSMUSP00000118325  .GN-Y..QKLHKAEIPeqfgpirtvaegkgnviligttrnfvlqgtlsgdftpitqghtdelwglai...........
ENSMUSP00000116772  .VEKNy.NLEQTLDDHsssitaikfagtrdvqmiscgadksiyfrsaqqasdglhfvrthhvaekttlydmdi.....
ENSMUSP00000103825  .VEKNy.NLEQTLDDHsssitaikfagtrdvqmiscgadksiyfrsaqqasdglhfvrthhvaekttlydmdi.....
ENSMUSP00000068516  .AQKSg.EGVQFTRTHhvvrkttlydmdv.................................................
ENSMUSP00000048489  .VP--..---------..............................................................
ENSMUSP00000051080  .TD-F..KPITKIDLReteqgykglsirsvcwkadrllagtqdseifevivrerdkpmlilqghcegelwalal....
ENSMUSP00000057209  .AVGH..RPVWDKIIEdpaqssgf......................................................
ENSMUSP00000112491  .SETH..QPVWSRSIEdparsagf......................................................
ENSMUSP00000105486  .AVGH..RPVWDKIIEdpaqssgf......................................................
ENSMUSP00000069279  .KE-G..HLRWKFETTarvyatpfafsnhp................................................
ENSMUSP00000113792  .KE-G..HLRWKFETTarvyatpfafsnhp................................................
ENSMUSP00000105483  .GN-Y..QKLHKAEIPeqfgpirtvaegkgnviligttrnfvlqgtlsgdftpitqghtdelwglai...........
ENSMUSP00000037654  .SD-Y..SKVQEVEVPedfgpvrtvaegrgdtlyvgttrnsillgsvhtgfsllvqghveelwglat...........
ENSMUSP00000131842  .LK--..---------..............................................................
ENSMUSP00000093960  .GEGH..ALAWSMDLKetglcadf......................................................
ENSMUSP00000078426  .LA--..---------..............................................................
ENSMUSP00000124804  .LKST..KKLQSPTPFldrtglaavsh...................................................
ENSMUSP00000052465  .FKSK..VLIHSLGLDsspnmmll......................................................
ENSMUSP00000125092  .LKST..KKLQSPTPFldrtglaavsh...................................................
ENSMUSP00000113309  .AM--..---------..............................................................
ENSMUSP00000029347  .KT--..---------..............................................................
ENSMUSP00000103442  .KT--..---------..............................................................
ENSMUSP00000133263  .KT--..---------..............................................................
ENSMUSP00000072509  .ATQT..AIVQLLQGEhmlrrgwpphrtlrghrnkvtcllyphqvsa...............................
ENSMUSP00000117710  .VSRT..TPIDNFKLKktgfhcfhvvnsppkkkfsvqspnknhyisstseavpppnltqnqafslppghvvccfldgg
ENSMUSP00000126736  wI---..---------..............................................................
ENSMUSP00000065643  .QELR..RCRAFRLETgqvtdcvrsv....................................................
ENSMUSP00000117489  .SR--..---------..............................................................
ENSMUSP00000119362  .VE--..---------..............................................................
ENSMUSP00000120285  .LTSG..DLLRHLKLGeelyalqfidnttffcqtthqfslrrlpgfyslfnicgsipqqlrrirc.............
ENSMUSP00000045812  .CDTP..PEGLRLKAPrgwkadilqrekeeeeedeeegdrettirgkttpaeqervgkv...................
ENSMUSP00000124712  .FS--..---------..............................................................
ENSMUSP00000139411  .VD--..---------..............................................................
ENSMUSP00000074387  .KDQLvtQLQWQENGPassntpyryqacrfgqvpdqlgglrlft..................................
ENSMUSP00000071863  .M---..---------..............................................................
ENSMUSP00000080592  .M---..---------..............................................................
ENSMUSP00000027139  .SQ--..---------..............................................................
ENSMUSP00000085379  .KDQLvtQLQWQENGPassntpyryqacrfgqvpdqlgglrlft..................................
ENSMUSP00000102413  .SE--..---------..............................................................
ENSMUSP00000034093  .----..--------Estfkpggnkedskiisdveeqea.......................................
ENSMUSP00000001059  .SE--..---------..............................................................
ENSMUSP00000110639  .----..---------..............................................................
ENSMUSP00000113418  .----..---------..............................................................
ENSMUSP00000033153  .PG--..---------..............................................................
ENSMUSP00000107982  .IENGc.K--------..............................................................
ENSMUSP00000094528  .IENGc.K--------..............................................................
ENSMUSP00000041880  .IENGc.K--------..............................................................
ENSMUSP00000124833  .LKST..KKLQSPTPF..............................................................
ENSMUSP00000112491  .PV--..---------..............................................................
ENSMUSP00000112447  .PV--..---------..............................................................
ENSMUSP00000119471  .----..-----LESPpmcitvgpgpirt.................................................
ENSMUSP00000051080  .MP--..---------..............................................................
ENSMUSP00000049034  .----..---------..............................................................
ENSMUSP00000137103  .----..---------..............................................................
ENSMUSP00000080888  .----..---------..............................................................
ENSMUSP00000107546  .----..---------..............................................................
ENSMUSP00000107547  .----..---------..............................................................
ENSMUSP00000117676  .----..------AWPpgsv..........................................................
ENSMUSP00000102412  .----..---------..............................................................
ENSMUSP00000025649  .----..---------..............................................................
ENSMUSP00000102411  .----..---------..............................................................
ENSMUSP00000055321  .----..---------..............................................................
ENSMUSP00000039427  .----..---------..............................................................
ENSMUSP00000102639  .----..---------..............................................................


                                                        460                                         
                                                          |                                         
d1flga_               .............................MGFRIKRMYD.......................................
ENSMUSP00000045812  .............................----------.......................................
ENSMUSP00000065004  .............................DPDASYMAAV.......................................
ENSMUSP00000136287  .............................DPDASYMAAV.......................................
