SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

FAD/NAD(P)-binding domain alignments

These alignments are sequences aligned to the 0050927 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 spytvvdht..........................................................
cwb_MDP0000251581|PACid:22621152 spytvvdht..........................................................
cwb_MDP0000188391|PACid:22626210 spytvvdht..........................................................
cwb_MDP0000254144|PACid:22644986 egs................................................................
cwb_MDP0000321972|PACid:22643109 ps.................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 kk.................................................................
cwb_MDP0000162193|PACid:22629958 kk.................................................................
cwb_MDP0000769741|PACid:22637873 sps................................................................
cwb_MDP0000295277|PACid:22625688 n..................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 kk.................................................................
cwb_MDP0000318858|PACid:22682838 rtgk...............................................................
cwb_MDP0000248995|PACid:22642703 mdee...............................................................
cwb_MDP0000442206|PACid:22660061 rtgk...............................................................
cwb_MDP0000181673|PACid:22646891 mdee...............................................................
cwb_MDP0000315409|PACid:22681973 mdee...............................................................
cwb_MDP0000053966|PACid:22620929 mdee...............................................................
cwb_MDP0000294615|PACid:22655955 mdee...............................................................
cwb_MDP0000306147|PACid:22679041 kk.................................................................
cwb_MDP0000180064|PACid:22628138 kkn................................................................
cwb_MDP0000261625|PACid:22630921 pssss..............................................................
cwb_MDP0000300208|PACid:22651331 d..................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 kl.................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 itsdvneasgks.......................................................
cwb_MDP0000188994|PACid:22643055 s..................................................................
cwb_MDP0000159189|PACid:22672554 s..................................................................
cwb_MDP0000656178|PACid:22657871 ngsppksfd..........................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 n..................................................................
cwb_MDP0000231799|PACid:22673471 naxppksfd..........................................................
cwb_MDP0000255025|PACid:22624807 kl.................................................................
cwb_MDP0000231632|PACid:22622264 k..................................................................
cwb_MDP0000173300|PACid:22648712 nvk................................................................
cwb_MDP0000158474|PACid:22655457 ng.................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 p..................................................................
cwb_MDP0000549646|PACid:22624756 sanglnpsydlsafkfdpikesivsremtrrymtdmityad..........................
cwb_MDP0000158853|PACid:22672016 mvakks.............................................................
cwb_MDP0000702799|PACid:22650781 mvakks.............................................................
cwb_MDP0000233110|PACid:22669060 n..................................................................
cwb_MDP0000260827|PACid:22621315 dv.................................................................
cwb_MDP0000941459|PACid:22654340 mvakks.............................................................
cwb_MDP0000185338|PACid:22637072 dy.................................................................
cwb_MDP0000451172|PACid:22678939 h..................................................................
cwb_MDP0000136847|PACid:22626492 fsylkfvrnatdlplqek.................................................
cwb_MDP0000177641|PACid:22624304 qvsgks.............................................................
cwb_MDP0000413935|PACid:22663920 dv.................................................................
cwb_MDP0000206098|PACid:22637273 sanglnpsyxlsafkfdpikesivsremtrrymtdmityad..........................
cwb_MDP0000845788|PACid:22673064 esppaspenaie.......................................................
cwb_MDP0000465595|PACid:22654474 sgks...............................................................
cwb_MDP0000137211|PACid:22645789 fsylkfvrnatdlplqee.................................................
cwb_MDP0000130099|PACid:22624356 sehdfsysksvvnatdlpqee..............................................
cwb_MDP0000425135|PACid:22674685 ylkfvvnatdfptedy...................................................
cwb_MDP0000200780|PACid:22660656 n..................................................................
cwb_MDP0000142434|PACid:22683351 g..................................................................
cwb_MDP0000248951|PACid:22626490 dfsylkfvrnatdlplqek................................................
cwb_MDP0000869086|PACid:22644121 sk.................................................................
cwb_MDP0000318256|PACid:22681338 rnfsyvkfvrnatdlpllee...............................................
cwb_MDP0000231634|PACid:22622267 k..................................................................
cwb_MDP0000626995|PACid:22630905 sanglnpsynlsafkfdpikesivsremtrrymtdmityad..........................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 msangltpsydlsafkfdpikesivsremtrrymtdmityad.........................
cwb_MDP0000199159|PACid:22674497 sk.................................................................
cwb_MDP0000162755|PACid:22662459 g..................................................................
cwb_MDP0000173666|PACid:22649255 k..................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 qvsgks.............................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 dfsysksvinatdlplee.................................................
cwb_MDP0000175650|PACid:22652650 p..................................................................
cwb_MDP0000233802|PACid:22672706 ddlktlrt...........................................................
cwb_MDP0000321186|PACid:22667177 dr.................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 a..................................................................
cwb_MDP0000823251|PACid:22668430 ddlktlrt...........................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ik.................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 vsgks..............................................................
cwb_MDP0000295839|PACid:22658517 eev................................................................
cwb_MDP0000903805|PACid:22678063 lvfqnfsylkfvrnatdlplqee............................................
cwb_MDP0000202123|PACid:22678734 ydf................................................................
cwb_MDP0000227773|PACid:22639029 pkx................................................................
cwb_MDP0000317524|PACid:22631851 sk.................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 n..................................................................
cwb_MDP0000235846|PACid:22627807 ptddlktlrt.........................................................
cwb_MDP0000251344|PACid:22682514 ptddlktlrt.........................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ev.................................................................
cwb_MDP0000293482|PACid:22637734 p..................................................................
cwb_MDP0000233995|PACid:22662680 ev.................................................................
cwb_MDP0000257243|PACid:22657003 vfqnfsyvkfvrnatdlplqee.............................................
cwb_MDP0000160099|PACid:22658087 qpk................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 sylkfvrnatdlplqek..................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 kk.................................................................
cwb_MDP0000169201|PACid:22625917 mgk................................................................
cwb_MDP0000399642|PACid:22674547 mgk................................................................
cwb_MDP0000582079|PACid:22634000 ev.................................................................
cwb_MDP0000129765|PACid:22673448 p..................................................................
cwb_MDP0000272655|PACid:22672104 lvfqnfsylkfvcnatdlplqee............................................
cwb_MDP0000686821|PACid:22637777 ev.................................................................
cwb_MDP0000170414|PACid:22675630 mgk................................................................
cwb_MDP0000320804|PACid:22671446 mgk................................................................
cwb_MDP0000189790|PACid:22676146 v..................................................................
cwb_MDP0000847111|PACid:22682055 v..................................................................
cwb_MDP0000289536|PACid:22677728 e..................................................................
cwb_MDP0000123987|PACid:22662898 mgk................................................................
cwb_MDP0000245245|PACid:22671727 mgk................................................................
cwb_MDP0000188553|PACid:22658192 s..................................................................
cwb_MDP0000296599|PACid:22628159 k..................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 vs.................................................................
cwb_MDP0000151331|PACid:22656760 dfgylkfvynatdlplgxk................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 pskp...............................................................
cwb_MDP0000320539|PACid:22651795 y..................................................................
cwb_MDP0000239909|PACid:22648375 r..................................................................
cwb_MDP0000259264|PACid:22650726 vs.................................................................
cwb_MDP0000293613|PACid:22654008 isasasnpl..........................................................
cwb_MDP0000253362|PACid:22653297 isasasnpl..........................................................
cwb_MDP0000182973|PACid:22649063 v..................................................................
cwb_MDP0000138005|PACid:22620884 s..................................................................
cwb_MDP0000261301|PACid:22674262 tt.................................................................
cwb_MDP0000771633|PACid:22649768 l..................................................................
cwb_MDP0000851102|PACid:22674240 l..................................................................
cwb_MDP0000159873|PACid:22673571 nl.................................................................
cwb_MDP0000140206|PACid:22652348 ks.................................................................
cwb_MDP0000261201|PACid:22657417 nl.................................................................
cwb_MDP0000252244|PACid:22643267 l..................................................................
cwb_MDP0000261821|PACid:22664612 aakn...............................................................
cwb_MDP0000124454|PACid:22663639 pskp...............................................................
cwb_MDP0000234830|PACid:22664319 l..................................................................
cwb_MDP0000297861|PACid:22646554 re.................................................................
cwb_MDP0000152184|PACid:22632666 y..................................................................
cwb_MDP0000157871|PACid:22670351 islkks.............................................................
cwb_MDP0000250932|PACid:22662666 r..................................................................
cwb_MDP0000219521|PACid:22657613 g..................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 g..................................................................
cwb_MDP0000222306|PACid:22645946 g..................................................................
cwb_MDP0000829384|PACid:22650105 tt.................................................................
cwb_MDP0000145663|PACid:22632174 rsrl...............................................................
cwb_MDP0000288439|PACid:22643642 sgks...............................................................
cwb_MDP0000267350|PACid:22676208 erl................................................................
cwb_MDP0000155608|PACid:22665289 lkvaiidsnpavsnglsikkedppdprasavapatislfqdigawkyveqnrhayfdqmqvwdytgl
cwb_MDP0000194622|PACid:22683388 v..................................................................
cwb_MDP0000134271|PACid:22620865 k..................................................................
cwb_MDP0000312748|PACid:22644976 dkk................................................................
cwb_MDP0000197715|PACid:22640206 ikr................................................................
cwb_MDP0000220943|PACid:22675739 ki.................................................................
cwb_MDP0000320539|PACid:22651795 a..................................................................
cwb_MDP0000140206|PACid:22652348 g..................................................................
cwb_MDP0000215521|PACid:22667208 ki.................................................................
cwb_MDP0000203847|PACid:22681509 nt.................................................................
cwb_MDP0000201011|PACid:22661057 nt.................................................................
cwb_MDP0000204596|PACid:22635084 whfanldygcaaplkevslpnwnqddvyggfggahciikggys........................
cwb_MDP0000148978|PACid:22620687 frasprptkpl........................................................
cwb_MDP0000130369|PACid:22663416 kekk...............................................................
cwb_MDP0000314606|PACid:22664349 isasasnpl..........................................................
cwb_MDP0000263146|PACid:22654671 kk.................................................................
cwb_MDP0000250583|PACid:22633065 dkkkp..............................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 tgnlnlitqalaavgcempvipdpttvhyhlpdnlsvlvhreysefisertskfphekqgilkfygv
cwb_MDP0000261638|PACid:22646820 mdee...............................................................
cwb_MDP0000130370|PACid:22654204 kekk...............................................................
cwb_MDP0000272119|PACid:22671033 at.................................................................
cwb_MDP0000305861|PACid:22662391 kq.................................................................
cwb_MDP0000255696|PACid:22677008 kk.................................................................
cwb_MDP0000214280|PACid:22681133 rdfgylkfvynatdlplgxk...............................................
cwb_MDP0000210966|PACid:22644665 sy.................................................................
cwb_MDP0000610999|PACid:22659782 pst................................................................
cwb_MDP0000242546|PACid:22662348 pst................................................................
cwb_MDP0000320742|PACid:22645070 epdresiq...........................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 qkftseegvpnvrgwvldgssminagfyttadkeffmksgiewdmysvykayrwveetivfpptmdr
cwb_MDP0000235080|PACid:22654616 mnt................................................................
cwb_MDP0000284363|PACid:22634918 kk.................................................................
cwb_MDP0000125043|PACid:22648273 vtiedgrnfiadaaiitvphgilkakliefvpqlpewkvaaisdlgvgnenkvalrfekxfwpnvel
cwb_MDP0000192359|PACid:22632529 wlylyhsnlrgrvlgggsainggffsrasddyvkrvgwnkqmvsdaykwvesrnafkpkltpwqyva
cwb_MDP0000440005|PACid:22623062 grerk..............................................................
cwb_MDP0000609131|PACid:22633588 t..................................................................
cwb_MDP0000362000|PACid:22628256 kp.................................................................
cwb_MDP0000150210|PACid:22663655 kk.................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 klgirslvlessdsmrmtgfalttwtnawkaldal................................
cwb_MDP0000569169|PACid:22666591 lisasasnpl.........................................................
cwb_MDP0000525742|PACid:22647174 e..................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 empvipdpttvhyhlpdnlsvlvhreysefisertskfphekqgilkfygvcwkvfnasnslelksl
cwb_MDP0000919183|PACid:22661837 h..................................................................
cwb_MDP0000146158|PACid:22623090 h..................................................................
cwb_MDP0000832077|PACid:22645850 ki.................................................................
