SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Hedgehog/intein (Hint) domain alignments

These alignments are sequences aligned to the 0035098 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                             10        20        30        40        50             
                                              |         |         |         |         |             
d1am2a_                ............as--ITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPVLADRLFHSG...E...H
ENSP00000295731      ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PhrlR
ENSP00000297261      ..............-CFPGSATVHLEQGGTKLVKDLSPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSP00000266991      ..............-CFPGNATVRLWSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSPTRP00000022106   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSTTFSDVLIFLDRE...PhrlR
ENSPTRP00000060583   ..............-CFPAGAQVRLESGARVALSAVRPGDRV----------LWGRMGAPPVLIFLDRD...P...Q
ENSGGOP00000010547   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSTTFSDVLIFLDRE...PhrlR
ENSGGOP00000023030   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSTTFSDVLIFLDRE...PhrlR
ENSGGOP00000007809   ..............-CFPGNATVRLWSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSGGOP00000021296   ..............-CFPGSATVHLEQGGTKLVKDLSPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSGGOP00000013669   ..............-CFPGSATVHLEQGGTKLVKDLSPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSGGOP00000017031   ..............-CFPGNATVRLWSGERKGLRELHRGDWVLAVR------PGG---AHAVLLFLDRDlqrR...A
ENSPPYP00000014741   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PhrlR
ENSPPYP00000020423   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSPPYP00000005114   ..............-CFPGNATVRLWSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSNLEP00000011023   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PhrlR
ENSNLEP00000018692   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSNLEP00000021679   ..............-CFPGNATVRLWSGEPKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
hFl_ENSPANP00000015169 ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PhrlR
hFl_ENSPANP00000017379 ..............-CFPGSATVHLEQG-TKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
hFl_ENSPANP00000011936 ..............-CFPGNATVRLWSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSMMUP00000001060   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PhrlR
ENSMMUP00000009646   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSMMUP00000016783   ..............-CFPGNATVRLWSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSCJAP00000021087   ..............-CFPAGAQVHLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PhrlR
ENSCJAP00000038804   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSCJAP00000038806   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------ASGRVVPTPVLLFLDRDlqrR...A
ENSCJAP00000037954   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
ENSOGAP00000012635   ..............-CFPAGAQVRLESGARVALSALQLGDRVLAMG------EDGNPTFSDVLIFLDRE...PnklR
ENSOGAP00000016602   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------SQGQLLYSDFLTFLDRDdsaK...K
ENSOGAP00000021869   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSMICP00000000684   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PnklR
ENSMICP00000015983   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSMICP00000001911   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD-----------------------...-...-
ENSRNOP00000024419   ..............-CFPAGAQVHLETGERVALSAVKPGDRVLAMG------EDGNPTFSDVLIFLDRE...PnrlR
ENSRNOP00000008497   ..............-CFPGSATVHLEQGGTKLVKDLSPGDRVLAAD------DQGRLLYSDFLTFLDRDegaK...K
ENSRNOP00000020563   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSMUSP00000128056   ..............-CFPAGAQVRLENGERVALSAVKPGDRVLAMG------EDGTPTFSDVLIFLDRE...PnrlR
ENSMUSP00000002708   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDegaK...K
ENSMUSP00000023737   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSDORP00000008328   ..............-CFPAGAHVRLESGARVTLSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PdrlR
ENSDORP00000005309   ..............-CFPGWATVHLERGGTKPVRELRPGDRVLAAD------EQGRLLYSDFLAFLDRDdraR...K
ENSSTOP00000021364   ..............-CFPAGAQVRLESGARVALSAVKPGDRVLAMG------EDGNPTFSDVLIFLDRE...PnrlR
ENSSTOP00000000164   ..............-CFPGNATVRLRSGERKGLRELHGGDWVLAAD------ATGRVVPTPVLLFLDRDlqrR...A
ENSSTOP00000015201   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdgaK...K