ENSMUSP00000122326  .............................----------.......................................
ENSMUSP00000135805  .............................----------.......................................
ENSMUSP00000115550  .............................----------.......................................
ENSMUSP00000117710  .............................----------.......................................
ENSMUSP00000041880  .............................HPSGTVVAIG.......................................
ENSMUSP00000107982  .............................HPSGTVVAIG.......................................
ENSMUSP00000094528  .............................HPSGTVVAIG.......................................
ENSMUSP00000118325  .............................HASKPQFLTC.......................................
ENSMUSP00000116772  .............................DITQKYVAVA.......................................
ENSMUSP00000103825  .............................DITQKYVAVA.......................................
ENSMUSP00000068516  .............................EPSWKYTAIG.......................................
ENSMUSP00000048489  .............................----------.......................................
ENSMUSP00000051080  .............................HPKKPLAVTG.......................................
ENSMUSP00000057209  .............................HPSGSVVAVG.......................................
ENSMUSP00000112491  .............................HPSGSVLAVG.......................................
ENSMUSP00000105486  .............................HPSGSVVAVG.......................................
ENSMUSP00000069279  .............................RSDDALLAAA.......................................
ENSMUSP00000113792  .............................RSDDALLAAA.......................................
ENSMUSP00000105483  .............................HASKPQFLTC.......................................
ENSMUSP00000037654  .............................HPSRAQFVTC.......................................
ENSMUSP00000131842  .............................----------.......................................
ENSMUSP00000093960  .............................HPSGAVVVVG.......................................
ENSMUSP00000078426  .............................----------.......................................
ENSMUSP00000124804  .............................HGSFVYFPKV.......................................
ENSMUSP00000052465  .............................HRDSGILGLA.......................................
ENSMUSP00000125092  .............................HGSFVYFPKV.......................................
ENSMUSP00000113309  .............................----------.......................................
ENSMUSP00000029347  .............................----------.......................................
ENSMUSP00000103442  .............................----------.......................................
ENSMUSP00000133263  .............................----------.......................................
ENSMUSP00000072509  .............................RYDQRYLISG.......................................
ENSMUSP00000117710  vglydmgakkwdflrelghvetifdckfkPDDPNVLATA.......................................
ENSMUSP00000126736  .............................---------Gsstalfilnlasfeleaalhfkefqslsvqvagscamvs
ENSMUSP00000065643  .............................CRGKGKILVG.......................................
ENSMUSP00000117489  .............................----------.......................................
ENSMUSP00000119362  .............................----------.......................................
ENSMUSP00000120285  .............................GNNWYRILCA.......................................
ENSMUSP00000045812  .............................K---------.......................................
ENSMUSP00000124712  .............................----------.......................................
ENSMUSP00000139411  .............................----------.......................................
ENSMUSP00000074387  .............................VQIP------.......................................
ENSMUSP00000071863  .............................----------.......................................
ENSMUSP00000080592  .............................----------.......................................
ENSMUSP00000027139  .............................----------.......................................
ENSMUSP00000085379  .............................VQIP------.......................................
ENSMUSP00000102413  .............................----------.......................................
ENSMUSP00000034093  .............................TMLDTVIKVS.......................................
ENSMUSP00000001059  .............................----------.......................................
ENSMUSP00000110639  .............................----------.......................................
ENSMUSP00000113418  .............................----------.......................................
ENSMUSP00000033153  .............................----------.......................................
ENSMUSP00000107982  .............................----------.......................................
ENSMUSP00000094528  .............................----------.......................................
ENSMUSP00000041880  .............................----------.......................................
ENSMUSP00000124833  .............................LDRTG-----.......................................
ENSMUSP00000112491  .............................----------.......................................
ENSMUSP00000112447  .............................----------.......................................
ENSMUSP00000119471  .............................LLSLEDAAWA.......................................
ENSMUSP00000051080  .............................----------.......................................
ENSMUSP00000049034  .............................----------.......................................
ENSMUSP00000137103  .............................----------.......................................
ENSMUSP00000080888  .............................----------.......................................
ENSMUSP00000107546  .............................----------.......................................
ENSMUSP00000107547  .............................----------.......................................
ENSMUSP00000117676  .............................V---------.......................................
ENSMUSP00000102412  .............................----------.......................................
ENSMUSP00000025649  .............................----------.......................................
ENSMUSP00000102411  .............................----------.......................................
ENSMUSP00000055321  .............................----------.......................................
ENSMUSP00000039427  .............................----------.......................................
ENSMUSP00000102639  .............................----------.......................................


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  ..............................................................................
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  epmsakafcmlssmfgskiavleidlaallstqqypragkvlsvlasscvlptsplyfgiikekfpklantkqhavks
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  ..............................................................................