cwb_MDP0000621365|PACid:22669861 atdlplee...........................................................
cwb_MDP0000875229|PACid:22620206 lvitsdhalklefvpew..................................................
cwb_MDP0000251344|PACid:22682514 lrt................................................................
cwb_MDP0000168919|PACid:22641114 xleq...............................................................
cwb_MDP0000267855|PACid:22645516 r..................................................................
cwb_MDP0000195207|PACid:22668389 vg.................................................................
cwb_MDP0000400145|PACid:22662498 ttt................................................................
cwb_MDP0000919183|PACid:22661837 kp.................................................................
cwb_MDP0000307336|PACid:22681275 k..................................................................
cwb_MDP0000263146|PACid:22654671 kkllsf.............................................................
cwb_MDP0000309730|PACid:22638555 r..................................................................
cwb_MDP0000163903|PACid:22648802 s..................................................................
cwb_MDP0000611628|PACid:22643604 h..................................................................
cwb_MDP0000119779|PACid:22649695 s..................................................................
cwb_MDP0000120904|PACid:22629470 g..................................................................
cwb_MDP0000150544|PACid:22634453 kk.................................................................
cwb_MDP0000902209|PACid:22678199 r..................................................................
cwb_MDP0000269370|PACid:22680893 gvfanaevilsagtlgtpqlllxsgigpesylsslnitvvrdhpfvgqfvydnprnfinivppnpie
cwb_MDP0000146158|PACid:22623090 ekp................................................................
cwb_MDP0000124051|PACid:22654473 q..................................................................
cwb_MDP0000255696|PACid:22677008 ekkril.............................................................
cwb_MDP0000305861|PACid:22662391 ekkril.............................................................
cwb_MDP0000611628|PACid:22643604 kp.................................................................
cwb_MDP0000309622|PACid:22670269 v..................................................................
cwb_MDP0000239909|PACid:22648375 hd.................................................................
cwb_MDP0000126888|PACid:22675379 r..................................................................
cwb_MDP0000869086|PACid:22644121 lqe................................................................
cwb_MDP0000317524|PACid:22631851 sk.................................................................
cwb_MDP0000160099|PACid:22658087 qieslq.............................................................
cwb_MDP0000251205|PACid:22649529 nxiydsdpleki.......................................................
cwb_MDP0000314335|PACid:22679828 ermlr..............................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 rer................................................................
cwb_MDP0000748068|PACid:22649054 mlsgvgpaeqlkahnitvvvdqpmvgqgmsdnpmnaifvpspipvevsliqvvgithfgsyieaasg
cwb_MDP0000727481|PACid:22682921 mlsgvgpaeqlkahnitvvvdqpmvgqgmsdnpmnaifvpspipvevsliqvvgithfgsyieaasg
cwb_MDP0000301246|PACid:22669391 tsipypv............................................................
cwb_MDP0000190684|PACid:22677586 kvlfv..............................................................
cwb_MDP0000456223|PACid:22643829 mdee...............................................................
cwb_MDP0000745172|PACid:22667211 ssydlsafkfdpikesivsremtrhymtdmityadtg..............................
cwb_MDP0000407932|PACid:22626437 vtdillgkndnvegvrtffgmnfyspsvilttgtfmsgkiwvgrts.....................
cwb_MDP0000440896|PACid:22680420 ptnqgdgdncfisa.....................................................
cwb_MDP0000694227|PACid:22673619 lvadergyehllhkmaedflfnsegkllds.....................................
cwb_MDP0000123987|PACid:22662898 siilkkspsslsfdqegilv...............................................
cwb_MDP0000138005|PACid:22620884 s..................................................................
cwb_MDP0000258205|PACid:22638470 fdpstrsrl..........................................................
cwb_MDP0000245245|PACid:22671727 siilkkspsslsfdqegilv...............................................
cwb_MDP0000306704|PACid:22680179 ikivhsnvhkvpttdmealkpllmglfekrrafkfiiyvqdysetdpktregmdltrvttrdliaky
cwb_MDP0000478654|PACid:22674637 t..................................................................
cwb_MDP0000728219|PACid:22657389 me.................................................................
cwb_MDP0000170414|PACid:22675630 egevs..............................................................
cwb_MDP0000284363|PACid:22634918 h..................................................................
cwb_MDP0000219560|PACid:22625984 mgatwihgiggspvhkiaqeinprvsasvgvhgrvlrrahhrremwvgagtgcggphfvsvqeldgl
cwb_MDP0000235930|PACid:22635275 m..................................................................
cwb_MDP0000755938|PACid:22650525 kivfkrstskwwfsad...................................................
cwb_MDP0000138851|PACid:22674897 nk.................................................................
cwb_MDP0000261638|PACid:22646820 ptnqdagdncfisa.....................................................
cwb_MDP0000317524|PACid:22631851 qieslqed...........................................................
cwb_MDP0000294615|PACid:22655955 ptnqdagdncfisa.....................................................
cwb_MDP0000208234|PACid:22624840 nk.................................................................
cwb_MDP0000216129|PACid:22668259 ggdhcflpggngrlvhalaenvpilyerivntvrygsgrvqlcnccwrsllialvageaahkfetmp
cwb_MDP0000219521|PACid:22657613 fseadkgkivfkrstskwwf...............................................
cwb_MDP0000248995|PACid:22642703 pvneptldncfistsy...................................................
cwb_MDP0000256328|PACid:22629063 kp.................................................................
cwb_MDP0000181673|PACid:22646891 pvnepaldncfistsy...................................................
cwb_MDP0000169201|PACid:22625917 egevs..............................................................
cwb_MDP0000263530|PACid:22651991 qieqknt............................................................
cwb_MDP0000295839|PACid:22658517 dgk................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 tisppwdfvdtpcdyasycggcsqgssnymealksplmgliekliarkfilyvqdysetdpkthegm
cwb_MDP0000053966|PACid:22620929 ptnqdagdncfisa.....................................................
cwb_MDP0000795740|PACid:22666880 gng................................................................
cwb_MDP0000212327|PACid:22630830 a..................................................................
cwb_MDP0000437365|PACid:22632357 ee.................................................................
cwb_MDP0000135231|PACid:22629791 qt.................................................................
cwb_MDP0000167343|PACid:22638473 eadkgkivfkrstskwwfs................................................
cwb_MDP0000222306|PACid:22645946 eadkgkivfkrstskwwfs................................................
cwb_MDP0000183517|PACid:22634175 p..................................................................
cwb_MDP0000686821|PACid:22637777 gk.................................................................
cwb_MDP0000430157|PACid:22655785 hyhggcrvgrvvdkgyrvpgidsl...........................................
cwb_MDP0000373054|PACid:22683333 grrvhvierdlsepdrivgell.............................................
cwb_MDP0000295306|PACid:22673308 pvneptldncfistsy...................................................
cwb_MDP0000233995|PACid:22662680 sgk................................................................
cwb_MDP0000209681|PACid:22642739 gk.................................................................
cwb_MDP0000876898|PACid:22679933 tmqnksmpaapqptpgaillgdafnmrhpltggg.................................
cwb_MDP0000738522|PACid:22680891 gfaynlqqeddgttpvqrimsedgiptvrgrllggtsminagvyaranmsfynqsgiewdmelvnnt
cwb_MDP0000399642|PACid:22674547 egevs..............................................................
cwb_MDP0000215521|PACid:22667208 kilfkrsskxwfwsgg...................................................
cwb_MDP0000170521|PACid:22675770 ddnrvgplykhifppslapalsfvglpwkaepfpmfelqskwiagvlsnrialpsqqemmedvkafy
cwb_MDP0000262982|PACid:22620906 rgk................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 g..................................................................
cwb_MDP0000837610|PACid:22643529 mpatpvpt...........................................................
cwb_MDP0000582079|PACid:22634000 gk.................................................................
cwb_MDP0000538071|PACid:22663035 ggcqvgrvvdhdykvlg..................................................
cwb_MDP0000241703|PACid:22642424 rp.................................................................
cwb_MDP0000671114|PACid:22638724 sydlsafkfdpikesivsremtrxymtdmityadtg...............................
cwb_MDP0000315388|PACid:22681954 tvtganseglsaigimysdsngrshcafvrskaevllsasaigshqllqln................
cwb_MDP0000134271|PACid:22620865 k..................................................................
cwb_MDP0000297581|PACid:22646099 grirfqrsildfeqrkrqlxydetsgfwr......................................
cwb_MDP0000911003|PACid:22677366 f..................................................................
cwb_MDP0000576650|PACid:22634720 m..................................................................
cwb_MDP0000149205|PACid:22670334 fisv...............................................................
cwb_MDP0000315409|PACid:22681973 ptnqgdgdncfisavrmnef...............................................
cwb_MDP0000320804|PACid:22671446 ngessp.............................................................
cwb_MDP0000474647|PACid:22667377 tsv................................................................
cwb_MDP0000566648|PACid:22666666 tsv................................................................
cwb_MDP0000171379|PACid:22629613 mdee...............................................................
cwb_MDP0000814529|PACid:22673539 tsv................................................................
cwb_MDP0000218295|PACid:22671514 gitkgwetkkkmftsv...................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ihgripqlavigfseslsnlytsemrcrwvaellgrtftlpsikemekdvn................
cwb_MDP0000919706|PACid:22656631 qnfgylkfvrnatdlplqee...............................................
cwb_MDP0000295675|PACid:22626457 tsv................................................................
cwb_MDP0000147542|PACid:22652542 tsv................................................................
cwb_MDP0000272126|PACid:22655119 aatl...............................................................
cwb_MDP0000196881|PACid:22654963 v..................................................................
cwb_MDP0000268346|PACid:22678394 mftsv..............................................................
cwb_MDP0000147542|PACid:22652542 mftsv..............................................................
cwb_MDP0000948298|PACid:22676144 rhpltgggmtvalsdivvlrnllrplhnlndapal................................
cwb_MDP0000220943|PACid:22675739 kgkilfkrsskwwfwsg..................................................
cwb_MDP0000182589|PACid:22648509 mftsi..............................................................
cwb_MDP0000557870|PACid:22631128 ivrin..............................................................
cwb_MDP0000308870|PACid:22652882 mfanglnpsydlsafkfdpikesivsremtrxyxtdxityadtg.......................
cwb_MDP0000322449|PACid:22657441 litqalaavgcempvipdpttvhyhlpdnlsvlvhreysefisertskfphekqgilkfygvcwkvf
cwb_MDP0000286494|PACid:22671310 tsv................................................................
cwb_MDP0000150868|PACid:22621264 rhpltgggmtvalsdivllrdllrplsdfndapal................................
cwb_MDP0000155608|PACid:22665289 nlsmgmestssglneqgnlakldli..........................................
cwb_MDP0000168505|PACid:22672316 lpsvseeekkkllsf....................................................
cwb_MDP0000196888|PACid:22670849 satgvfltpeiexs.....................................................
cwb_MDP0000154812|PACid:22632894 tsv................................................................
cwb_MDP0000186080|PACid:22622639 tsv................................................................
cwb_MDP0000220012|PACid:22626541 sc.................................................................
cwb_MDP0000169409|PACid:22673915 sf.................................................................
cwb_MDP0000373095|PACid:22661923 fpgh...............................................................
cwb_MDP0000235846|PACid:22627807 lrt................................................................
cwb_MDP0000207126|PACid:22623152 gflffesqakwiaqllsgkttlpsrddmmqsikefyhsreva.........................
cwb_MDP0000268357|PACid:22630891 seeekkkllsf........................................................
cwb_MDP0000149067|PACid:22669209 ppksfd.............................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 ...................................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 gytrynardvhkdslgcvvenkvlhssllscmqntdfqktvypsrlstmtlqprnlsmgmestssgl
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 cwkvfnasnslelksleepiyhfgqffqkpvecltlayylpqnagdiackyiqdpqllsfidaevmc
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 wqsavakafmeadvgp...................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 lgivapnsyacgyflnlhkatghpvlvymaagrfaydlekltddaavnfvmlqlkkmlpdatepvqy
cwb_MDP0000192359|PACid:22632529 elsfleagifpyngfsldhikgtkigattfdeqgrrhtsadlltagn....................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 eepiyhfgqffqkpvecltlayylpqnagdiackyiqdpqllsf.......................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 asivtvlgitdyfyqcslssmplttpayslfptplvvnstfthi.......................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 enfaggsttkdfgmfspkigqlstvppkqrtpeala...............................
cwb_MDP0000727481|PACid:22682921 enfaggsttkdfgmfspkigqlstvppkqrtpeala...............................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 glddntvdfigh.......................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 csgeaeseyrmfpgeeiiiakgylsivqslasvlppgli............................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ptdavtrviqilkgiyepqgitvpepiqtictrwgsdpfslgaysnvavgasgddydilaes.....