HGL_H00000295731     ..............-CFPAGAQVRLESGAHMALSAVRPGDRVLAMG------EDGTPIFSDVLIFLDRE...PnrlR
HGL_H00000266991     ..............-CFPGNATVRLQSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSCPOP00000016106   ..............-CFPAGAQVHLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PdrlR
ENSCPOP00000002048   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSCPOP00000014589   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGQLLYSDFLTFLDSDdgaK...K
ENSOCUP00000025121   ..............-CFPAGAQVRLESGARVAMSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PdrlR
ENSOCUP00000014488   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DQGRLLYSDFLTFLDRDdsaR...K
ENSOCUP00000027011   ..........terp-------------------------------------------------------...-...-
ENSOPRP00000010072   qvietqgpsrrlkl-------------------------------------------------------...-...-
ENSOPRP00000014054   ..............-CFPGNATVRLQSGERKGLRELHGGDWVLAHD------AAGRGVPTPVLLYLNGDqr.R...A
ENSTBEP00000010220   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PdrlR
ENSTBEP00000001345   ..............-CFSGNATVPLRSGERKILRELHRGDWVLAAD------AASRVDPTPVLLFLDRDlqrR...D
ENSSSCP00000017167   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PdrlR
ENSSSCP00000017394   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DEGRLLYSDFLTFLDRDdgaK...K
ENSSSCP00000000197   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSBTAP00000011124   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PdrlR
ENSBTAP00000000135   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSBTAP00000034059   ........aceslr-----------------------GGGRGVAPE------QTGRGAAARRNTFLDRDrgaK...K
tfI_ENSOARP00000021256 ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PdrlR
tfI_ENSOARP00000001718 ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
tfI_ENSOARP00000001737 ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
tfI_ENSOARP00000007435 ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAA------------------------...-...-
ENSVPAP00000000153   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
ENSTTRP00000009502   ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGSPTFSDVLIFLDRE...PdrlR
ENSTTRP00000013015   ..............-CFPGSATVHLEQGGTKLVKDLRPGDRVLAAD------DEGRLLYSDFLTFLDRDhgaK...K
ENSTTRP00000004503   ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A
Mpf_ENSMPUP00000016454 ..............-CFPAGAQVRLESGARVALSAVRPGDRVLAMG------EDGNPTFSDVLIFLDRE...PdrlR
Mpf_ENSMPUP00000014514 ..............-CFPGNATVRLRSGERKGLRELHRGDWVLAAD------AAGRVVPTPVLLFLDRDlqrR...A


                        60          70        80          90                              100       
                         |           |         |           |                                |       
d1am2a_                PVYAVRTVEG.LR.VTGTANHPLLCLVDVAG..VPTL.......................LWKLIDEIKPGDYAVIQ
ENSP00000295731      AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSP00000297261      VFYVIETREP.RErLLLTAAHLLFVAPHNDS..ATGEpeassgsgppsggalgp......RALFASRVRPGQRVYVV
ENSP00000266991      SFVAVETEWPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSPTRP00000022106   VFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSPTRP00000060583   EFQVIETQDPpRR.LALTPAHLLFTADNHTE..-PAP.......................APGHICQPRAGQYVLVA
ENSGGOP00000010547   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSGGOP00000023030   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSGGOP00000007809   SFVAVETEWPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSGGOP00000021296   VFYVIETREP.RErLLLPAAHLLFVAPHNDS..ATGEpeassgsgppsggalgp......RALFASRVRPGQRVYVV
ENSGGOP00000013669   VFYVIETREP.RErLLLPAAHLLFVAPHNDS..ATGEpeassgsgppsggalgp......RALFASRVRPGQRVYVV
ENSGGOP00000017031   SFVAVETEWPpRK.LLLTPWHLVFAARGP--..----.......................-----------------
ENSPPYP00000014741   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSPPYP00000020423   VFYVIETREP.RErLLLTAAHLLFVAPHNDS..AAGEpeassgsgppsggalgp......RALFASRVRPGQRVYVV
ENSPPYP00000005114   SFVAVETEWPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSNLEP00000011023   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSNLEP00000018692   VFYVIETREP.RErLLLTAAHLLFVAPHNDS..AAGEpeassgsgppsggalgp......RALFASRVRPGQRVYVV
ENSNLEP00000021679   SFVAVETEWPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
hFl_ENSPANP00000015169 AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
hFl_ENSPANP00000017379 VFYVIETREP.RErLLLTAAHLLFVAPHNDS..---Aaaepeafsgagppfegalgh...RALFASRVRPGQRVYVV