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                              470                               480 
                                                                |                                 | 
d1flga_               ...........................DHV........GSLRA................MDPVSG........KVVWE
ENSMUSP00000045812  ...........................---........-----................---DSW........RTKET
ENSMUSP00000065004  ...........................NSA........GNCYV................WNLTGGigddvtqlIPKTK
ENSMUSP00000136287  ...........................NSA........GNCYV................WNLTGGigddvtqlIPKTK
ENSMUSP00000122326  ...........................---........-----................----QD........ACVST
ENSMUSP00000135805  ...........................---........-----................----QD........ACVST
ENSMUSP00000115550  ...........................---........-----................----QD........ACVST
ENSMUSP00000117710  ...........................---........-----................----QD........ACVST
ENSMUSP00000041880  ...........................THS........GRWFV................LDAETR........DLVSI
ENSMUSP00000107982  ...........................THS........GRWFV................LDAETR........DLVSI
ENSMUSP00000094528  ...........................THS........GRWFV................LDAETR........DLVSI
ENSMUSP00000118325  ...........................GHD........KHATL................WDAVGH........RPVWD
ENSMUSP00000116772  ...........................CQD........RNVRV................YNTVSG........KQKKC
ENSMUSP00000103825  ...........................CQD........RNVRV................YNTVSG........KQKKC
ENSMUSP00000068516  ...........................CQD........RNIRI................FNISSG........KQKKL
ENSMUSP00000048489  ...........................---........-----................----PGglenvlt.TPETV
ENSMUSP00000051080  ...........................SDD........RSVRL................WSLADH........ALIAR
ENSMUSP00000057209  ...........................TLT........GRWFV................FDTETK........DLVTV
ENSMUSP00000112491  ...........................TVT........GRWLL................LDTETH........DLVAI
ENSMUSP00000105486  ...........................TLT........GRWFV................FDTETK........DLVTV
ENSMUSP00000069279  ...........................STD........GKLWV................LESRSG........ELRSV
ENSMUSP00000113792  ...........................STD........GKLWV................LESRSG........ELRSV
ENSMUSP00000105483  ...........................GHD........KHATL................WDAVGH........RPVWD
ENSMUSP00000037654  ...........................GQD........KLVHL................WSSETH........QPVWS
ENSMUSP00000131842  ...........................---........-AVLE................SNPESPitit....EPYRT
ENSMUSP00000093960  ...........................LNT........GRWLV................LDTETR........EIVSD
ENSMUSP00000078426  ...........................---........-----................----TL........QQLYD
ENSMUSP00000124804  ...........................GDK........NKVTI................WDLAEG........EEQDC
ENSMUSP00000052465  ...........................MDD........FSIAV................LDIETR........KIVRE
ENSMUSP00000125092  ...........................GDK........NKVTI................WDLAEG........EEQDC
ENSMUSP00000113309  ...........................---........-----................----SLen......ESPEP
ENSMUSP00000029347  ...........................---........-----................----GW........SYALE
ENSMUSP00000103442  ...........................---........-----................----GW........SYALE
ENSMUSP00000133263  ...........................---........-----................----GW........SYALE
ENSMUSP00000072509  ...........................GVD........FSVII................WDIFSG........EMKHI
ENSMUSP00000117710  ...........................SFD........GTIKV................WDINTL........TAVYT
ENSMUSP00000126736  vvedrplvfhtkvrssgytlaphmamfSPK........TNIKH................HNKRSS........KYKNN
ENSMUSP00000065643  ...........................TRN........SEIIE................VGEKNA........ACNIL
ENSMUSP00000117489  ...........................---........-----................------........-----
ENSMUSP00000119362  ...........................---........-----................----SG........KKEYS
ENSMUSP00000120285  ...........................TED........GLLRF................VSPVTG........DLLLI
ENSMUSP00000045812  ...........................---........-----................------........-----
ENSMUSP00000124712  ...........................---........-----................----SG........FIEAV
ENSMUSP00000139411  ...........................---........-----................----TKe.......EVVGV
ENSMUSP00000074387  ...........................--HkrlrqpppCYLTA................WDSSTF........LPLRT
ENSMUSP00000071863  ...........................---........-----................------........-----
ENSMUSP00000080592  ...........................---........-----................------........-----
ENSMUSP00000027139  ...........................---........-----................----TW........ELKCT
ENSMUSP00000085379  ...........................--HkrlrqpppCYLTA................WDSSTF........LPLRT
ENSMUSP00000102413  ...........................---........-----................----SG........DVLW-
ENSMUSP00000034093  ...........................VAD........WKVMA................FSRKGG........RLEWE
ENSMUSP00000001059  ...........................---........-----................----SG........DVLW-
ENSMUSP00000110639  ...........................---........-----................------........-----
ENSMUSP00000113418  ...........................---........-----................------........-----
ENSMUSP00000033153  ...........................---........-----................----SG........IVLWT
ENSMUSP00000107982  ...........................---........-----................------........-LIRN
ENSMUSP00000094528  ...........................---........-----................------........-LIRN
ENSMUSP00000041880  ...........................---........-----................------........-LIRN
ENSMUSP00000124833  ...........................---........-----................------........-----
ENSMUSP00000112491  ...........................---........-----................----TC........KQITS
ENSMUSP00000112447  ...........................---........-----................----TC........KQITS
ENSMUSP00000119471  ...........................SCG........PRVTV................LDAATL........QTQQS
ENSMUSP00000051080  ...........................---........-----................----SG........KPLTS
ENSMUSP00000049034  ...........................---........-----................------........-----
ENSMUSP00000137103  ...........................---........-----................------........-----
ENSMUSP00000080888  ...........................---........-----................------........-----
ENSMUSP00000107546  ...........................---........-----................------........-----
ENSMUSP00000107547  ...........................---........-----................------........-----
ENSMUSP00000117676  ...........................---........----AdpmqpppiaeeidllvFDLKTMr.......EVKRA
ENSMUSP00000102412  ...........................---........-----................------........-----
ENSMUSP00000025649  ...........................-IN........STVRL................YEWTTE........KELRT
ENSMUSP00000102411  ...........................---........-----................------........-----
ENSMUSP00000055321  ...........................---........-----................------........-----
ENSMUSP00000039427  ...........................---........-----................------........-----
ENSMUSP00000102639  ...........................---........-----................------........-----


                                                       490              500        510              
                                                         |                |          |              
d1flga_               HKE..........................HLP.LWAG.VLAT......AGNLVFTG.TGDGYFKAF....DA...KS.
ENSMUSP00000045812  LTL..........................TSD.ALAV.TFRP......DGAELAVA.TLNSQITFW....DP...ENa
ENSMUSP00000065004  IPA..........................HTRyALQC.RFSP......DSTLLATC.SADQTCKIW....RT...SN.
ENSMUSP00000136287  IPA..........................HTRyALQC.RFSP......DSTLLATC.SADQTCKIW....RT...SN.
ENSMUSP00000122326  LNG..........................HTApVRGL.MWNTe.....IPYLLISG.SWDYTIKVW....DT...RG.
ENSMUSP00000135805  LNG..........................HTApVRGL.MWNTe.....IPYLLISG.SWDYTIKVW....DT...RG.