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 nltrvttrdliakyglddnnvdfirhalalhrddcylne............................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 yewvedtivykpnsfp...................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ssleasgtpkh........................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 nasnslelks.........................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                     10        20                        30         
                                                      |         |                         |         
d1xdia1                          ............VTRIVILGGGPAGYEAALVAATS..............HPETT..QVTVI......
cwb_MDP0000813172|PACid:22649115 ............-YDAVVVGAGGAGLRAAIGLSEH..............GFN--..-TACI......
cwb_MDP0000251581|PACid:22621152 ............-YDAVVVGAGGAGLRAAIGLSEH..............GFN--..-TACI......
cwb_MDP0000188391|PACid:22626210 ............-YDAVVVGAGGAGLRAAIGLSEH..............GFN--..-TACI......
cwb_MDP0000254144|PACid:22644986 ............---VIIVGAGLAGLAAARQLMQL..............GFK--..-VAVL......
cwb_MDP0000321972|PACid:22643109 ............---VIVIGGGISGIAAARILHDA..............SFK--..-VLLL......
cwb_MDP0000299806|PACid:22682346 ............--NVVIVGAGLAGLVAARQLVFL..............GFK--..-VVVL......
cwb_MDP0000283451|PACid:22680462 ............--NVVIVGAGLAGLVAARQLVFL..............GFK--..-VAVL......
cwb_MDP0000296714|PACid:22644308 ............--KIIVIGAGPAGLTAARHLQRQ..............GFS--..-VTIL......
cwb_MDP0000162193|PACid:22629958 ............--KIIVIGAGPAGLTAARHLQRQ..............GFS--..-VTIL......
cwb_MDP0000769741|PACid:22637873 ............---VIVIGGGMAGVSAARALHDA..............SIQ--..-VVLL......
cwb_MDP0000295277|PACid:22625688 ............--DVVVVGGGPGGYVAAIKAAQL..............GLK--..-TTCI......
cwb_MDP0000897124|PACid:22647159 ............--DVVVVGGGPGGYVAAIKAAQL..............GLK--..-TTCI......
cwb_MDP0000854208|PACid:22682207 ............-FDFAVIGSGVAGLRYALEVAKH..............G-S--..-VAVI......
cwb_MDP0000241767|PACid:22665328 ............--KIIVIGAGPAGLTAARHLQRQ..............GFS--..-VTIL......
cwb_MDP0000318858|PACid:22682838 ............--RVAIVGSGPAGLAAADQLNRI..............GHT--..-VTVY......
cwb_MDP0000248995|PACid:22642703 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000442206|PACid:22660061 ............--RVAIVGSGPAGLAAADQLNRI..............GHT--..-VTVY......
cwb_MDP0000181673|PACid:22646891 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000315409|PACid:22681973 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000053966|PACid:22620929 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000294615|PACid:22655955 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000306147|PACid:22679041 ............--KIIVIGAGPAGLIAVCNLQRQ..............GFS--..-VTIL......
cwb_MDP0000180064|PACid:22628138 ............-YDAIVIGSGIGGLVAATQLAVK..............GAK--..-VLVL......
cwb_MDP0000261625|PACid:22630921 ............---VIIVGAGVSGLSAAKVLIEN..............GVED-..-VVIL......
cwb_MDP0000300208|PACid:22651331 ............-FDLFVIGAGSGGVRASRFSANF..............GAK--..-VGIC......
cwb_MDP0000247171|PACid:22623108 ............--DVVIVGAGIAGLATAVALKRA..............GVE--..-AXVL......
cwb_MDP0000308095|PACid:22667065 ............--KVAIIGAGLAGMSTAVELLDQ..............GHE--..-VDIY......
cwb_MDP0000319421|PACid:22624123 ............---IVIVGGGICGLATALALHRK..............GIR--..-SVVL......
cwb_MDP0000232295|PACid:22657598 ............-FDYIVIGGGTAGCPLAATLSEK..............-FS--..-VLLV......
cwb_MDP0000188994|PACid:22643055 ............---VVIVGAGIAGLSAALGLHRL..............GIR--..-SLVL......
cwb_MDP0000159189|PACid:22672554 ............---VVIVGAGIAGLSAALGLHRL..............GIR--..-SLVL......
cwb_MDP0000656178|PACid:22657871 ............-YDLLIIGAGVGGHGAALHAVEK..............GLK--..-TAIV......
cwb_MDP0000910523|PACid:22620639 ............--DVVIVGAGIAGLATAVALKKA..............GLK--..-ALVL......
cwb_MDP0000119941|PACid:22643547 ............--DVVVVGGGPGGYVAAIKAAQL..............GLK--..-TTCI......
cwb_MDP0000231799|PACid:22673471 ............-YDLLIIGAGVGGHGAALHAVEK..............GLK--..-TAIV......
cwb_MDP0000255025|PACid:22624807 ............--KVAIIGAGLAGMSTAVELLDQ..............GHE--..-VDIY......
cwb_MDP0000231632|PACid:22622264 ............--RVAVVGAGVSGLAAAYKLKSH..............GFD--..-VAVF......
cwb_MDP0000173300|PACid:22648712 ............-CDVIIVGSGCGGGVAAAALASS..............GHK--..-VIVL......
cwb_MDP0000158474|PACid:22655457 ............-YDYIVVGGGTAGCPLAATLSKN..............-FN--..-VLVL......
cwb_MDP0000276878|PACid:22649644 ............-MRVAVIGAGMSGLVSAYVLAKE..............GVE--..-VVVY......
cwb_MDP0000154720|PACid:22639222 ............-YDIAIVGGGMVGMALACSLAKMpltk..........HLK--..-VAII......
cwb_MDP0000549646|PACid:22624756 ............-TDVVVVGAGSAGLSCAYELSKNp.............DVQ--..-VAII......
cwb_MDP0000158853|PACid:22672016 ............--RVVIIGAGMAGVTAANKLYTAag............SKDLF..ELVVV......
cwb_MDP0000702799|PACid:22650781 ............--RVVIIGAGMAGVTAANKLYTAag............SKDLF..ELVVV......
cwb_MDP0000233110|PACid:22669060 ............-CDVVIVGSGCGGGVAAAVLAQS..............GQK--..-VVVL......
cwb_MDP0000260827|PACid:22621315 ............--DVIIVGAGVAGAALAHTLGKD..............GRR--..-VHVI......
cwb_MDP0000941459|PACid:22654340 ............--RIVIIGAGMAGVTAANKLYTAag............SKDLF..ELVVV......
cwb_MDP0000185338|PACid:22637072 ............-YDYIIVGGGTAGCPLAATLSSR..............-FR--..-VLLL......
cwb_MDP0000451172|PACid:22678939 ............-YDYIVIGGGTAGCPLAATLS-H..............GAT--..-VLVL......
cwb_MDP0000136847|PACid:22626492 ............-YDYIVVGGGTAGCPLAATLSAN..............-YS--..-VLLL......
cwb_MDP0000177641|PACid:22624304 ............-FDYIIVGGGTAGCPLAATLSEK..............-FS--..-VLLV......
cwb_MDP0000413935|PACid:22663920 ............--DVIIVGAGVAGAALAHTLGKD..............GRR--..-VHVI......
cwb_MDP0000206098|PACid:22637273 ............-TDVVVVGAGSAGLSCAYELSKNp.............DVQ--..-VAII......
cwb_MDP0000845788|PACid:22673064 ............--NVVIIGSGPAGFTAAIYAARA..............NLK--..-PLVF......
cwb_MDP0000465595|PACid:22654474 ............-FDYIVIGGGTAGCPLAATLSEK..............-FS--..-VLLV......
cwb_MDP0000137211|PACid:22645789 ............-YDYIVVGGGTAGCPLATTLSAN..............-YS--..-VLLL......
cwb_MDP0000130099|PACid:22624356 ............VYDYIVVGGGTAGCPLAATLSL-..............NYS--..-VLVL......
cwb_MDP0000425135|PACid:22674685 ............-YDYIIVGGGTAGCPLAATLSSR..............-FR--..-VLLL......
cwb_MDP0000200780|PACid:22660656 ............---IVIVGAGIAGLATALSLHRL..............GVG--..-SLVL......
cwb_MDP0000142434|PACid:22683351 ............---IAIVGGGICGLATALALHRK..............GFT--..-SVVL......
cwb_MDP0000248951|PACid:22626490 ............-YDYIVVGGGTAGCPLAATLSAN..............-YS--..-VLLL......
cwb_MDP0000869086|PACid:22644121 ............--NVCVIGAGPSGLVAARELRKE..............GHK--..-VVVL......
cwb_MDP0000318256|PACid:22681338 ............-YDYIVVGGGTAGCPLATTLSAN..............-YS--..-VLLL......
cwb_MDP0000231634|PACid:22622267 ............--RVAVVGGGVSGLAAAYKLKSH..............GFD--..-VAVF......
cwb_MDP0000626995|PACid:22630905 ............-TDVVVVGAGSAGLSCAYELSKNp.............DVQ--..-VAII......
cwb_MDP0000123832|PACid:22633934 ............---------GIAGLATAVALKRA..............GVE--..-AXVL......
cwb_MDP0000236092|PACid:22632501 ............-TDVVVVGAGSAGLSCAYELSKNp.............DVQ--..-VAII......
cwb_MDP0000199159|PACid:22674497 ............--NVCVIGAGPSGLVAARELRKE..............GHS--..-VVVL......
cwb_MDP0000162755|PACid:22662459 ............---VVIVGAGLSGLATSLGLHRL..............GIR--..-SLVL......
cwb_MDP0000173666|PACid:22649255 ............--RVAVVGAGVSGLAAAYKLKSH..............GFD--..-VAVF......
cwb_MDP0000262982|PACid:22620906 ............----IIVGAGPSGLATAACLRDQ..............GVP--..-FVVF......
cwb_MDP0000184832|PACid:22636281 ............-FDYIIVGGGTAGCPLAATLSEK..............-FS--..-VLLV......
cwb_MDP0000598927|PACid:22655979 ............-FDFAVIGSGVAGLRYALEVAKH..............G-S--..-VAVI......
cwb_MDP0000561228|PACid:22637769 ............VYDYIVVGGGTAGCPLAATLSSK..............-YS--..-VLVL......
cwb_MDP0000175650|PACid:22652650 ............---VLIVGAGPVGLVLSILLTKL..............GVK--..-CSVV......
cwb_MDP0000233802|PACid:22672706 ............--KVCIIGSGPAAHTAAIYAARA..............ELK--..-PILF......
cwb_MDP0000321186|PACid:22667177 ............-----------------------..............-----..-----......
cwb_MDP0000161955|PACid:22660959 ............-TDVVIVGAGVAGAALAYTLAKD..............GRR--..-VHVI......
cwb_MDP0000213381|PACid:22663844 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000168437|PACid:22624648 ............--DIIVVGAGVVGSALAYTLGKD..............GRR--..-VHVX......
cwb_MDP0000823251|PACid:22668430 ............--KVCIIGSGPAAHTAAIYAARA..............ELK--..-PILF......
cwb_MDP0000191389|PACid:22631180 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000199319|PACid:22658752 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000857446|PACid:22649571 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000266638|PACid:22658651 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000208936|PACid:22641581 ............-CDVVIVGSGCGGGVAAAVLAQS..............GQK--..-VVVL......
cwb_MDP0000202883|PACid:22663993 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000288439|PACid:22643642 ............-FDYIIVGGGTAGCPLAATLSEK..............-FS--..-VLLV......
cwb_MDP0000295839|PACid:22658517 ............--DVVIVGAGPAGIATSACLNHL..............NIS--..-NVVI......
cwb_MDP0000903805|PACid:22678063 ............-YDYIVVGGGTAGCPLATTLSAN..............-YS--..-VLLL......
cwb_MDP0000202123|PACid:22678734 ............--DLFTIGAGSGGVRASRFAANF..............GAS--..-VAVC......
cwb_MDP0000227773|PACid:22639029 ............---VCVIGAGPSGLVAARELRKE..............GHR--..-VVVL......