hFl_ENSPANP00000011936 SFVAVETERPpRK.LLLTPWHLVFAARGPAPs.PGDF.......................APVFARRLRAGDSVLAP
ENSMMUP00000001060   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSMMUP00000009646   VFYVIETREP.RErLLLTAAHLLFVAPHNDS..---Aaaepeafsgagppfegalgh...RALFASRVRPGQRVYVV
ENSMMUP00000016783   SFVAVETERPpRK.LLLTPWHLVFAARGPAPs.PGDF.......................APVFARRLRAGDSVLAP
ENSCJAP00000021087   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSCJAP00000038804   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSCJAP00000038806   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSCJAP00000037954   VFYVIETREP.RErLLLTAAHLLFVAPHNDS..AAGEsesssgvgpppgdalgr......RALFASRVRPGQRVYVV
ENSOGAP00000012635   AFQVIETRDPpRR.LTLTPAHLLFTADNHTEp.AAHF.......................RATFASHVQPGQYVLVA
ENSOGAP00000016602   VFYVIETREP.RErLLLTAAHLLFVAPHNDS..AAGLppggapgr...............RALFASRVRPGQRVYVV
ENSOGAP00000021869   SFVAVETEWPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSMICP00000000684   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSMICP00000015983   SFVAVETEWPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSMICP00000001911   ----------.--.-----------------..----.......................-----------------
ENSRNOP00000024419   AFQVIETQDPpRR.LALTPAHLLFIADNHTEp.AARF.......................RATFASHVQPGQYVLVA
ENSRNOP00000008497   VFYVIETREP.RErLLLTAAHLLFVAPHNDSgpTPGP.......................SPLFASRVRPGQRVYVV
ENSRNOP00000020563   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSMUSP00000128056   AFQVIETQDPpRR.LALTPAHLLFIADNHTEp.AAHF.......................RATFASHVQPGQYVLVS
ENSMUSP00000002708   VFYVIETLEP.RErLLLTAAHLLFVAPHNDSgpTPGP.......................SALFASRVRPGQRVYVV
ENSMUSP00000023737   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSDORP00000008328   TFQVIETQNPpRR.LALTPAHLLFTADNHTEs.AAHF.......................RATFASHVQPGQYVLVA
ENSDORP00000005309   VFYVIETREPrAR.LLLTAAHLLFVAPPHNGsaPAGR.......................RALFASSVRPGQRVYVA
ENSSTOP00000021364   AFQVIETQDPpRR.LALTPAHLLFTADNHTEp.VARF.......................RATFASHVQPGQYVLVA
ENSSTOP00000000164   SFVAVETERPpRK.LLLTPWHLVFAARGPAPe.PGDF.......................APVFARRLRAGDSVLAP
ENSSTOP00000015201   VFYVIETREP.RErLLLTAAHLLFVAPHNDS..AGDPeapwgtglppgr...........RALFASRVRPGQRVYV-
HGL_H00000295731     VFQVIETQDPpHR.LALTPAHLLFTADNHTEp.AAHF.......................RATFASHVQPGQYVLVA
HGL_H00000266991     SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSCPOP00000016106   VFQVIETLDPpRR.LSLTPAHLLFTADNHTE..PAHF.......................RATFASHVQPGQYVLVA
ENSCPOP00000002048   SFVAVETERPpRK.LLLTPWHLVFAARGPAPe.PGDF.......................APVFARRLRAGDSVLAP
ENSCPOP00000014589   VFYVIETREP.RErLLLTAAHLLFVAPPHND..STAG.......................EREVAAGVRPGQRVYVV
ENSOCUP00000025121   AFQVIETQDPpRR.LALTPAHLLFTADNRTEt.AARF.......................RATFASHVQPGQYVLVA
ENSOCUP00000014488   VFYVIETLEP.RErLLLTAAHLLFVAPHNAS..AAGEpelapgagpppggapgr......RALFASRVRPGQRVYVV
ENSOCUP00000027011   ---------P.RK.LLLTPWHLVFAARGPAPe.PGDF.......................APVFARRLRAGDSVLAP
ENSOPRP00000010072   ----------.--.----PAHLLFTADNHTEt.AAQF.......................RATFASHVQPGQYVLVA
ENSOPRP00000014054   LSVSVETERPpRK.LLLTPWQLVFAARG---..----.......................-----------------
ENSTBEP00000010220   AFQVIETQDPpRR.LDLTPAHLLFTADNHTEp.VAHF.......................RATFASHVQPGQYVLVA
ENSTBEP00000001345   SFVAVENERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSSSCP00000017167   AFQVIETQDPpRR.LALTPAHLLFTANNHTEp.AARF.......................RATFASQVQPGQYVLVA
ENSSSCP00000017394   VFYVIETREP.RErLLLTAAHLLFVAPH---..NNSAawepealsgagrppggapgr...RALFASRVRPGQHVYVV
ENSSSCP00000000197   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSBTAP00000011124   AFQVIETQDPpRR.LALTPAHLLFTANNHTEp.AAHF.......................RATFASQVQPGQYVLVA
ENSBTAP00000000135   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSBTAP00000034059   VFYAIETREP.RErLLLTAAHLLFVAPHNGS..---AagapegaaaaaaaaaagggapgrRALFASRVRPGQHVYVV
tfI_ENSOARP00000021256 AFQVIETQDPpRR.LALTPAHLLFTANNHTEp.AAHF.......................RATFASQVQPGQYVLVA
tfI_ENSOARP00000001718 SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
tfI_ENSOARP00000001737 SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
tfI_ENSOARP00000007435 ----------.--.-----------------..----.......................-----------------
ENSVPAP00000000153   SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP
ENSTTRP00000009502   AFQVIETQDPpRR.LALTPAHLLFTANNHTEp.ATHF.......................RATFASQVQPGQYVLVA
ENSTTRP00000013015   VFYAIETREP.RErLLLTAAHLLFVAPHNGS..AGREpealsgagrppggaper......RALFASSVRPGQHVYVV