ENSMUSP00000115550  LNG..........................HTApVRGL.MWNTe.....IPYLLISG.SWDYTIKVW....DT...RG.
ENSMUSP00000117710  LNG..........................HTApVRGL.MWNTe.....IPYLLISG.SWDYTIKVW....DT...RG.
ENSMUSP00000041880  HTD..........................GNEqLSVM.RYSV......DGTLLAVG.SHDNFIYLYtvleNG...RK.
ENSMUSP00000107982  HTD..........................GNEqLSVM.RYSV......DGTLLAVG.SHDNFIYLYtvleNG...RK.
ENSMUSP00000094528  HTD..........................GNEqLSVM.RYSV......DGTLLAVG.SHDNFIYLYtvleNG...RK.
ENSMUSP00000118325  KII..........................EDP.AQSS.GFHP......SGSVVAVG.TLTGRWFVF....DT...ET.
ENSMUSP00000116772  YKGsqg.......................DEGsLLKV.HVDP......SGTFLATS.CSDKSISLI....DF...YS.
ENSMUSP00000103825  YKGsqg.......................DEGsLLKV.HVDP......SGTFLATS.CSDKSISLI....DF...YS.
ENSMUSP00000068516  FKGsqg.......................EDGtLIKV.QTDP......SGIYIATS.CSDKNLSIF....DF...SS.
ENSMUSP00000048489  LTG..........................HTEkIYSL.RFHPl.....AADVLASS.SYDLTVRIW....DL...QT.
ENSMUSP00000051080  CNM..........................EEA.VRSV.SFSP......DGSQLALG.MKDGSFIVL....RV...RD.
ENSMUSP00000057209  HTD..........................GNEqLSVM.RYSP......DGNFLAIG.SHDNCIYIYgvtdNG...RK.
ENSMUSP00000112491  HTD..........................GNEqISVV.SFSP......DGAYLAVG.SHDNLVYVY....TV...DQ.
ENSMUSP00000105486  HTD..........................GNEqLSVM.RYSP......DGNFLAIG.SHDNCIYIYgvtdNG...RK.
ENSMUSP00000069279  YEL..........................PGEvFSSP.VVW-......-ESMLVIG.CRNNYIYCL....DL...L-.
ENSMUSP00000113792  YEL..........................PGEvFSSP.VVW-......-ESMLVIG.CRNNYIYCL....DL...L-.
ENSMUSP00000105483  KII..........................EDP.AQSS.GFHP......SGSVVAVG.TLTGRWFVF....DT...ET.
ENSMUSP00000037654  RSI..........................EDP.ARSA.GFHP......SGSVLAVG.TVTGRWLLL....DT...ET.
ENSMUSP00000131842  LSG..........................HTAkITSL.AWSPh.....HDGRLVSA.CYDGTAQVW....DA...LR.
ENSMUSP00000093960  VTD..........................GNEqLSVV.RYSP......DGLYLAIG.SHDNMIYIY....SV...SS.
ENSMUSP00000078426  FSS..........................SEDtPCAV.AFHP......TMPNFFCG.FSSGAVRSF....SL...ES.
ENSMUSP00000124804  LDT..........................SNE.VRCL.EVAE......QAKLLFTG.LVSGIVLVF....PL...NS.
ENSMUSP00000052465  FSG..........................HHGqINDM.TFSP......DGRWLISA.AMDCSVRTW....DL...PS.
ENSMUSP00000125092  LDT..........................SNE.VRCL.EVAE......QAKLLFTG.LVSGIVLVF....PL...NSr
ENSMUSP00000113309  FKY..........................SKSsVSHC.CFSH......DSNYMATA.DVNFTVAVYmv..VV...KN.
ENSMUSP00000029347  KPN..........................TGS.IFNI.AWSI......DGTQIAGA.CGNGHVVF-....--...--.
ENSMUSP00000103442  KPN..........................TGS.IFNI.AWSI......DGTQIAGA.CGNGHVVF-....--...--.
ENSMUSP00000133263  KPN..........................TGS.IFNI.AWSI......DGTQIAGA.CGNGHVVF-....--...--.
ENSMUSP00000072509  FCV..........................HGGeITQL.LVPPencsarVQHCICSV.ASDHSVGLL....SL...RE.
ENSMUSP00000117710  SPG..........................NEGvIFAL.SWAPg.....DLNCIAGA.TSRNGAFIW....DI...QK.
ENSMUSP00000126736  YKCkecslenflprnlsrqvavaqk....PVA.VSCL.QFSG......DGQKLACG.LGNHLSLVF....NA...SL.
ENSMUSP00000065643  VNGhv........................DGP.IWGL.ATHP......SRDFFLSA.AEDGTVRLW....DI...AD.
ENSMUSP00000117489  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000119362  LDT..........................RGKfILSI.AYSP......DGKYLASG.AIDGIINIF....DI...AT.
ENSMUSP00000120285  TWPfsv.......................LDH.AVDW.AYDP......NKEELFVA.TGTSEVLVF....DA...SRn
ENSMUSP00000045812  --Ysrlakyflnkeg..............DFNnLTSA.AYHK......KTHLLVTG.FASGIFHLH....EL...PE.
ENSMUSP00000124712  FKH..........................EGI.VEHC.VLTS......TGDLMVTS.DDKSSQYVW....HT...SS.
ENSMUSP00000139411  FRPetvasqpslgegees...........ESNsVESL.GFCS......VMPLAAVG.YLDGTLAIY....DL...ST.
ENSMUSP00000074387  RSC..........................GHEvISCL.SVSD......SGTFLGLG.TVTGSVAIY....IA...FS.
ENSMUSP00000071863  --Slteiskgeaahfeyllypl.......HSAsITGL.DTCI......RKPLIATC.SLDRSVRIW....NY...ES.
ENSMUSP00000080592  --Slteiskgeaahfeyllypl.......HSAsITGL.DTCI......RKPLIATC.SLDRSVRIW....NY...ES.