cwb_MDP0000317524|PACid:22631851 ............--NVCVIGAGPSGLVAARELRNE..............GHR--..-VVVL......
cwb_MDP0000320748|PACid:22658808 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000634676|PACid:22625957 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000235846|PACid:22627807 ............--KVCIIGSGPAAHTAAIYAARA..............ELK--..-PILF......
cwb_MDP0000251344|PACid:22682514 ............--KVCIIGSGPAAHTAAIYAARA..............ELK--..-PILF......
cwb_MDP0000501957|PACid:22671723 ............-TDVVIVGAGVAGAALAYTLGKE..............GXR--..-VHVI......
cwb_MDP0000209681|PACid:22642739 ............--QVIIVGAGPAGLATSACLNHL..............KIS--..-NVVL......
cwb_MDP0000293482|PACid:22637734 ............--KAVIVGGSIAGVSCAHTLISA..............GWD--..-VLLV......
cwb_MDP0000233995|PACid:22662680 ............--QVVIVGAGPAGLATSACLNHL..............KIP--..-NVVL......
cwb_MDP0000257243|PACid:22657003 ............-YDYIVVGGGTAGCPLATTLSAN..............-YS--..-VLLL......
cwb_MDP0000160099|PACid:22658087 ............--NVCVIGAGPSGLVAARELRKE..............GHR--..-VVVL......
cwb_MDP0000193196|PACid:22649572 ............-TDVVIVGAGVAGAALAYTLGKE..............GXR--..-VHVI......
cwb_MDP0000208234|PACid:22624840 ............---VIIVGAGPSGLATAGCLSRL..............AIP--..-YIIL......
cwb_MDP0000251783|PACid:22654795 ............-YDYIVVGGGTAGCPLAATLSAN..............-YS--..-VLLL......
cwb_MDP0000686885|PACid:22670382 ............-FDVIVVGAGVMGSSTAYQTAKR..............GHK--..-TLLL......
cwb_MDP0000138851|PACid:22674897 ............---VIIVGAGTSGLAMAGCLSRL..............AIP--..-YIIL......
cwb_MDP0000194930|PACid:22667971 ............-WDALVIGGGHNGLTAAAYLARS..............GLS--..-VAVL......
cwb_MDP0000169201|PACid:22625917 ............--QVAIVGAGISGLLACKYTLSK..............GFQ--..-PIVF......
cwb_MDP0000399642|PACid:22674547 ............--QVAIVGAGISGLLACKYTLSK..............GFQ--..-PIVF......
cwb_MDP0000582079|PACid:22634000 ............--QVIIVGAGPAGLATSACLNHL..............KIS--..-NVVL......
cwb_MDP0000129765|PACid:22673448 ............--KAVIVGGSIAGVSCAHTLVLT..............GWN--..-VLVV......
cwb_MDP0000272655|PACid:22672104 ............-YDYIVVGVGTAGCPLVTTLSAN..............-YS--..-VLLL......
cwb_MDP0000686821|PACid:22637777 ............--QVVIVGAGPAGLATSACLNHL..............NIT--..-NAVL......
cwb_MDP0000170414|PACid:22675630 ............--QVAIVGAGISGLLACKYTLSK..............RFQ--..-PIVF......
cwb_MDP0000320804|PACid:22671446 ............--QVAIIGAGISGLLACKYTLSK..............GFH--..-PIVF......
cwb_MDP0000189790|PACid:22676146 ............--DVIIVGAGVAGSALAYTLGKIvisyniicielqd.GXR--..-VHV-......
cwb_MDP0000847111|PACid:22682055 ............--QVIIVGAGPAGLATSACLNHL..............KIS--..-NVVL......
cwb_MDP0000289536|PACid:22677728 ............-YDIIVVGAGIMGSSTAYQTSKR..............SQK--..-TLLL......
cwb_MDP0000123987|PACid:22662898 ............--QVAIVGAGISGLLACKYTISK..............GFQ--..-PILF......
cwb_MDP0000245245|PACid:22671727 ............--QVAIVGAGISGLLACKYTISK..............GFQ--..-PILF......
cwb_MDP0000188553|PACid:22658192 ............---VIVIGGGISGIAAARILHDA..............SFK--..-VFLL......
cwb_MDP0000296599|PACid:22628159 ............--RVVVCGGGVIGVCAAYFLSKR..............GAA--..-VTLV......
cwb_MDP0000746652|PACid:22636428 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000259265|PACid:22650727 ............---VVIVGAGPSGIATSALLNSH..............SVP--..-NLVF......
cwb_MDP0000151331|PACid:22656760 ............-YDYIVVGGGTSGCPLAATLSAK..............-YS--..-VLVL......
cwb_MDP0000309775|PACid:22670556 ............--KIAVVGSGPSGLFAALVLAEF..............GAD--..-VTLL......
cwb_MDP0000232736|PACid:22657363 ............--HVIVIGHGLAGLAAARQMMRF..............GFK--..-VTAL......
cwb_MDP0000320539|PACid:22651795 ............----VILGGGVAAGYAALEFTKR..............GISHG..ELCII......
cwb_MDP0000239909|PACid:22648375 ............--HVAVIGAGAGGLIAARELWRE..............GHK--..-VVVF......
cwb_MDP0000259264|PACid:22650726 ............---VVIVGAGPSGIATSALLNSH..............SVP--..-NLXF......
cwb_MDP0000293613|PACid:22654008 ............--DILVIGGGATGSGVALDAVTR..............GLR--..-VGLV......
cwb_MDP0000253362|PACid:22653297 ............--DILVIGGGATGSGVALDAVTR..............GLR--..-VGLV......
cwb_MDP0000182973|PACid:22649063 ............--DCVVIGAGVVGLAVARELALK..............GRE--..-VLVL......
cwb_MDP0000138005|PACid:22620884 ............---VIVIGGGISGIAAARILHDA..............SFK--..-VFLL......
cwb_MDP0000261301|PACid:22674262 ............-FDLIVVGTGLPATVIAAAASAA..............GKT--..-VLHL......
cwb_MDP0000771633|PACid:22649768 ............--RAAVIGAGPAGSSAAEALATG..............GVE--..-CFMF......
cwb_MDP0000851102|PACid:22674240 ............--RAAVIGAGPAGSSAAEALATG..............GVE--..-CFMF......
cwb_MDP0000159873|PACid:22673571 ............--RVAVIGGGPAGGAAAETLAKG..............GVE--..-TFLI......
cwb_MDP0000140206|PACid:22652348 ............-FKYVIIGGGVAAGYAAREFVKQ..............GLKPG..ELAII......
cwb_MDP0000261201|PACid:22657417 ............--RVAVIGGGPAGGAAAETLAKG..............GVE--..-TFLI......
cwb_MDP0000252244|PACid:22643267 ............--RVAVIGGGPAGGAAAETLAKG..............GVE--..-TFLI......
cwb_MDP0000261821|PACid:22664612 ............-FKYVILGGGVSAGYAAREFAKQ..............GLKPG..ELAVI......
cwb_MDP0000124454|PACid:22663639 ............--HVIVIGHGLAGLAAARQMMRF..............GFK--..-VTAL......
cwb_MDP0000234830|PACid:22664319 ............--DILVIGGGATGCGVALDATTR..............GLR--..-VGLV......
cwb_MDP0000297861|PACid:22646554 ............-----------------------..............GRR--..-VHVI......
cwb_MDP0000152184|PACid:22632666 ............----VILGGGVAAGYAALEFTKR..............GISHG..ELCII......
cwb_MDP0000157871|PACid:22670351 ............-FKYVIIGGGVAAGYAAREFVKQ..............GLEPG..ELAII......
cwb_MDP0000250932|PACid:22662666 ............-YDVIVVGGGHAGCEAAIASAHL..............GAK--..-TLLL......
cwb_MDP0000219521|PACid:22657613 ............-----IIGAGVSGIAAAKQLAHY..............--N--..-PIIL......
cwb_MDP0000239289|PACid:22649630 ............-TDVIVVGAGVAGAALALTLAKE..............GRH--..-VHVI......
cwb_MDP0000258995|PACid:22632347 ............--DCVVVGGGISGLCIAQALATKh.............GDTVP..NVIVT......
cwb_MDP0000167343|PACid:22638473 ............-----IIGAGVSGIAAAKQLAHY..............--N--..-PIIL......
cwb_MDP0000222306|PACid:22645946 ............-----IIGAGVSGIAAAKQLAHY..............--N--..-PIIL......
cwb_MDP0000829384|PACid:22650105 ............-FDLIVVGTGLPATIIAAAASAS..............GKT--..-VLHL......
cwb_MDP0000145663|PACid:22632174 ............--DVIIIGTGPAGLRLAEQLSRY..............GIK--..-VCCV......
cwb_MDP0000288439|PACid:22643642 ............-FDYIIVGGGTAGCPLAATLSEK..............-FS--..-VLLV......
cwb_MDP0000267350|PACid:22676208 ............-----------------------..............-----..-----......
cwb_MDP0000155608|PACid:22665289 neqgnlakldli-----------------------..............-----..-----......
cwb_MDP0000194622|PACid:22683388 ............--DLAVVGGGPAGLAVAQQVSEA..............GLS--..-VCSI......
cwb_MDP0000134271|PACid:22620865 ............---VGIIGAGISGIAAAKQLS--..............GHS--..-PVVF......
cwb_MDP0000312748|PACid:22644976 ............-WDALVIGGGHNGLTAAAYLARS..............GLS--..-VAVL......
cwb_MDP0000197715|PACid:22640206 ............--DVVVVGSGCGGCVVAVVLASS..............GHK--..-VIVL......
cwb_MDP0000220943|PACid:22675739 ............----GIIGAGISGIAAAKQLS--..............GHS--..-PVVF......
cwb_MDP0000320539|PACid:22651795 ............----IVIGGGYIGMECAASLVIS..............RMN--..-VTMV......
cwb_MDP0000140206|PACid:22652348 ............--KVVIIGGGYIGLEVGAAMRIN..............KFD--..-VTMV......
cwb_MDP0000215521|PACid:22667208 ............----GIIGAGISGIVATKQL--L..............GHN--..-PVVF......
cwb_MDP0000203847|PACid:22681509 ............--RIGIVGGGPSGLSSAYALVKX..............GYSN-..-VTVL......
cwb_MDP0000201011|PACid:22661057 ............--RIAIVGGGPSGLSSAYALVKL..............GYSN-..-VTVL......
cwb_MDP0000204596|PACid:22635084 ............-----------------------..............-----..-----......
cwb_MDP0000148978|PACid:22620687 ............--KVVIAGAGLAGLATAKYLADA..............GHQ--..-PILL......
cwb_MDP0000130369|PACid:22663416 ............--KVVVVGSGWAGLGAAHHLCNQ..............GFD--..-VTVI......
cwb_MDP0000314606|PACid:22664349 ............--DILVIGGGATGSGVALDAVTR..............GLR--..-VGLV......
cwb_MDP0000263146|PACid:22654671 ............--KVVVLGTGWAGVSFLKNLRSS..............SYD--..-VEVV......
cwb_MDP0000250583|PACid:22633065 ............--RICILGGGFGGLYTALRLESLewpd..........D-KKP..QVLLV......
cwb_MDP0000208233|PACid:22624841 ............---VIIVGAGPSGLATAGCLSRL..............AIP--..-YIVL......
cwb_MDP0000158720|PACid:22655873 ............----VVVGGGAAGVYGAIRAKTL..............APNLN..-VVII......
cwb_MDP0000152184|PACid:22632666 ............-----VIGGGYIGMECAASLVIN..............RMN--..-VTMV......
cwb_MDP0000182702|PACid:22680484 ..........dr-----------------------..............-----..-----......
cwb_MDP0000261638|PACid:22646820 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000130370|PACid:22654204 ............--KVVVVGSGWAGLGAAHHLCNQ..............GFD--..-VTVI......
cwb_MDP0000272119|PACid:22671033 ............-FDLIIIGTGLLGSVIAAAASAA..............GKT--..-VLQL......
cwb_MDP0000305861|PACid:22662391 ............--KIVVLGTGWAGTSFLRNLKNP..............NYE--..-VQII......
cwb_MDP0000255696|PACid:22677008 ............--KIXVLGTGWAGTSFLRNLKNP..............NYE--..-VQVI......