ENSTTRP00000004503   SFVAVETERPpRK.LLLTPWHLVFAARGPAPe.PGDF.......................APVFARRLRAGDSVLAP
Mpf_ENSMPUP00000016454 AFRVIETQDPpRR.LALTPAHLLFTSNNHTEp.AAHF.......................RATFASQVQPGQYVLVA
Mpf_ENSMPUP00000014514 SFVAVETERPpRK.LLLTPWHLVFAARGPAPa.PGDF.......................APVFARRLRAGDSVLAP


                       110       120       130       140       150       160       170       180    
                         |         |         |         |         |         |         |         |    
d1am2a_                RSAFSVDCAGFARGKPEFAPTTYTVGVPGLVRFLEAHHRDPDAKAIADELTDGRFYYAKVASVTDAGVQPVYSLRVD
ENSP00000295731      GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSP00000297261      AERD-------------------------------------------------------------------------
ENSP00000266991      GGDALRPAR--------------------------------------------------------------------
ENSPTRP00000022106   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSPTRP00000060583   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSGGOP00000010547   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSGGOP00000023030   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSGGOP00000007809   GGDALRPAR--------------------------------------------------------------------
ENSGGOP00000021296   AERD-------------------------------------------------------------------------
ENSGGOP00000013669   AERD-------------------------------------------------------------------------
ENSGGOP00000017031   -----------------------------------------------------------------------------
ENSPPYP00000014741   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSPPYP00000020423   AERD-------------------------------------------------------------------------
ENSPPYP00000005114   GGDALRPAR--------------------------------------------------------------------
ENSNLEP00000011023   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSNLEP00000018692   AERD-------------------------------------------------------------------------
ENSNLEP00000021679   GGDALRPAR--------------------------------------------------------------------
hFl_ENSPANP00000015169 GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
hFl_ENSPANP00000017379 AERD-------------------------------------------------------------------------
hFl_ENSPANP00000011936 GGDALQPTR--------------------------------------------------------------------
ENSMMUP00000001060   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSMMUP00000009646   AERD-------------------------------------------------------------------------
ENSMMUP00000016783   GGDALRPTR--------------------------------------------------------------------
ENSCJAP00000021087   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSCJAP00000038804   GGDALRPAR--------------------------------------------------------------------
ENSCJAP00000038806   GGDALRPAR--------------------------------------------------------------------
ENSCJAP00000037954   AERD-------------------------------------------------------------------------
ENSOGAP00000012635   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSOGAP00000016602   AERN-------------------------------------------------------------------------
ENSOGAP00000021869   GGDALRPAR--------------------------------------------------------------------
ENSMICP00000000684   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSMICP00000015983   GGDALRPAR--------------------------------------------------------------------
ENSMICP00000001911   -----------------------------------------------------------------------------
ENSRNOP00000024419   GVPGLQPARVAAISTHVALGS--------------------------------------------------------
ENSRNOP00000008497   AERG-------------------------------------------------------------------------
ENSRNOP00000020563   GGDALRPAR--------------------------------------------------------------------
ENSMUSP00000128056   GVPGLQPARVAAVSTHVALGSY-------------------------------------------------------
ENSMUSP00000002708   AERG-------------------------------------------------------------------------
ENSMUSP00000023737   GGDALQPAR--------------------------------------------------------------------
ENSDORP00000008328   GIPGLQPARVASVSTHVALGAYA------------------------------------------------------
ENSDORP00000005309   S----------------------------------------------------------------------------
ENSSTOP00000021364   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSSTOP00000000164   GGDALRPAR--------------------------------------------------------------------