ENSMUSP00000027139  FCQ..........................RAGkIRHL.CFGRlt....CSKYLLGT.TDNGILCCW....NL...LS.
ENSMUSP00000085379  RSC..........................GHEvISCL.SVSD......SGTFLGLG.TVTGSVAIY....--...--.
ENSMUSP00000102413  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000034093  YQF..........................CTP.IASA.WLVR......DGKVI---.---------....--...--.
ENSMUSP00000001059  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000110639  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000113418  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000033153  QDL..........................GVP.VTGI.----......--------.---------....--...--.
ENSMUSP00000107982  RSDckdidwttytcvlgfqvfgvwpegsdGTD.INAL.VRSH......NRRVIAVA.DDFCKVHLF....QY...PC.
ENSMUSP00000094528  RSDckdidwttytcvlgfqvfgvwpegsdGTD.INAL.VRSH......NRRVIAVA.DDFCKVHLF....QY...PC.
ENSMUSP00000041880  RSDckdidwttytcvlgfqvfgvwpegsdGTD.INAL.VRSH......NRRVIAVA.DDFCKVHLF....QY...PC.
ENSMUSP00000124833  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000112491  ADTvrnvewatatcvlgfgvfgiwpegadGTD.INAV.ARSH......DGKLLVSA.DDFGKVHLF....SY...PC.
ENSMUSP00000112447  ADTvrnvewatatcvlgfgvfgiwpegadGTD.INAV.ARSH......DGKLLVSA.DDFGKVHLF....SY...PC.
ENSMUSP00000119471  FEA..........................HQDeAVSVtHMVK......AGSGVWMAfSSGSSIRLF....HT...ET.
ENSMUSP00000051080  KEEikgipwaswtcvrgpevsgiwpkyt.EVIdINSV.DANY......NSSVLVSG.DDFGLVKLF....KFpclKK.
ENSMUSP00000049034  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000137103  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000080888  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000107546  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000107547  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000117676  LRAhrayt.....................PNDeCFFI.FLDV......SRDFVASG.AEDRHGYIW....DR...HY.
ENSMUSP00000102412  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000025649  ECN..........................HYNnIMAL.YLKT......KGDFILVG.DL-------....--...--.
ENSMUSP00000102411  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000055321  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000039427  ---..........................---.----.----......--------.---------....--...--.
ENSMUSP00000102639  ---..........................---.----.----......--------.---------....--...--.


                                                                                                    
                                                                                                    
d1flga_               ..............................................................................
ENSMUSP00000045812  vqvgsiegrhdlktg...............................................................
ENSMUSP00000065004  ..............................................................................
ENSMUSP00000136287  ..............................................................................
ENSMUSP00000122326  ..............................................................................
ENSMUSP00000135805  ..............................................................................
ENSMUSP00000115550  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000118325  ..............................................................................
ENSMUSP00000116772  ..............................................................................
ENSMUSP00000103825  ..............................................................................
ENSMUSP00000068516  ..............................................................................
ENSMUSP00000048489  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000057209  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000105486  ..............................................................................
ENSMUSP00000069279  ..............................................................................
ENSMUSP00000113792  ..............................................................................
ENSMUSP00000105483  ..............................................................................
ENSMUSP00000037654  ..............................................................................
ENSMUSP00000131842  ..............................................................................
ENSMUSP00000093960  ..............................................................................
ENSMUSP00000078426  ..............................................................................
ENSMUSP00000124804  ..............................................................................
ENSMUSP00000052465  ..............................................................................
ENSMUSP00000125092  qdvlcipppearkavncmslsksenrlaiaydnivlvldispgdpcpaiegptytfytqlpetivsvavladyrvvyg
ENSMUSP00000113309  ..............................................................................
ENSMUSP00000029347  ..............................................................................
ENSMUSP00000103442  ..............................................................................
ENSMUSP00000133263  ..............................................................................
ENSMUSP00000072509  ..............................................................................
ENSMUSP00000117710  ..............................................................................
ENSMUSP00000126736  ..............................................................................
ENSMUSP00000065643  ..............................................................................
ENSMUSP00000117489  ..............................................................................
ENSMUSP00000119362  ..............................................................................
ENSMUSP00000120285  pcpvkyllctspdiqdyvqclaygnfhlgrgleglmfsghqsgmirvlsqhscarieknvhfgavlalsifygglmts
ENSMUSP00000045812  ..............................................................................
ENSMUSP00000124712  ..............................................................................
ENSMUSP00000139411  ..............................................................................
ENSMUSP00000074387  ..............................................................................
ENSMUSP00000071863  ..............................................................................
ENSMUSP00000080592  ..............................................................................
ENSMUSP00000027139  ..............................................................................
ENSMUSP00000085379  ..............................................................................
ENSMUSP00000102413  ..............................................................................
ENSMUSP00000034093  ..............................................................................
ENSMUSP00000001059  ..............................................................................
ENSMUSP00000110639  ..............................................................................
ENSMUSP00000113418  ..............................................................................
ENSMUSP00000033153  ..............................................................................
ENSMUSP00000107982  ..............................................................................
ENSMUSP00000094528  ..............................................................................
ENSMUSP00000041880  ..............................................................................
ENSMUSP00000124833  ..............................................................................
ENSMUSP00000112491  ..............................................................................
ENSMUSP00000112447  ..............................................................................
ENSMUSP00000119471  ..............................................................................
ENSMUSP00000051080  ..............................................................................
ENSMUSP00000049034  ..............................................................................
ENSMUSP00000137103  ..............................................................................
ENSMUSP00000080888  ..............................................................................
ENSMUSP00000107546  ..............................................................................
ENSMUSP00000107547  ..............................................................................
ENSMUSP00000117676  ..............................................................................
ENSMUSP00000102412  ..............................................................................
ENSMUSP00000025649  ..............................................................................
ENSMUSP00000102411  ..............................................................................