cwb_MDP0000214280|PACid:22681133 ............-YDYIVVGGGTSGCPLAATLSAK..............-YS--..-VLVL......
cwb_MDP0000210966|PACid:22644665 ............-YDYIIVGGGTAGCPLAASLSQN..............-YS--..-VLLL......
cwb_MDP0000610999|PACid:22659782 ............-FDLIVIGTGLPGSVIAAAASTA..............GKA--..-VLHL......
cwb_MDP0000242546|PACid:22662348 ............-FDLIVIGTGLPGSVIAAAASTA..............GKA--..-VLHL......
cwb_MDP0000320742|PACid:22645070 ............-YDVVIVGAGPAGLSAAIRMKQLcrekdv........DLS--..-VCVV......
cwb_MDP0000654164|PACid:22658363 ............----------------ATLAAQL..............GLK--..-TTCI......
cwb_MDP0000256300|PACid:22644503 ............-----------------------..............-----..-----......
cwb_MDP0000235080|PACid:22654616 ............-TKVAVVGSGISGAVCASTLARN..............GVS--..-VTLF......
cwb_MDP0000284363|PACid:22634918 ............--RVVVLGTGWAGTSFLKYLDAS..............AYD--..-VQVV......
cwb_MDP0000125043|PACid:22648273 ............-----------------------..............-----..-----......
cwb_MDP0000192359|PACid:22632529 ............-----------------------..............-----..-----......
cwb_MDP0000440005|PACid:22623062 ............--KVVVVGGGVAGSLLAKSLQFV..............-AD--..-FTLI......
cwb_MDP0000609131|PACid:22633588 ............---VCIIGSGIGGSSVAHFLRRYspphl.........NFT--..-IRIF......
cwb_MDP0000362000|PACid:22628256 ............--RVVVLGSGWAGCRLMKGLDTE..............QYD--..-IVCV......
cwb_MDP0000150210|PACid:22663655 ............-WDALVIGGGHNGLTAAAYLARS..............GLS--..-VAVL......
cwb_MDP0000158790|PACid:22624362 ............VLDLVVIGCGPAGLALAAESAKL..............GLK--..-VGLI......
cwb_MDP0000427950|PACid:22623610 ............-----------------------..............-----..-----......
cwb_MDP0000569169|PACid:22666591 ............--DILVIGGGATGSGVALDAVTR..............GLR--..-VGLV......
cwb_MDP0000525742|PACid:22647174 ............--NVVIIGSGPAGFTAAIYAARA..............NLK--..-PLVF......
cwb_MDP0000559829|PACid:22672870 ............-TDVVIVGAXVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000321788|PACid:22641842 ............-----------------------..............-----..-----......
cwb_MDP0000919183|PACid:22661837 ............---CVVIGGGPTGVEFSGELSDFimkdvqeryt....HVKDYi.XVTLI......
cwb_MDP0000146158|PACid:22623090 ............---CVVIGGGPTGVEFSGELSDFimkdvqerfshvkdYI---..KVTLI......
cwb_MDP0000832077|PACid:22645850 ............----GIIGAGISGIAAAKQLS--..............GHS--..-PVVF......
cwb_MDP0000621365|PACid:22669861 ............VYDYIVVGGGTAGCPLAATLSSN..............-YS--..-VLVL......
cwb_MDP0000875229|PACid:22620206 ............---IAIVGSGYIGLEFSDVYTAL..............GSE--..-VTFI......
cwb_MDP0000251344|PACid:22682514 ............--RICIIGGGLTAHTAAIYAARA..............DLK--..-PILF......
cwb_MDP0000168919|PACid:22641114 ............-----------------------..............-----..-----......
cwb_MDP0000267855|PACid:22645516 ............---YAVLGAGFAGLSVAWHLLKQ..............SPKDSniRVDIY......
cwb_MDP0000195207|PACid:22668389 ............-----IIGGGMAGLACALFLEKR..............GVR--..-STVF......
cwb_MDP0000400145|PACid:22662498 ............-FDLIVVGTGLPATIIAAAASAS..............GKT--..-VLHL......
cwb_MDP0000919183|PACid:22661837 ............--RVVVLGTGWAACRFLKGLDTK..............VYD--..-VVCI......
cwb_MDP0000307336|PACid:22681275 ............--RVAVVGAGVSGLAAAYKLKSH..............GFD--..-VAVF......
cwb_MDP0000263146|PACid:22654671 ............----VCVGGGPAGVEFAAELHDFvkddlaklypsvtgYVK--..-ITVI......
cwb_MDP0000309730|PACid:22638555 ............---YAVLGAGFAGLSVAWHLLKQ..............SPKDSniRVDIY......
cwb_MDP0000163903|PACid:22648802 ............---ILIVGGGPTGVELAGEIAIDfp............EKK--..-VTLV......
cwb_MDP0000611628|PACid:22643604 ............---CVVIGGGPTGVEFSGELSDFimkdvqerfshvkdYI---..KVTLI......
cwb_MDP0000119779|PACid:22649695 ............---ILIVGGGPTGVELAGEIAIDfp............EKK--..-VTLV......
cwb_MDP0000120904|PACid:22629470 ............-----------------------..............-----..-----......
cwb_MDP0000150544|PACid:22634453 ............-WDALVIGGGHNGLTAAAYLARS..............GLS--..-VAVL......
cwb_MDP0000902209|PACid:22678199 ............---YAVLGAGFAGLSVAWHLLKQ..............SPKDSniRVDIY......
cwb_MDP0000269370|PACid:22680893 ............-----------------------..............-----..-----......
cwb_MDP0000146158|PACid:22623090 ............--RVVVLGTGWAACRFLKGLDTK..............VYD--..-VVCI......
cwb_MDP0000124051|PACid:22654473 ............VLDYITVGGGTAGCPLAATLSEK..............F----..-LVLL......
cwb_MDP0000255696|PACid:22677008 ............--HFAVVGGGPTGVEFAAELHDYv.............N-EDL..-VKLY......
cwb_MDP0000305861|PACid:22662391 ............--HFAVVGGGPTGVEFAAELHDFvnedlvklyp....GVKDLv.RITIL......
cwb_MDP0000611628|PACid:22643604 ............--RVVVLGTGWAACRFLKGLDTK..............VYD--..-VVCI......
cwb_MDP0000309622|PACid:22670269 ............--DVIIVGAGVAGSALAYTLGKD..............GRR--..-VHVI......
cwb_MDP0000239909|PACid:22648375 ............-----------------------..............-----..-----......
cwb_MDP0000126888|PACid:22675379 ............-YDVIVVGGGHAGCEAAIASAHL..............GAK--..-TLLL......
cwb_MDP0000869086|PACid:22644121 ............-----------------------..............-----..-----......
cwb_MDP0000317524|PACid:22631851 ............--NVCVIGAGPSGLVAARELRNE..............GHR--..-VVVL......
cwb_MDP0000160099|PACid:22658087 ............-----------------------..............-----..-----......
cwb_MDP0000251205|PACid:22649529 ............-----------------------..............-----..-----......
cwb_MDP0000314335|PACid:22679828 ............-----------------------..............-----..-----......
cwb_MDP0000638870|PACid:22646063 ............-TDVVIVGAGVAGAALAYTLGKE..............GRR--..-VHVI......
cwb_MDP0000790657|PACid:22654829 ............-----------------------..............-----..-----......
cwb_MDP0000748068|PACid:22649054 ............-----------------------..............-----..-----......
cwb_MDP0000727481|PACid:22682921 ............-----------------------..............-----..-----......
cwb_MDP0000301246|PACid:22669391 ............-----------------------..............-----..-----......
cwb_MDP0000190684|PACid:22677586 ............-----------------------..............-----..-----......
cwb_MDP0000456223|PACid:22643829 ............-YDVIVLGTGLKECILSGLLSVD..............GLK--..-VLHM......
cwb_MDP0000745172|PACid:22667211 ............---IVLVGAGSAGLSCAYELSKNp.............DVQ--..-VAIT......
cwb_MDP0000407932|PACid:22626437 ............-----------------------..............-----..-----......
cwb_MDP0000440896|PACid:22680420 ............-----------------------..............-----..-----......
cwb_MDP0000694227|PACid:22673619 ............-----------------------..............-----..-----......
cwb_MDP0000123987|PACid:22662898 ............-----------------------..............-----..-----......
cwb_MDP0000138005|PACid:22620884 ............---VIVIGGGISGIAAARILHDA..............SFK--..-VFLL......
cwb_MDP0000258205|PACid:22638470 ............--DVIIIGTGPAGLRLAEQVSRY..............DIK--..-VCSV......
cwb_MDP0000245245|PACid:22671727 ............-----------------------..............-----..-----......
cwb_MDP0000306704|PACid:22680179 ............-----------------------..............-----..-----......
cwb_MDP0000478654|PACid:22674637 ............---VCIIGSGIGGSSVAHFLRRYspphl.........NFT--..-IRIF......
cwb_MDP0000728219|PACid:22657389 ............-----------------------..............-----..-----......
cwb_MDP0000170414|PACid:22675630 ............-----------------------..............-----..-----......
cwb_MDP0000284363|PACid:22634918 ............---FVIVGGGPTGVEFAAELHDY..............FQEDL..-VKLY......
cwb_MDP0000219560|PACid:22625984 ............-----------------------..............-----..-----......
cwb_MDP0000235930|PACid:22635275 ............-KRVVVIGGGVGGSVVAHSLQFC..............-AD--..-VVLV......
cwb_MDP0000755938|PACid:22650525 ............-----------------------..............-----..-----......
cwb_MDP0000138851|PACid:22674897 ............--KVLVVGAGNSGMEISLDLANH..............GAK--..-TSII......
cwb_MDP0000261638|PACid:22646820 ............-----------------------..............-----..-----......
cwb_MDP0000317524|PACid:22631851 ............-----------------------..............-----..-----......
cwb_MDP0000294615|PACid:22655955 ............-----------------------..............-----..-----......
cwb_MDP0000208234|PACid:22624840 ............--KVLVVGAGNSGMEISLDLANH..............GAK--..-TSII......
cwb_MDP0000216129|PACid:22668259 ............-----------------------..............-----..-----......
cwb_MDP0000219521|PACid:22657613 ............-----------------------..............-----..-----......
cwb_MDP0000248995|PACid:22642703 ............-----------------------..............-----..-----......
cwb_MDP0000256328|PACid:22629063 ............--RVVVLGTGWAACRFLKGLDTK..............VYD--..-VVCI......
cwb_MDP0000181673|PACid:22646891 ............-----------------------..............-----..-----......
cwb_MDP0000169201|PACid:22625917 ............-----------------------..............-----..-----......
cwb_MDP0000263530|PACid:22651991 ............-TRVAVVGSGIPGAVCASTLGRN..............GVS--..-VTLL......
cwb_MDP0000295839|PACid:22658517 ............--NVLVVGSGNSGMEIAYDLTNW..............GANTS..-IVVR......
cwb_MDP0000297466|PACid:22645872 ............--DLVVIGWGPAGLALAAESAKL..............GVK--..-VGLI......
cwb_MDP0000281982|PACid:22629373 ............-----------------------..............-----..-----......
cwb_MDP0000053966|PACid:22620929 ............-----------------------..............-----..-----......
cwb_MDP0000795740|PACid:22666880 ............-----------------------..............-----..-----......
cwb_MDP0000212327|PACid:22630830 ............--DIIVVGAGQ-----------D..............GRR--..-VHVV......
cwb_MDP0000437365|PACid:22632357 ............-YDVVVVGSGYGGSVVACRLSMAg.............GRS--..-VCLL......
cwb_MDP0000135231|PACid:22629791 ............-FDVLVIGAGIIGLTIARQFLIGs.............DLS--..-VAVI......
cwb_MDP0000167343|PACid:22638473 ............-----------------------..............-----..-----......
cwb_MDP0000222306|PACid:22645946 ............-----------------------..............-----..-----......
cwb_MDP0000183517|PACid:22634175 ............---VLIVGAAPVGLVLPLLLTKL..............GVK--..-CSVV......
cwb_MDP0000686821|PACid:22637777 ............--NVLVVGSGNSGMEIAYDLSNS..............GANTS..-IVVR......
cwb_MDP0000430157|PACid:22655785 ............-----------------------..............-----..-----......
cwb_MDP0000373054|PACid:22683333 ............-----------------------..............-----..-----......
cwb_MDP0000295306|PACid:22673308 ............-----------------------..............-----..-----......