ENSSTOP00000015201   -----------------------------------------------------------------------------
HGL_H00000295731     GMPGLQPARVIAVSTHVALGAYA------------------------------------------------------
HGL_H00000266991     GGDALRPAR--------------------------------------------------------------------
ENSCPOP00000016106   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSCPOP00000002048   GGGALRPA---------------------------------------------------------------------
ENSCPOP00000014589   AERD-------------------------------------------------------------------------
ENSOCUP00000025121   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSOCUP00000014488   AERD-------------------------------------------------------------------------
ENSOCUP00000027011   GGDALRPAR--------------------------------------------------------------------
ENSOPRP00000010072   GVPGLQPAKVASVSTHVALGAYA------------------------------------------------------
ENSOPRP00000014054   -----------------------------------------------------------------------------
ENSTBEP00000010220   GAPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSTBEP00000001345   GGDALRPAR--------------------------------------------------------------------
ENSSSCP00000017167   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSSSCP00000017394   AE---------------------------------------------------------------------------
ENSSSCP00000000197   GGDALRPAR--------------------------------------------------------------------
ENSBTAP00000011124   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSBTAP00000000135   GGDALRPAR--------------------------------------------------------------------
ENSBTAP00000034059   AERG-------------------------------------------------------------------------
tfI_ENSOARP00000021256 GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
tfI_ENSOARP00000001718 GGDALRPAR--------------------------------------------------------------------
tfI_ENSOARP00000001737 GGDALRPAR--------------------------------------------------------------------
tfI_ENSOARP00000007435 -----------------------------------------------------------------------------
ENSVPAP00000000153   GGDALRPAR--------------------------------------------------------------------
ENSTTRP00000009502   GVPGLQPARVAAVSTHVALGAY-------------------------------------------------------
ENSTTRP00000013015   AERG-------------------------------------------------------------------------
ENSTTRP00000004503   GGDALRPAR--------------------------------------------------------------------
Mpf_ENSMPUP00000016454 GVPGLQAARVAAVST--------------------------------------------------------------
Mpf_ENSMPUP00000014514 GGDALRPAR--------------------------------------------------------------------


                          190                                                                       
                            |                                                                       
d1am2a_                TADHAFITNGFVSHN..............................................................
ENSP00000295731      ---------------apltkhgtlvvedvvascfa..........................................
ENSP00000297261      ---------------gdrrllpaavhsvtlseeaagayapltaqgtilinrvlascya...................
ENSP00000266991      ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSPTRP00000022106   ---------------apltrhgtlvvedvvascfa..........................................
ENSPTRP00000060583   ---------------apltrhgtlvvedvvascfa..........................................
ENSGGOP00000010547   ---------------apltrhgtlvvedvvascfa..........................................
ENSGGOP00000023030   ---------------apltrhgtlvvedvvascfa..........................................
ENSGGOP00000007809   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSGGOP00000021296   ---------------gdrrllpaavhsvtlseeaagayapltaqgtilinrvlascya...................
ENSGGOP00000013669   ---------------gdrrllpaavhsvtlseeaagayapltaqgtilinrvlascya...................
ENSGGOP00000017031   ---------------arqatlhrcsragyagdsvlapggdalrparvarvareeavgvfapltahgtllvndvlasc
ENSPPYP00000014741   ---------------apltrhgtlvvedvvascfa..........................................
ENSPPYP00000020423   ---------------gdrrllpaavhsvtlreeaagayapltaqgtilinrvlascya...................
ENSPPYP00000005114   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSNLEP00000011023   ---------------apltrhgtlvvedvvascfa..........................................
ENSNLEP00000018692   ---------------gdrrllpaavhsvtlreeaagayapltaqgtilinrvlascya...................