ENSMUSP00000055321  ..............................................................................
ENSMUSP00000039427  ..............................................................................
ENSMUSP00000102639  ..............................................................................


                                                                                                    
                                                                                                    
d1flga_               ............................................................................G.
ENSMUSP00000045812  ............................................................................R.
ENSMUSP00000065004  ............................................................................F.
ENSMUSP00000136287  ............................................................................F.
ENSMUSP00000122326  ............................................................................G.
ENSMUSP00000135805  ............................................................................G.
ENSMUSP00000115550  ............................................................................G.
ENSMUSP00000117710  ............................................................................G.
ENSMUSP00000041880  ............................................................................Y.
ENSMUSP00000107982  ............................................................................Y.
ENSMUSP00000094528  ............................................................................Y.
ENSMUSP00000118325  ............................................................................K.
ENSMUSP00000116772  ............................................................................G.
ENSMUSP00000103825  ............................................................................G.
ENSMUSP00000068516  ............................................................................G.
ENSMUSP00000048489  ............................................................................G.
ENSMUSP00000051080  ............................................................................M.
ENSMUSP00000057209  ............................................................................Y.
ENSMUSP00000112491  ............................................................................Gg
ENSMUSP00000105486  ............................................................................Y.
ENSMUSP00000069279  ............................................................................-.
ENSMUSP00000113792  ............................................................................-.
ENSMUSP00000105483  ............................................................................K.
ENSMUSP00000037654  ............................................................................H.
ENSMUSP00000131842  ............................................................................E.
ENSMUSP00000093960  ............................................................................Cg
ENSMUSP00000078426  ............................................................................S.
ENSMUSP00000124804  ............................................................................R.
ENSMUSP00000052465  ............................................................................G.
ENSMUSP00000125092  ................................................................msdgslflydcaC.
ENSMUSP00000113309  ............................................................................G.
ENSMUSP00000029347  ............................................................................-.
ENSMUSP00000103442  ............................................................................-.
ENSMUSP00000133263  ............................................................................-.
ENSMUSP00000072509  ............................................................................K.
ENSMUSP00000117710  ............................................................................G.
ENSMUSP00000126736  ............................................................................S.
ENSMUSP00000065643  ............................................................................K.
ENSMUSP00000117489  ............................................................................-.
ENSMUSP00000119362  ............................................................................G.
ENSMUSP00000120285  rensllcsygvddyiqlseavltgarlqlktlacilsscplkhlvllpkavgaitstnclrlwklrefisfgssqgI.
ENSMUSP00000045812  ............................................................................F.
ENSMUSP00000124712  ............................................................................G.
ENSMUSP00000139411  ............................................................................Q.
ENSMUSP00000074387  ............................................................................L.
ENSMUSP00000071863  ............................................................................N.
ENSMUSP00000080592  ............................................................................N.
ENSMUSP00000027139  ............................................................................C.
ENSMUSP00000085379  ............................................................................-.
ENSMUSP00000102413  ............................................................................-.
ENSMUSP00000034093  ............................................................................-.
ENSMUSP00000001059  ............................................................................-.
ENSMUSP00000110639  ............................................................................-.
ENSMUSP00000113418  ............................................................................-.
ENSMUSP00000033153  ............................................................................-.
ENSMUSP00000107982  ............................................................................S.
ENSMUSP00000094528  ............................................................................S.
ENSMUSP00000041880  ............................................................................S.
ENSMUSP00000124833  ............................................................................-.
ENSMUSP00000112491  ............................................................................C.
ENSMUSP00000112447  ............................................................................C.
ENSMUSP00000119471  ............................................................................L.
ENSMUSP00000051080  ............................................................................G.
ENSMUSP00000049034  ............................................................................-.
ENSMUSP00000137103  ............................................................................-.
ENSMUSP00000080888  ............................................................................-.
ENSMUSP00000107546  ............................................................................-.
ENSMUSP00000107547  ............................................................................-.
ENSMUSP00000117676  ............................................................................N.
ENSMUSP00000102412  ............................................................................-.
ENSMUSP00000025649  ............................................................................-.
ENSMUSP00000102411  ............................................................................-.
ENSMUSP00000055321  ............................................................................-.
ENSMUSP00000039427  ............................................................................-.
ENSMUSP00000102639  ............................................................................-.