cwb_MDP0000233995|PACid:22662680 ............--NVLVVGSGNSGMEIAYDLSNS..............GANTS..-IVVR......
cwb_MDP0000209681|PACid:22642739 ............--NVLVVGSGNSGMEIAYDLSNS..............GANTS..-IVVR......
cwb_MDP0000876898|PACid:22679933 ............-----------------------..............-----..-----......
cwb_MDP0000738522|PACid:22680891 ............-----------------------..............-----..-----......
cwb_MDP0000399642|PACid:22674547 ............-----------------------..............-----..-----......
cwb_MDP0000215521|PACid:22667208 ............-----------------------..............-----..-----......
cwb_MDP0000170521|PACid:22675770 ............-----------------------..............-----..-----......
cwb_MDP0000262982|PACid:22620906 ............--KVLVVGCGNSGMEVSLDLCNH..............NAFPS..-MVVR......
cwb_MDP0000321186|PACid:22667177 ............--RVCVVGSGPAGFYTAEKMXKA..............HQEAE..-VDII......
cwb_MDP0000266051|PACid:22641431 ............-----------------------..............-----..-----......
cwb_MDP0000837610|PACid:22643529 ............-----------------------..............-----..-----......
cwb_MDP0000582079|PACid:22634000 ............--NVLVVGSGNSGMEIAYDLSNS..............GANTS..-IVIR......
cwb_MDP0000538071|PACid:22663035 ............-----------------------..............-----..----V......
cwb_MDP0000241703|PACid:22642424 ............-----------------------..............-----..-----......
cwb_MDP0000671114|PACid:22638724 ............---IIVVGXGSAXLSCTYELSKKp.............DVQ--..-VAIT......
cwb_MDP0000315388|PACid:22681954 ............-----------------------..............-----..-----......
cwb_MDP0000134271|PACid:22620865 ............---VGIIGAGISGIAAAKQLS--..............GHS--..-PVVF......
cwb_MDP0000297581|PACid:22646099 ............-----------------------..............-----..-----......
cwb_MDP0000911003|PACid:22677366 ............--DVLICG-GTLGIFIATALCAK..............GLR--..-VGIV......
cwb_MDP0000576650|PACid:22634720 ............-----VVGGGISGLCIAQVLATK..............HNDTVp.NVIVT......
cwb_MDP0000149205|PACid:22670334 ............--DCMVVGGGISGLCFAQVLATK..............HDDTVp.NVIVT......
cwb_MDP0000315409|PACid:22681973 ............-----------------------..............-----..-----......
cwb_MDP0000320804|PACid:22671446 ............-----------------------..............-----..-----......
cwb_MDP0000474647|PACid:22667377 ............--DCVVVGGGISGLCIAQVLATK..............HSDAI..PIVIVt.....
cwb_MDP0000566648|PACid:22666666 ............--DCVVVGGGISGLCIAQVLATK..............HGDAV..PIIIVt.....
cwb_MDP0000171379|PACid:22629613 ............-YDVIVLGTGLKE----------..............-----..-----......
cwb_MDP0000814529|PACid:22673539 ............--DCVVVGGGISGLCIAQVLATK..............HSDAI..PIVIVt.....
cwb_MDP0000218295|PACid:22671514 ............--DCVVVGGGISGLCIAQVLATK..............HGDAV..PIIIVt.....
cwb_MDP0000220943|PACid:22675739 ............-----IIGAGISGIAAAKQLS--..............GHS--..-PVVF......
cwb_MDP0000795437|PACid:22664825 ............-----------------------..............-----..-----......
cwb_MDP0000919706|PACid:22656631 ............-YDYIVVGGGTAGCPLAATL---..............-----..-----......
cwb_MDP0000295675|PACid:22626457 ............--DCVVVGGGISGLCIAQVLATK..............HSDAI..PIVIVt.....
cwb_MDP0000147542|PACid:22652542 ............--DCVVVGGGISGLCIAQVLATK..............HGDVV..PIVIVt.....
cwb_MDP0000272126|PACid:22655119 ............---------------------SH..............GAS--..-FLVL......
cwb_MDP0000196881|PACid:22654963 ............--DCVVVGGGINGLCIAQVLATK..............HGDVVp.NVIVT......
cwb_MDP0000268346|PACid:22678394 ............--DCVVVGGGISGLCVAQVLATK..............HGDAV..XIVIV......
cwb_MDP0000147542|PACid:22652542 ............--DCVVVGGGISGLCIAQVLATK..............HGDVV..PIVIVt.....
cwb_MDP0000948298|PACid:22676144 ............-----------------------..............-----..-----......
cwb_MDP0000220943|PACid:22675739 ............-----------------------..............-----..-----......
cwb_MDP0000182589|PACid:22648509 ............--DCVVVGGGISGLCIAQVLATK..............HGDVV..PIVIV......
cwb_MDP0000557870|PACid:22631128 ............-----------------------..............-----..-----......
cwb_MDP0000308870|PACid:22652882 ............---VVVVDAGFARLSYTYEXNKNp.............DVQ--..-VAIT......
cwb_MDP0000322449|PACid:22657441 ............-----------------------..............-----..-----......
cwb_MDP0000286494|PACid:22671310 ............--DCVVVGGGISGLCVAQVLATK..............HGDAV..LIVIV......
cwb_MDP0000150868|PACid:22621264 ............-----------------------..............-----..-----......
cwb_MDP0000155608|PACid:22665289 ............-----------------------..............-----..-----......
cwb_MDP0000168505|PACid:22672316 ............----VCVGGGPVGVEFAAELHD-..............-----..-----......
cwb_MDP0000196888|PACid:22670849 ............-TDVVIVGAGVAGAALAYTLG--..............-----..-----......
cwb_MDP0000154812|PACid:22632894 ............--DCVVVGGGISGLYVAQVLATK..............HGDAV..LIVIV......
cwb_MDP0000186080|PACid:22622639 ............--DCVVVGGGISGLYVAQVLATK..............HGDAV..LIVIV......
cwb_MDP0000220012|PACid:22626541 ............-TDVVIVGAGVAGAALAYTLGK-..............-----..-----......
cwb_MDP0000169409|PACid:22673915 ............-----------------------..............-----..--LVL......
cwb_MDP0000373095|PACid:22661923 ............-----------------------..............-----..-----......
cwb_MDP0000235846|PACid:22627807 ............--RICVIGSGLPAHTAAVYAARA..............ELK--..-PILAlrglhv
cwb_MDP0000207126|PACid:22623152 ............-----------------------..............-----..-----......
cwb_MDP0000268357|PACid:22630891 ............----VCVGGGPVGVEFAAELHD-..............-----..-----......
cwb_MDP0000149067|PACid:22669209 ............-YDLLIIGAGVGGHGAALHVVKK..............-----..-----......


                                                  40                                                
                                                   |                                                
d1xdia1                          DC..DGI..........GGAAV.............................................
cwb_MDP0000813172|PACid:22649115 TKl.FPT..........RSHTVaaqgginaalgnmteddwrwhmydtvkgsdwlgdqdaiqymcrea
cwb_MDP0000251581|PACid:22621152 TKl.FPT..........RSHTVaaqgginaalgnmteddwrwhmydtvkgsdwlgdqdaiqymcrea
cwb_MDP0000188391|PACid:22626210 TKl.FPT..........RSHTVaaqgginaalgnmteddwrwhmydtvkgsdwlgdqdaiqymcrea
cwb_MDP0000254144|PACid:22644986 EGr.NRP..........GGRVYtqkmgkdgkfsavdlggsvitgihanplgvlarqlsiplhkvrdk
cwb_MDP0000321972|PACid:22643109 ESr.DRL..........GGRIHtdysfgcpvdmgaswlhgvcnenplaplirrlgltlyrtsgddsv
cwb_MDP0000299806|PACid:22682346 EGr.SRP..........GGRVKtrkmvgeregveaaadlggsvltgingnplgvlarqlglplhkvr
cwb_MDP0000283451|PACid:22680462 EGr.SRP..........GGRVKtrkmvaeregveaaadlggsvltgingnplgvlarqlglplhkvr
cwb_MDP0000296714|PACid:22644308 EAr.SRI..........GGRVYtdrsslsvpvdlgasiitgveadwaterrpdpsslvcaqlglelt
cwb_MDP0000162193|PACid:22629958 EAr.SRI..........GGRVYtdrsslsvpvdlgasiitgveadwaterrpdpsslvcaqlglelt
cwb_MDP0000769741|PACid:22637873 ESr.DRL..........GGRVCtdysfgfpidlgaswlhgvckenplapligrlglplyrtsgdnsv
cwb_MDP0000295277|PACid:22625688 EKr.GAL..........GGTCL.............................................
cwb_MDP0000897124|PACid:22647159 EKr.GAL..........GGTCL.............................................
cwb_MDP0000854208|PACid:22682207 TKa.EPH..........ESNTNyaqggvsavlsqsdsveshmqdtivagaylcdeetvrvvctegpe
cwb_MDP0000241767|PACid:22665328 EAr.SRI..........GGRVYtdrsslsvpvdlgasiitgveadwaterrpdpsslvcaqlglelt
cwb_MDP0000318858|PACid:22682838 ERa.DRI..........GGL--.............................................
cwb_MDP0000248995|PACid:22642703 DRn.DYY..........GGECAslnlvqlwkrfrgddkppahlgssrdynvdmvpkfmmangtlvrv
cwb_MDP0000442206|PACid:22660061 ERa.DRI..........GGL--.............................................
cwb_MDP0000181673|PACid:22646891 DRn.DYY..........GGECAslnlvqlwkrfrgddkppahlgssrdynvdmvpkfmmangtlvrv
cwb_MDP0000315409|PACid:22681973 DRn.DYY..........GGESTslnlnqlwkxfrgedkppetlgssreynvdmipkfmmangalvrv
cwb_MDP0000053966|PACid:22620929 DRn.DYY..........GGESTslnlnqlwkrfrgedkppetlgsskdynvdmipkfmmangglvrv
cwb_MDP0000294615|PACid:22655955 DRn.DYY..........GGESTslnlnqlwkrfrgedkppetlgsskdynvdmipkfmmangglvrv
cwb_MDP0000306147|PACid:22679041 EAr.SRI..........GGRVYtdrlslsvpvdlgasiitgveadwaterrpdpsslvcaqlglelt
cwb_MDP0000180064|PACid:22628138 EKy.VIP..........GGSSGyyerdgytfdvgssvmfgfsdkvvsyyheehcvlvetcthgnvta
cwb_MDP0000261625|PACid:22630921 EAs.DRI..........GGRIRkqdfggvsvelgagwivgvggxelnpvldlalksnlrtifsdysn
cwb_MDP0000300208|PACid:22651331 EL..PFHpvsseviggvGGTCV.............................................
cwb_MDP0000247171|PACid:22623108 EKs.DGL..........RATGA.............................................
cwb_MDP0000308095|PACid:22667065 ESr.PFI..........GGKVGsfvdkkgnhiemglhvffgcysnlfrlmkkvgadenllvkdhtht
cwb_MDP0000319421|PACid:22624123 ERs.NRL..........PATGVaiivhlngwraldql..............................
cwb_MDP0000232295|PACid:22657598 ERg.GSP..........YGDPLvldtkyygfsllrtdqytsvaqxfvsndgvrnlrgrvlgggsain
cwb_MDP0000188994|PACid:22643055 ESs.DSX..........RXTGFxlttwtnawkaldalgtgdtlrqqhgalrgnvtsstisglpvfem
cwb_MDP0000159189|PACid:22672554 ESs.DSX..........RXTGFxlttwtnawkaldalgtgdtlrqqhgalrgnvtsstisglpvfem
cwb_MDP0000656178|PACid:22657871 EG..DVV..........GGTCV.............................................
cwb_MDP0000910523|PACid:22620639 EKs.DSL..........RVTGAaltlfpnawcaldalgvshhltslyatikkgyitnidtgeiqevs
cwb_MDP0000119941|PACid:22643547 EKr.GAL..........GGTCL.............................................
cwb_MDP0000231799|PACid:22673471 EG..DVV..........GGTCV.............................................