ENSNLEP00000021679   ---------------varvareeavgvfapltahgtllvndvlascya.............................
hFl_ENSPANP00000015169 ---------------apltrhgtlvvedvvascfa..........................................
hFl_ENSPANP00000017379 ---------------gdrrllpaavhsvtlreeaagayapltaqgtilinrvlascya...................
hFl_ENSPANP00000011936 ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSMMUP00000001060   ---------------apltrhgtlvvedvvascfa..........................................
ENSMMUP00000009646   ---------------gdrrllpaavhsvtlreeaagayapltaqgtilinrvlascya...................
ENSMMUP00000016783   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSCJAP00000021087   ---------------apltrhgtlvvedvvvscfa..........................................
ENSCJAP00000038804   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSCJAP00000038806   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSCJAP00000037954   ---------------gdrrllpaavhsvtlleeatgayapltvqgtsfihr..........................
ENSOGAP00000012635   ---------------apltrhgtlvvedvvascfa..........................................
ENSOGAP00000016602   ---------------gdrrllpasvhsvtlreeatgayapltaqgtilinrvlascya...................
ENSOGAP00000021869   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSMICP00000000684   ---------------apltrhgtlvvedvvascfa..........................................
ENSMICP00000015983   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSMICP00000001911   ---------------dkrl..........................................................
ENSRNOP00000024419   ---------------yapltrhgtlvvedvvascfa.........................................
ENSRNOP00000008497   ---------------gdrrllpaavhsvtlreeaagayapltahgtilinrvlascya...................
ENSRNOP00000020563   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSMUSP00000128056   ---------------apltrhgtlvvedvvascfa..........................................
ENSMUSP00000002708   ---------------gdrrllpaavhsvtlreeeagayapltahgtilinrvlascya...................
ENSMUSP00000023737   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSDORP00000008328   ---------------pltrhgtlvvedvvascfa...........................................
ENSDORP00000005309   ---------------grg...........................................................
ENSSTOP00000021364   ---------------apltrhgtlvvedvvascfa..........................................
ENSSTOP00000000164   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSSTOP00000015201   ---------------vt............................................................
HGL_H00000295731     ---------------pltrhgtlvvegvvascfa...........................................
HGL_H00000266991     ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSCPOP00000016106   ---------------apltrhgtlvvedvvascfa..........................................
ENSCPOP00000002048   ---------------rvarvareeavgvfapltahgtllvndvlascya............................
ENSCPOP00000014589   ---------------gdrrllpaavhsvtlreeaagayapltaqgtilinrvlascya...................
ENSOCUP00000025121   ---------------apltrhgtlvvedvvascfa..........................................
ENSOCUP00000014488   ---------------gdrrllpaavhsvtlreeatgayapltaqgtilinrvlascya...................
ENSOCUP00000027011   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSOPRP00000010072   ---------------pltrhgtlvvedvvascfa...........................................
ENSOPRP00000014054   ---------------..............................................................
ENSTBEP00000010220   ---------------apltrhgtlvmedvvascfa..........................................
ENSTBEP00000001345   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSSSCP00000017167   ---------------apltrhgtlvvedvvascfa..........................................
ENSSSCP00000017394   ---------------rggdrrllpaavhsvtlreeatgayapltaqgtilinrvlascya.................
ENSSSCP00000000197   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSBTAP00000011124   ---------------apltrhgtlvvedvvascfa..........................................
ENSBTAP00000000135   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSBTAP00000034059   ---------------garrllpaavhsvtlreetagayapltahgtilinrvlascya...................
tfI_ENSOARP00000021256 ---------------apltrhgtlvvedvvascfa..........................................
tfI_ENSOARP00000001718 ---------------varvareeavgvfapltahgtllvndvlascya.............................
tfI_ENSOARP00000001737 ---------------varvareeavgvfapltahgtllvndvlascya.............................
tfI_ENSOARP00000007435 ---------------gdeg..........................................................
ENSVPAP00000000153   ---------------varvareeavgvfapltahgtllvndvlascya.............................
ENSTTRP00000009502   ---------------apltrhgtlvvedvvascfa..........................................
ENSTTRP00000013015   ---------------gdrrllpaavhsvtlreestgayapltgqgtilinrvlascya...................
ENSTTRP00000004503   ---------------varvareeavgvfapltahgtllvndvlascya.............................