                         520               530           540          550       560       570       
                           |                 |             |            |         |         |       
d1flga_               K...ELWKFQ........TGSGIVSPPITWEQ....DGEQ.YL.GVTVG.YGGAVPLWGGDMADLTRPVAQGGSFWVF
ENSMUSP00000045812  K...ELDKITakhs....AKGKAF-TTLCYSA....DGQS.IL.AGGMS.KFVCLYHVREQ-----------------
ENSMUSP00000065004  S...LMTELSikssnpgeSSRGWM-WGCAFSG....DSQY.IV.TASSD.NLARLWCVETGEIKREYGGHQ-------
ENSMUSP00000136287  S...LMTELSikssnpgeSSRGWM-WGCAFSG....DSQY.IV.TASSD.NLARLWCVETGEIKREYGGHQ-------
ENSMUSP00000122326  V...CLDTVY........DHGADV-YGLTCHP....SRPFtMA.SCSRD.STVRLWSL--------------------
ENSMUSP00000135805  V...CLDTVY........DHGADV-YGLTCHP....SRPFtMA.SCSRD.STVRLWSL--------------------
ENSMUSP00000115550  V...CLDTVY........DHGADV-YGLTCHP....SRPFtMA.SCSRD.STVRLWSL--------------------
ENSMUSP00000117710  V...CLDTVY........DHGADV-YGLTCHP....SRPFtMA.SCSRD.STVRLWSL--------------------
ENSMUSP00000041880  S...RYGKCT........GHSSYI-THLDWSP....DNKH.IM.SNSGD.YEILYWDIENG-----------------
ENSMUSP00000107982  S...RYGKCT........GHSSYI-THLDWSP....DNKH.IM.SNSGD.YEILYWDIENG-----------------
ENSMUSP00000094528  S...RYGKCT........GHSSYI-THLDWSP....DNKH.IM.SNSGD.YEILYWDIENG-----------------
ENSMUSP00000118325  D...LVTVHT........DGNEQL-SVMRYSP....DGNF.LA.IGSHD.NCIYIYGVT-------------------
ENSMUSP00000116772  E...CVAKMF........GHSEIV-TGMKFTY....DCRH.LI.TVSGD.SCVFIWHL--------------------
ENSMUSP00000103825  E...CVAKMF........GHSEIV-TGMKFTY....DCRH.LI.TVSGD.SCVFIWHL--------------------
ENSMUSP00000068516  E...CVATMF........GHSEIV-TGMKFSN....DCKH.LI.SVSGD.SCIFVWRLS-------------------
ENSMUSP00000048489  A...ERLKLQ........GHQDQI-FSLAWSP....DGKQ.LA.TVCKD.GHVRVYEPRSSP----------------
ENSMUSP00000051080  T...EVVHIK........DRKEVI-HEMKFSP....DGSY.LA.VGSND.GPVD------------------------
ENSMUSP00000057209  T...RVGKCS........GHSSFI-THLDWS-....----.--.-----.----------------------------
ENSMUSP00000112491  RkvsRLGKCS........GHSSFI-THLDWAQ....DSTC.FV.TNSGD.YEILYWDPVT------------------
ENSMUSP00000105486  T...RVGKCS........GHSSFI-THLDWS-....----.--.-----.----------------------------
ENSMUSP00000069279  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000113792  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000105483  D...LVTVHT........DGNEQL-SVMRYSP....DGNF.LA.IGSHD.NCIYIYGVT-------------------
ENSMUSP00000037654  D...LVAIHT........DGNEQI-SVVSFSP....DGAY.LA.VGSHD.NLVYVYTVDQ------------------
ENSMUSP00000131842  E...PLFNFR........GHRGRL-LCVAWSPv...DPEC.IY.SGADD.FCVYRW----------------------
ENSMUSP00000093960  T...KSSRFGrcm.....GHSSFI-THLDWSK....DGNF.IM.SNSGD.YEILYWDVAGG-----------------
ENSMUSP00000078426  G...VLVEHT........RHRGAI-TSLVITL....DGRF.LF.SSCSQ.GSLVQYSCAD------------------
ENSMUSP00000124804  Q...D-----........--------------....----.--.-----.----------------------------
ENSMUSP00000052465  C...LIDCFL........LDSAP--LNVTMSP....TGDF.LA.TSHVDhLGIYLWSNI-------------------
ENSMUSP00000125092  S...KVFPLE........AHGSRV-SCVEVSH....SEQL.AV.SGAED.ALLCLWDL--------------------
ENSMUSP00000113309  Q...RVWEYLarlr....SHQNSI-QSLLFGVhldsNEPR.LL.SLGKD.RFLIE-----------------------
ENSMUSP00000029347  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000103442  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000133263  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000072509  K...CIMLAS........RHLFPI-QVIKWRP....SDDY.LV.VGCTD.GSVYVWQMDTG-----------------
ENSMUSP00000117710  K...IIQRFNe.......HGKNGI-FYIAWSHk...DSKR.IA.TCSGD.GFCIIRTVD-------------------
ENSMUSP00000126736  G...PPAAFS........GHDGAV-STICWSH....DKRW.LL.STGRD.RTLRVWSV--------------------
ENSMUSP00000065643  K...MLNKVN........LGHAA--RTVCYSP....EGDM.VA.IGMKN.GEFIIL----------------------
ENSMUSP00000117489  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000119362  K...LLHTLE........GHAMPI-RSLTFSP....DSQL.--.-----.----------------------------
ENSMUSP00000120285  K...FIETLP........LHQCPI-TSFDVCL....SLNV.FA.TGGSD.GTVRLWDFQ-------------------
ENSMUSP00000045812  N...LIHSLS........ISDQRV-ASVAINS....SGDW.IA.FGC--.----------------------------
ENSMUSP00000124712  E...NLFRIN........GQRI---SQLLITH....NDQF.VV.SLCEE.NASRVWRLATG-----------------
ENSMUSP00000139411  T...LRHQ--........--------------....----.--.-----.----------------------------
ENSMUSP00000074387  Q...RLYYVKe.......AHGIVV-TDVTFLP....----.--.-----.----------------------------
ENSMUSP00000071863  T...LELYKE........YQEEA--YTVSLHP....SGHY.IV.VGFAD.----------------------------
ENSMUSP00000080592  T...LELYKE........YQEEA--YTVSLHP....SGHY.IV.VGFAD.----------------------------
ENSMUSP00000027139  S...IQW---........--------------....----.--.-----.----------------------------
ENSMUSP00000085379  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000102413  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000034093  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000001059  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000110639  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000113418  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000033153  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000107982  KakaPSHKYS........AHSSHV-TNVSFTH....NDSH.LIsTGGKD.MSIIQWKLV-------------------
ENSMUSP00000094528  KakaPSHKYS........AHSSHV-TNVSFTH....NDSH.LIsTGGKD.MSIIQWKLV-------------------
ENSMUSP00000041880  KakaPSHKYS........AHSSHV-TNVSFTH....NDSH.LIsTGGKD.MSIIQWKLV-------------------
ENSMUSP00000124833  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000112491  Q...PRALSHkyg.....GHSSHV-TNVAFLW....DDSM.ALtTGGKD.TSVLQWR---------------------
ENSMUSP00000112447  Q...PRALSHkyg.....GHSSHV-TNVAFLW....DDSM.ALtTGGKD.TSVLQWR---------------------
ENSMUSP00000119471  E...HLQEI-........--------------....----.--.-----.----------------------------
ENSMUSP00000051080  A...KFRKYV........GHSAHV-TNVRWSH....DFQW.VLsTGGAD.HSVFQW----------------------
ENSMUSP00000049034  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000137103  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000080888  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000107546  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000107547  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000117676  I...CLAKLR........HEDVV--NSVAFSP....QE--.--.-----.----------------------------
ENSMUSP00000102412  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000025649  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000102411  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000055321  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000039427  -...------........--------------....----.--.-----.----------------------------
ENSMUSP00000102639  -...------........--------------....----.--.-----.----------------------------


                      580                                                    
                        |                                                    
d1flga_               KLP--sw................................................