cwb_MDP0000255025|PACid:22624807 ESr.PFI..........GGKVGsfvdkkgnhiemglhvffgcysnlfrlmkkvdnfcllelllhlai
cwb_MDP0000231632|PACid:22622264 EAe.GRA..........GGKLRsvsrdglvwdegantmtesetevqtlldnlglrekqqfpisqtkr
cwb_MDP0000173300|PACid:22648712 EKg.NYF..........TPSDYssleapshdhlyesggilvtvdgkivlqagstvgggsainwsaci
cwb_MDP0000158474|PACid:22655457 ERg.GVP..........FSNANvsflqnfhialadtsptsasqpfvstdgvintrarvlgggscina
cwb_MDP0000276878|PACid:22649644 EKd.DYL..........GGHARtvtfdgvdldlgfmvfnrvnvkelixydarltipvflktglqvty
cwb_MDP0000154720|PACid:22639222 DSn.PAV..........SNGLSikkedppdprvstvtpvtislfkdigawkyveqnrhayfdqmqvw
cwb_MDP0000549646|PACid:22624756 EQs.VSP..........GGGAW.............................................
cwb_MDP0000158853|PACid:22672016 EGg.ERI..........GGRINtsefggdriemgatwihgiegspvhkiaqeinaleseqpwecmdg
cwb_MDP0000702799|PACid:22650781 EGg.ERI..........GGRINtsefggdriemgatwihgiegspvhkiaqeinaleseqpwecmdg
cwb_MDP0000233110|PACid:22669060 EKg.NYF..........VPKDYsslegpsmselyesggimasvdamvmilagstvgggsavnwsasi
cwb_MDP0000260827|PACid:22621315 ERd.LTE..........PDRIVgellqpggylklielgledcveqidaqrvfgyalfkdgkntrlsy
cwb_MDP0000941459|PACid:22654340 EGg.ERI..........GGRINtsefggdriemgatwihgiggspvhkiaqeinalexahpwecmdg
cwb_MDP0000185338|PACid:22637072 ERg.GVA..........YGNRNlmtkegflatlmdvnsldsptqaftseegvanvrgrilggssain
cwb_MDP0000451172|PACid:22678939 ERg.GSP..........YGNPNiinidkfaptlldtsptspaqqftsedgvynirarvlgggsavna
cwb_MDP0000136847|PACid:22626492 ERg.DIP..........TAYPNvlsnagilanfmqeddgktpaqrftsedgvafvrgrvlggssmin
cwb_MDP0000177641|PACid:22624304 ERg.GSP..........YEXPLimenknyglslvqtdeytsvaqsfvskdgvsnlrgrvlgggsain
cwb_MDP0000413935|PACid:22663920 ERd.LTE..........PDRIVgellqpggylklielgledcveqidaqrvfgyalfkdgkntklsy
cwb_MDP0000206098|PACid:22637273 EQs.VSP..........GGGAW.............................................
cwb_MDP0000845788|PACid:22673064 EGyqSGP..........GGQLM.............................................
cwb_MDP0000465595|PACid:22654474 ERg.GSP..........YGNPLvldtkyygfsllqtdqytsvaqsfvsndgvsnlrgrvlggasain
cwb_MDP0000137211|PACid:22645789 ERg.DIP..........TTYPSvstvegilenfmleddgttplqrfvsedgvanvrgrilggtsmvs
cwb_MDP0000130099|PACid:22624356 ERg.SFP..........ASYPNvltqdgfiynlqqeddgetpvqrvmsedgiptvrgrilggtsiin
cwb_MDP0000425135|PACid:22674685 ERg.GVA..........YGNRNlmtregflatlmdvnsfdsptqaftseegvanvrgrilggssain
cwb_MDP0000200780|PACid:22660656 EQa.ESLrt........GGTSL.............................................
cwb_MDP0000142434|PACid:22683351 ERs.ESL..........RATGGgitirangwraldelgvasklrqtalplqgardiyxhngkqqki.
cwb_MDP0000248951|PACid:22626490 ERg.DIP..........TAYPNvlsnagilanfmqeddgktpaqrftsedgvafvrgrvlggssmin
cwb_MDP0000869086|PACid:22644121 EQn.HDV..........GGQWLydpnvegedplgrvptlkvhsslytslrlispreimgftdfpfav
cwb_MDP0000318256|PACid:22681338 ERg.NIP..........SAYPNvlrqnetlanfmqeddgktpaqrftsedgvanlrgrilggssmin
cwb_MDP0000231634|PACid:22622267 EAe.GRA..........GGNLRsvsrddliwdeganlmvfsqtesetevqtlldnlglrekqqfpis
cwb_MDP0000626995|PACid:22630905 EQs.VSP..........GGGAW.............................................
cwb_MDP0000123832|PACid:22633934 EKs.DGL..........RATGA.............................................
cwb_MDP0000236092|PACid:22632501 EQs.VSP..........GGGAW.............................................
cwb_MDP0000199159|PACid:22674497 EQn.HDV..........GGQWLydpnvegedplgrsptlkvhsslytslrlispreimgftdfpfav
cwb_MDP0000162755|PACid:22662459 ESs.DSL..........RTTGFalttwtnawkaldalgigdslrqqhvtldgnsferrnvtssritg
cwb_MDP0000173666|PACid:22649255 EAe.GRA..........GGKLRsvsrdglvwdegantmtesetevqtlldnlglrekqqfpisqtkr
cwb_MDP0000262982|PACid:22620906 ERa.ECI..........ASLWQkrtydrlklhlpkafcqlpkf........................
cwb_MDP0000184832|PACid:22636281 ERg.GSP..........YENPLimenknfglslvqtdeytsvaqsfvskdgvsnlrgrvlgggsain
cwb_MDP0000598927|PACid:22655979 TKa.EPH..........ESNTNyaqggvsavlslsdsveshvqdtivagaylcdeetvrvvctegpe
cwb_MDP0000561228|PACid:22637769 ERg.SFP..........TSYPNvltqegfiynlqqeddgetpvqrvmsedgiptvrgrilggtsmis
cwb_MDP0000175650|PACid:22652650 EKs.KTF..........SNHPQahfinnrsmevfrkldglaeeiqrsqppvdlwrkfiyctslygsi
cwb_MDP0000233802|PACid:22672706 EGm.MANdiap......GGQLTtttdve.......................................
cwb_MDP0000321186|PACid:22667177 --..---..........-----.............................................
cwb_MDP0000161955|PACid:22660959 ERd.LSE..........PDRIVgellqpggylklielgledcanesidaqkvfgyalykdgndtkls
cwb_MDP0000213381|PACid:22663844 ERdlNEP..........-DRIVgellqpggylklielgledxanesidaqkvfgyalykngndtkls
cwb_MDP0000168437|PACid:22624648 ERd.LSE..........PDRIVgellqpggylrlvelgledcvneidaqrvfgyalykdgkstklpy
cwb_MDP0000823251|PACid:22668430 EGm.MANdiap......GGQLTtttdve.......................................
cwb_MDP0000191389|PACid:22631180 ERd.LSE..........PDRIVgellqpggylklielgladcanesidaqkvfgyalykngndtkls
cwb_MDP0000199319|PACid:22658752 ERdlNEP..........-DRIVgellqpggylklielgledxanesidaqkvfgyalykngndtkls
cwb_MDP0000857446|PACid:22649571 ERd.LSE..........PDRIVgellqpggylklielgledcanesidaqkvfgyalykngndtkls
cwb_MDP0000266638|PACid:22658651 ERdlNEP..........-DRIVgellqpggylklielgledxanesidaqkvfgyalykngndtkls
cwb_MDP0000208936|PACid:22641581 EKg.NYF..........VPKDYsslegpsmnelyesggilssvdgmvmilagstvgggsavnwsasi
cwb_MDP0000202883|PACid:22663993 ERd.LSE..........PDRIVgellqpggylklielgledcanesvdaqkvfgyalykngndtkls
cwb_MDP0000288439|PACid:22643642 ERdtRSY..........LDLSLfvsrvlshlrekrrftgklgamasssgtgagrvlgggsainggff
cwb_MDP0000295839|PACid:22658517 ERe.DSY..........ASLWRkrsydrlklhlakqfcelpym........................
cwb_MDP0000903805|PACid:22678063 ERg.NIP..........SAYPNvllangtfanfmqeddgktpaqrftsedgvanlrgrvlgrgsmin
cwb_MDP0000202123|PACid:22678734 ELpfSTIssdtaggv..GGTCV.............................................
cwb_MDP0000227773|PACid:22639029 EQn.HEV..........GGQWLydpnvegedplgrsptlkvhsslysslriispresmgftdfpfa.
cwb_MDP0000317524|PACid:22631851 EQn.HDV..........GGQWLydpnvegedplgraptlkvhsslytslrlmlpreiagftdfpfa.
cwb_MDP0000320748|PACid:22658808 ERd.LSE..........PDRIVgellqpggylklielgledcandsidaxkvfgyalykngndtkls
cwb_MDP0000634676|PACid:22625957 ERdlNEP..........-DRIVgellqpggylklielgledcanesidaqkvfgyalykngndtkls
cwb_MDP0000235846|PACid:22627807 EGm.MANdiap......GGQLTtttdve.......................................
cwb_MDP0000251344|PACid:22682514 EGm.MANdiap......GGQLTtttdve.......................................
cwb_MDP0000501957|PACid:22671723 ERdlNEP..........-DRIVgellqpggylklielgledcanesidaqkvfgyalykngndtkls
cwb_MDP0000209681|PACid:22642739 ERe.DCY..........ASLWKkxsydrlklhlakefcelpym........................
cwb_MDP0000293482|PACid:22637734 EKsyAPP..........TGSPTgaglgldplslrliqswiqdpdllhkatlpltidqndaidgenkv
cwb_MDP0000233995|PACid:22662680 ERe.DCY..........ASLWKkksydrlklhlakefcelpym........................
cwb_MDP0000257243|PACid:22657003 ERg.NIP..........SAYPNvlhdgktpaqrftsedgvanlrgrilggssminigxysradgefy
cwb_MDP0000160099|PACid:22658087 EQn.HEV..........GGQWLydpnvegedplgrsptlkvhsslysslriispresmgftdfpfa.
cwb_MDP0000193196|PACid:22649572 ERdlNEP..........-DRIVgellqpggylklielgledcanesidaqkvfgyalykngndtkls
cwb_MDP0000208234|PACid:22624840 ERe.DCF..........ASLWKkysydrlhlhlqkqfcelphm........................
cwb_MDP0000251783|PACid:22654795 ERg.DIP..........TAYPNvlsnagilanfmqeddgktpaqrftsedgvafvrgrvlggsnall
cwb_MDP0000686885|PACid:22670382 EQf.DFL..........HHRGSshgesrtiratypedyytplvlesyklwqqaeseigynvyfkanq
cwb_MDP0000138851|PACid:22674897 ERe.DCF..........ASLWTkysydrlhlhlrkqfcelphm........................
cwb_MDP0000194930|PACid:22667971 ERr.HVI..........GGAAVteelvpgfkfsrcsylqsllrpsiikelelprhglkllkgshssf
cwb_MDP0000169201|PACid:22625917 ESt.SSI..........GGVWTktiestklqtpkplyqfsdfp........................
cwb_MDP0000399642|PACid:22674547 ESt.SSI..........GGVWTktiestklqtpkplyqfsdfp........................
cwb_MDP0000582079|PACid:22634000 ERe.DCY..........ASLWKkrsydrlklhlakefcelpym........................
cwb_MDP0000129765|PACid:22673448 EKscAPPt.........GSQTGaglgldplslrliqswiqdpellhqttlpftidqnaxdayaknda
cwb_MDP0000272655|PACid:22672104 ERg.NIP..........SAYPNvlcqnetlanfmqeddgktpvqrftsedgvanvrgrilgwssmin
cwb_MDP0000686821|PACid:22637777 ERe.DCY..........ASLWKkksydrlklhlakqfcelpy.........................
cwb_MDP0000170414|PACid:22675630 ESt.SSI..........GGVWIktvestklqtpkplyqfsdfp........................
cwb_MDP0000320804|PACid:22671446 ENs.SSI..........GGVWTktvettkiqtpkefyqfsdfp........................
cwb_MDP0000189790|PACid:22676146 --..---..........----Ierdltkpdrivgellqpgaylrlielgledcvnkxdaqxifgyvl
cwb_MDP0000847111|PACid:22682055 ERe.DCY..........ASLWKkrsydrlklhlakefcelpym........................
cwb_MDP0000289536|PACid:22677728 EQf.DFL..........HHRGSshgesrtiratypedyyxplvmesyklwqqaeseigynvyfkahq
cwb_MDP0000123987|PACid:22662898 ESt.SSI..........GGVWTktvestklqtpkpvyqfsdfp........................