Mpf_ENSMPUP00000016454 ---------------hvavgayapltrhgtlvvedvvascfa...................................
Mpf_ENSMPUP00000014514 ---------------varvareeavgvfapltahgtllvndvlascya.............................


                         
                         
d1am2a_                ..
ENSP00000295731      ..
ENSP00000297261      ..
ENSP00000266991      ..
ENSPTRP00000022106   ..
ENSPTRP00000060583   ..
ENSGGOP00000010547   ..
ENSGGOP00000023030   ..
ENSGGOP00000007809   ..
ENSGGOP00000021296   ..
ENSGGOP00000013669   ..
ENSGGOP00000017031   ya
ENSPPYP00000014741   ..
ENSPPYP00000020423   ..
ENSPPYP00000005114   ..
ENSNLEP00000011023   ..
ENSNLEP00000018692   ..
ENSNLEP00000021679   ..
hFl_ENSPANP00000015169 ..
hFl_ENSPANP00000017379 ..
hFl_ENSPANP00000011936 ..
ENSMMUP00000001060   ..
ENSMMUP00000009646   ..
ENSMMUP00000016783   ..
ENSCJAP00000021087   ..
ENSCJAP00000038804   ..
ENSCJAP00000038806   ..
ENSCJAP00000037954   ..
ENSOGAP00000012635   ..
ENSOGAP00000016602   ..
ENSOGAP00000021869   ..
ENSMICP00000000684   ..
ENSMICP00000015983   ..
ENSMICP00000001911   ..
ENSRNOP00000024419   ..
ENSRNOP00000008497   ..
ENSRNOP00000020563   ..
ENSMUSP00000128056   ..
ENSMUSP00000002708   ..
ENSMUSP00000023737   ..
ENSDORP00000008328   ..
ENSDORP00000005309   ..
ENSSTOP00000021364   ..
ENSSTOP00000000164   ..
ENSSTOP00000015201   ..
HGL_H00000295731     ..
HGL_H00000266991     ..
ENSCPOP00000016106   ..
ENSCPOP00000002048   ..
ENSCPOP00000014589   ..
ENSOCUP00000025121   ..
ENSOCUP00000014488   ..
ENSOCUP00000027011   ..
ENSOPRP00000010072   ..
ENSOPRP00000014054   ..
ENSTBEP00000010220   ..
ENSTBEP00000001345   ..
ENSSSCP00000017167   ..
ENSSSCP00000017394   ..
ENSSSCP00000000197   ..
ENSBTAP00000011124   ..
ENSBTAP00000000135   ..
ENSBTAP00000034059   ..
tfI_ENSOARP00000021256 ..
tfI_ENSOARP00000001718 ..
tfI_ENSOARP00000001737 ..
tfI_ENSOARP00000007435 ..
ENSVPAP00000000153   ..
ENSTTRP00000009502   ..
ENSTTRP00000013015   ..
ENSTTRP00000004503   ..
Mpf_ENSMPUP00000016454 ..
Mpf_ENSMPUP00000014514 ..


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0035098 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizomucor miehei CAU432
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Galerina marginata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Podospora anserina
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Botrytis cinerea B05.10
NoYes   Blumeria graminis 22
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Alternaria brassicicola
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Microsporum gypseum
NoYes   Septoria musiva v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus nidulans FGSC A4
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus tubingensis v1.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tropicalis MYA-3404
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Selaginella moellendorffii
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Physcomitrella patens
NoYes   Chlorella variabilis sp. NC64A
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Fragilariopsis cylindrus
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus elongatus PCC 7942
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella lenta DSM 2243
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Frankia sp. EAN1pec
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Rhodococcus opacus B4
NoYes   Nocardia farcinica IFM 10152
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Microbacterium testaceum StLB037
NoYes   Intrasporangium calvum DSM 43043
NoYes   Isoptericola variabilis 225
NoYes   Cellulomonas flavigena DSM 20109
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter sp. FB24
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Clostridium clariflavum DSM 19732
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium cellulovorans 743B
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Ammonifex degensii KC4
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Bacillus selenitireducens MLS10
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Staphylococcus epidermidis RP62A
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Fibrella aestuarina
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Solitalea canadensis DSM 3403
NoYes   Sphingobacterium sp. 21
NoYes   Flavobacterium johnsoniae UW101
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Thermovirga lienii DSM 17291
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Treponema azotonutricium ZAS-9
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Aquifex aeolicus VF5
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Acidithiobacillus caldus SM-1
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Hippea maritima DSM 10411
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Pandoraea sp. RB-44
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   beta proteobacterium CB
NoYes   Thiomonas arsenitoxydans
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Advenella kashmirensis WT001
NoYes   Asticcacaulis excentricus CB 48