ENSMUSP00000045812  -----ilvkrfelscnlsl....................................
ENSMUSP00000065004  -----kavvclaf..........................................
ENSMUSP00000136287  -----kavvclaf..........................................
ENSMUSP00000122326  -----i.................................................
ENSMUSP00000135805  -----i.................................................
ENSMUSP00000115550  -----i.................................................
ENSMUSP00000117710  -----i.................................................
ENSMUSP00000041880  -----ck................................................
ENSMUSP00000107982  -----ck................................................
ENSMUSP00000094528  -----ck................................................
ENSMUSP00000118325  -----dngr..............................................
ENSMUSP00000116772  -----g.................................................
ENSMUSP00000103825  -----..................................................
ENSMUSP00000068516  -----se................................................
ENSMUSP00000048489  -----lplqegpgpeggrgarivwvcdggcllvs.....................
ENSMUSP00000051080  -----vy................................................
ENSMUSP00000057209  -----..................................................
ENSMUSP00000112491  -----ck................................................
ENSMUSP00000105486  -----..................................................
ENSMUSP00000069279  -----cg................................................
ENSMUSP00000113792  -----cg................................................
ENSMUSP00000105483  -----dn................................................
ENSMUSP00000037654  -----g.................................................
ENSMUSP00000131842  -----lt................................................
ENSMUSP00000093960  -----c.................................................
ENSMUSP00000078426  -----sqc...............................................
ENSMUSP00000124804  -----vlcippp...........................................
ENSMUSP00000052465  -----slysvvslrp........................................
ENSMUSP00000125092  -----q.................................................
ENSMUSP00000113309  -----ynlv..............................................
ENSMUSP00000029347  -----ahvv..............................................
ENSMUSP00000103442  -----ahvv..............................................
ENSMUSP00000133263  -----ahvv..............................................
ENSMUSP00000072509  -----a.................................................
ENSMUSP00000117710  -----g.................................................
ENSMUSP00000126736  -----hr................................................
ENSMUSP00000065643  -----lvsslk............................................
ENSMUSP00000117489  -----..................................................
ENSMUSP00000119362  -----l.................................................
ENSMUSP00000120285  -----..................................................
ENSMUSP00000045812  -----s.................................................
ENSMUSP00000124712  -----h.................................................
ENSMUSP00000139411  -----cqhq..............................................
ENSMUSP00000074387  -----e.................................................
ENSMUSP00000071863  -----..................................................
ENSMUSP00000080592  -----..................................................
ENSMUSP00000027139  -----saklnvrvm.........................................
ENSMUSP00000085379  -----..................................................
ENSMUSP00000102413  -----iqnyaspv..........................................
ENSMUSP00000034093  -----pis...............................................
ENSMUSP00000001059  -----iqnyasp...........................................
ENSMUSP00000110639  -----lpggppstslm.......................................
ENSMUSP00000113418  -----lpggppstslm.......................................
ENSMUSP00000033153  -----ytw...............................................
ENSMUSP00000107982  -----ek................................................
ENSMUSP00000094528  -----ek................................................
ENSMUSP00000041880  -----ek................................................
ENSMUSP00000124833  -----laavshhgsfvy......................................
ENSMUSP00000112491  -----v.................................................
ENSMUSP00000112447  -----v.................................................
ENSMUSP00000119471  -----ni................................................
ENSMUSP00000051080  -----..................................................
ENSMUSP00000049034  -----wtp...............................................
ENSMUSP00000137103  -----wtp...............................................
ENSMUSP00000080888  -----wtp...............................................
ENSMUSP00000107546  -----hmketpttsai.......................................
ENSMUSP00000107547  -----hmketpttsai.......................................
ENSMUSP00000117676  -----qel...............................................
ENSMUSP00000102412  -----kn................................................
ENSMUSP00000025649  -----mrsvlll...........................................
ENSMUSP00000102411  -----nsd...............................................
ENSMUSP00000055321  -----trggg.............................................
ENSMUSP00000039427  -----ppgwscqitpdkqmlytnqftqeqwvrledqhgkpyfynpedssvqwelp
ENSMUSP00000102639  -----ppgwscqitpdkqmlytnqftqeqwvrledqhgkpyfynpedssvqwelp


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0046808 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mycoplasma mobile 163K
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Atopobium parvulum DSM 20469
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Rothia mucilaginosa DY-18
NoYes   Arthrobacter sp. Rue61a
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Finegoldia magna ATCC 29328
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium phytofermentans ISDg
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus acidophilus 30SC
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus oralis Uo5
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus polymyxa M1
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Solibacillus silvestris StLB046
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus pumilus SAFR-032
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter concisus 13826
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Wolbachia sp. wRi
NoYes   Ehrlichia chaffeensis str. Arkansas
NoYes   Ehrlichia canis str. Jake
NoYes   Ehrlichia ruminantium str. Gardel
NoYes   Anaplasma phagocytophilum HZ
NoYes   Anaplasma marginale str. Florida
NoYes   Anaplasma centrale str. Israel
NoYes   Orientia tsutsugamushi str. Boryong
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia massiliae MTU5
NoYes   Rickettsia japonica YH
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Halyomorpha halys symbiont
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   secondary endosymbiont of Ctenarytaina eucalypti
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Francisella noatunensis subsp. orientalis str. Toba 04
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Aeropyrum pernix K1
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Pyrobaculum islandicum DSM 4184
NoYes   halophilic archaeon DL31
NoYes