NoYes   Caulobacter sp. K31
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum sp. B510
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Xanthobacter autotrophicus Py2
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium radiobacter K84
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Aeromonas veronii B565
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Serratia proteamaculans 568
NoYes   Pantoea sp. At-9b
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Shigella flexneri 5 str. 8401
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Acinetobacter oleivorans DR1
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Fervidicoccus fontis Kam940
NoYes   Aeropyrum pernix K1
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Methanopyrus kandleri AV19
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasma volcanium GSS1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Methanobacterium sp. AL-21
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus fervens AG86
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Methanothermococcus okinawensis IH1
NoYes   Methanococcus aeolicus Nankai-3
NoYes   Methanothermus fervidus DSM 2088
NoYes   Methanothermobacter marburgensis str. Marburg
NoYes   Methanothermobacter thermautotrophicus str. Delta H
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem/NITR202
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae TN
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. longum JCM 1217
NoYes   Chthonomonas calidirosea T49
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus oshimai JL-2
NoYes   Thermus thermophilus JL-18
NoYes   Thermus thermophilus SG0.5JP17-16
NoYes   Thermus thermophilus HB8
NoYes   Clostridium thermocellum DSM 1313
NoYes   Sulfobacillus acidophilus TPY
NoYes   Clostridium acidurici 9a
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Desulfotomaculum gibsoniae DSM 7213
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Halobacteroides halobius DSM 5150
NoYes   Streptococcus constellatus subsp. pharyngis C1050
NoYes   Streptococcus constellatus subsp. pharyngis C818
NoYes   Streptococcus constellatus subsp. pharyngis C232
NoYes   Streptococcus suis D12
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus cereus B4264
NoYes   Staphylococcus aureus subsp. aureus Z172
NoYes   Staphylococcus aureus subsp. aureus TW20
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfobacula toluolica Tol2
NoYes   Sorangium cellulosum So0157-2
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis G2136
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis M01-240355
NoYes   Neisseria meningitidis 8013
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Neisseria gonorrhoeae TCDC-NG08107
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Octadecabacter arcticus 238
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium tropici CIAT 899
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Aggregatibacter actinomycetemcomitans D11S-1
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Aeromonas hydrophila ML09-119
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Coxiella burnetii CbuK_Q154
NoYes   Coxiella burnetii CbuG_Q212
NoYes   Coxiella burnetii RSA 331
NoYes   Coxiella burnetii RSA 493
NoYes   Serratia plymuthica S13
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas fluorescens A506
NoYes   Acinetobacter genomosp. 13TU RUH2624
NoYes   Acinetobacter baumannii ZW85-1
NoYes   Acinetobacter baumannii TYTH-1
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii BJAB0715
NoYes   Acinetobacter baumannii BJAB07104
NoYes   Acinetobacter baumannii TCDC-AB0715
NoYes   Acinetobacter baumannii MDR-TJ
NoYes   Acinetobacter baumannii MDR-ZJ06
NoYes   Acinetobacter baumannii AB0057
NoYes   Acinetobacter baumannii ACICU
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Caldisphaera lagunensis DSM 15908
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Thermococcus sp. AM4
NoYes   Thermococcus sp. CL1
NoYes   Thermococcus litoralis DSM 5473
NoYes   Pyrococcus sp. NA2
NoYes   Pyrococcus furiosus DSM 3638
NoYes   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
NoYes   Ferroplasma acidarmanus fer1
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Natronococcus occultus SP4
NoYes   Natronobacterium gregoryi SP2
NoYes   Haloquadratum walsbyi C23
NoYes   Halorhabdus tiamatea SARL4B
NoYes   Natronomonas moolapensis 8.8.11
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Guillardia theta
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   1_050719N (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Anaerobic methane oxidation (AOM) community from Eel River Basin sediment, California (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot Spring microbial communities from Yellowstone Obsidian Hot Spring, Sample 10594 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP2 from Nymph Lake 10 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma1 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]