cwb_MDP0000245245|PACid:22671727 ESt.SSI..........GGVWTktvestklqtpkpvyqfsdfp........................
cwb_MDP0000188553|PACid:22658192 ESr.DRL..........GGRIHtdysfgcpvdmgaswlhgvcnenplaplirrlgltlyrtsgddsv
cwb_MDP0000296599|PACid:22628159 EKs.SVAcaa.......S---Gkaggflaldwcdgkplaslarasfhlhlslaqeldgpksygyrpl
cwb_MDP0000746652|PACid:22636428 ERd.LSE..........PDRIVgellqpggylklielgledcanesidaqk................
cwb_MDP0000259265|PACid:22650727 ERe.DCC..........ASLWKkrsydrlnlhlakgycslplm........................
cwb_MDP0000151331|PACid:22656760 ERg.XLP..........TAYPNxlnqdgflyxlxqeddgntpvqrimsedxiptvrgrilggtsmin
cwb_MDP0000309775|PACid:22670556 ER..GQP..........VEQRGrdigalvvrrmlqtesnfcfgeggagtwsdgklvtrigrnsgsvl
cwb_MDP0000232736|PACid:22657363 EGr.NRA..........GGWVYtkkmeggiregvaadlggsvltgtlgnplgivarqlgyvlhkvrd
cwb_MDP0000320539|PACid:22651795 SEesVPP..........YERPAlskgfllpe....................................
cwb_MDP0000239909|PACid:22648375 ERe.DQV..........GGTWVytpkvesdpigihpnrttvhssmyeslrtnlprevmgfrdypfva
cwb_MDP0000259264|PACid:22650726 ERe.DCC..........ASLWKkrsydrlnlhlakgycslplm........................
cwb_MDP0000293613|PACid:22654008 ERe.DFS..........SGTSSrstklihggvrylekavfnldygqlklvfhaleerkqvienaphl
cwb_MDP0000253362|PACid:22653297 ERe.DFS..........SGTSSrstklihggvrylekavfnldygqlklvfhaleerkqvienaphl
cwb_MDP0000182973|PACid:22649063 DSa.PTF..........GTSTSsrnsevihagiyypthslkakfcvrgryllykycsehniphkqig
cwb_MDP0000138005|PACid:22620884 ESr.DRL..........GGRIHtdysfgcpvdmgasw..............................
cwb_MDP0000261301|PACid:22674262 DRn.HFY..........GSQFAslhldqltsfinshatppstiidttstsishdytvldvtlrsvys
cwb_MDP0000771633|PACid:22649768 ERs.GPS..........TAKPCggaiplcmldefdipshlidrqvtrmrifspsnlavdfgk.....
cwb_MDP0000851102|PACid:22674240 ERs.GPS..........TAKPCggaiplcmldefdipshlidrqvtrmrifspsnlavdfgk.....
cwb_MDP0000159873|PACid:22673571 ERk.MDN..........CKPCGgaiplcmvgefnlpldiidrrvtkmkmispsnvavdigq......
cwb_MDP0000140206|PACid:22652348 SKeaVAP..........YERPAlskayllpegaa.................................
cwb_MDP0000261201|PACid:22657417 ERk.MDN..........CKPCGgaiplcmvgefdlpldiidrrvtkmkmispsnvavdigq......
cwb_MDP0000252244|PACid:22643267 ERk.MDN..........CKPCGgaiplcmvgefdlpldiidrrvtkmkmispsnvavdigq......
cwb_MDP0000261821|PACid:22664612 SKeaVAP..........YERPAlskaylxpe....................................
cwb_MDP0000124454|PACid:22663639 EGr.NRA..........GGWVYtkkmeggiregvaadlggsvltgtlgnplgivarqlgyvlhkvrd
cwb_MDP0000234830|PACid:22664319 ERe.DFS..........SGTSSrstklihggrriayihtcvrylekavfnldygqlklvfhaleerk
cwb_MDP0000297861|PACid:22646554 ERd.LTE..........PDRIVgellqpggylklielgledcveeidaqrvvgyalfkdgkntrlty
cwb_MDP0000152184|PACid:22632666 SEesVPP..........YERPAlskgfllpe....................................
cwb_MDP0000157871|PACid:22670351 SKeaVAP..........YERPAlskgyllpeg...................................
cwb_MDP0000250932|PACid:22662666 --..TLN..........IDRIA.............................................
cwb_MDP0000219521|PACid:22657613 EAs.DSI..........GGVWRhcsysstklqshrcdyefsdf........................
cwb_MDP0000239289|PACid:22649630 ERd.LTE..........PDRIVgellqpggylklmelgledcveeidaqrvvgyvlfkdgkntrlty
cwb_MDP0000258995|PACid:22632347 EAr.DRV..........GGNIItvekdgylweegpnsfqpsdpmltmmvdcglkddlvlgdpnaprf
cwb_MDP0000167343|PACid:22638473 EAs.DSI..........GGVWRhcsynstklqshrcdyefsdf........................
cwb_MDP0000222306|PACid:22645946 EAs.DSI..........GGVWRhcsynstklqshrcdyefsdf........................
cwb_MDP0000829384|PACid:22650105 DRn.HFY..........GSQFAslqldeltsfikshatppstiigststgssldytaldvtlrsvys
cwb_MDP0000145663|PACid:22632174 DPs.PLSmwpnn.....YGVWVdefeslnlescldkiwpmasvhvndski.................
cwb_MDP0000288439|PACid:22643642 ERg.GSP..........YENPLimenknfglslvqtdeytsvaqsfvskdggfqsprkssrrrigyq
cwb_MDP0000267350|PACid:22676208 --..---..........-----.............................................
cwb_MDP0000155608|PACid:22665289 --..---..........-----.............................................
cwb_MDP0000194622|PACid:22683388 DPs.PKLiwpnn.....YGVWVdefeamdmldcldttwsgavvyideesk.................
cwb_MDP0000134271|PACid:22620865 EAt.NSI..........GGVWR.............................................
cwb_MDP0000312748|PACid:22644976 ERr.HVI..........GGAAV.............................................
cwb_MDP0000197715|PACid:22640206 EKg.NYF..........THLDYssleapshdqlyeaggiivtadgkiilqvrstdnk..........
cwb_MDP0000220943|PACid:22675739 EAt.DSI..........GGVWKhcsynstklqtprcdfefsdyp.......................
cwb_MDP0000320539|PACid:22651795 --..---..........-----.............................................
cwb_MDP0000140206|PACid:22652348 SRd.PWC..........MPR--.............................................
cwb_MDP0000215521|PACid:22667208 EAt.DSI..........GGVWKqcsynstklqsprcnfefsdyp.......................
cwb_MDP0000203847|PACid:22681509 EKh.HTV..........GGMCEsvxiegkiydlggqvlaansapvifhlaketgseldemdshklal
cwb_MDP0000201011|PACid:22661057 EKh.HTV..........GGMCEsvdiegkiydlggqvlaansapvifhlaketgselvemdshklal
cwb_MDP0000204596|PACid:22635084 --..---..........-----.............................................
cwb_MDP0000148978|PACid:22620687 EAr.DVL..........GGKDGglgiielsafdqtllsvgggvcvgmgdvlsdrwqhgkivmgtgmk
cwb_MDP0000130369|PACid:22663416 EQ..GSG..........LGVLHeigiqrgnwypfrnifslvdelgikpftnwtkfaqysaegleiel
cwb_MDP0000314606|PACid:22664349 ERe.DFS..........SGTSSrstklihggrriayvhsyttttltcvqilsaqesv..........
cwb_MDP0000263146|PACid:22654671 SPk.NYF..........MFTPL.............................................
cwb_MDP0000250583|PACid:22633065 DQs.ERF..........VFKPM.............................................
cwb_MDP0000208233|PACid:22624841 ERe.DCF..........ASLWKkysydrlhlhlqkqfcelphm........................
cwb_MDP0000158720|PACid:22655873 EK..GRPlskvkisg..GGRCNvtnghcvdtmvlaenyprghrelkgaffnthgpadtmswfxdqgv
cwb_MDP0000152184|PACid:22632666 --..---..........-----.............................................
cwb_MDP0000182702|PACid:22680484 --..---..........-----.............................................
cwb_MDP0000261638|PACid:22646820 DRn.DYY..........GGEST.............................................
cwb_MDP0000130370|PACid:22654204 EQ..GSG..........LGVLHeigiqrgnwypfrnifslvdelgikpftnwtkfaqysaegleiel
cwb_MDP0000272119|PACid:22671033 DPy.NSY..........GSHFAslhlndftsfihshatpsstasanmtptsidhdytvldl......
cwb_MDP0000305861|PACid:22662391 SPr.NYF..........AFTPL.............................................
cwb_MDP0000255696|PACid:22677008 SPr.NYF..........AFTPL.............................................
cwb_MDP0000214280|PACid:22681133 ERg.XLP..........TAYPNxlnqdgflyxlxqeddgntpvqrimsedxiptvrgrilggtsmin
cwb_MDP0000210966|PACid:22644665 ERg.GSP..........YGNPNitnlstfgsalsdlspaspsqrfisedgvinararvlgggsclna
cwb_MDP0000610999|PACid:22659782 DTn.QFY..........GGHFAslplddlfpflnshasppsssstttttttitghddytalpltrrl
cwb_MDP0000242546|PACid:22662348 DTn.QFY..........GGHFAslplddlfpflnshasppsssstttttttitghddytalpltrrl
cwb_MDP0000320742|PACid:22645070 EKg.AEV..........GAHIIsgnvfepralnellpqwkdeespitvpvtsdkfwlltkdralslp
cwb_MDP0000654164|PACid:22658363 EKr.GAL..........DGTCL.............................................
cwb_MDP0000256300|PACid:22644503 --..---..........-----.............................................
cwb_MDP0000235080|PACid:22654616 ESa.RGP..........GGRMSqrrevvedekellfdhgapffnanktevlglvxeweskglvacwk
cwb_MDP0000284363|PACid:22634918 SPr.NYF..........AFTPL.............................................
cwb_MDP0000125043|PACid:22648273 --..---..........-----.............................................
cwb_MDP0000192359|PACid:22632529 --..---..........-----.............................................
cwb_MDP0000440005|PACid:22623062 DE..KEY..........FEIPW.............................................
cwb_MDP0000609131|PACid:22633588 ERn.PVV..........GGRMAtvnvsghifeagasilhprnlhavnytkllnlavnspsssdesss
cwb_MDP0000362000|PACid:22628256 SPr.NHM..........VFTPL.............................................
cwb_MDP0000150210|PACid:22663655 ERr.HVI..........GGAAV.............................................
cwb_MDP0000158790|PACid:22624362 GP..DLP..........FTNNYgvwedefkdlglegciehvwqntivyldgdsdp............
cwb_MDP0000427950|PACid:22623610 --..---..........-----.............................................
cwb_MDP0000569169|PACid:22666591 ERe.DFS..........SGTSSrstklihggvrylekavfnldygqlklvfhaleerkqvienaphl
cwb_MDP0000525742|PACid:22647174 EGyqSGP..........GGQLM.............................................
cwb_MDP0000559829|PACid:22672870 ERx.LSE..........PDRIFellqpaggylkkh................................
cwb_MDP0000321788|PACid:22641842 --..---..........----Idaevmcdr.....................................
cwb_MDP0000919183|PACid:22661837 EA..NEI..........LSS--.............................................
cwb_MDP0000146158|PACid:22623090 EA..NEI..........LSSF-.............................................
cwb_MDP0000832077|PACid:22645850 EAt.DSI..........GGVWK.............................................
cwb_MDP0000621365|PACid:22669861 ERg.SFP..........TSYPNvltqdgfilnlqqdddgetpvqrvms...................
cwb_MDP0000875229|PACid:22620206 EAl.DQL..........VPG--.............................................
cwb_MDP0000251344|PACid:22682514 ESc.MSNkixp......GGRLT.............................................
cwb_MDP0000168919|PACid:22641114 --..---..........-----.............................................
cwb_MDP0000267855|PACid:22645516 DE..AGI..........GGGAS.............................................
cwb_MDP0000195207|PACid:22668389 DTgiHGL..........GGRLGtrvvdpqplifdhaaqfftasdpqfvglvqgwlxqglvx......
cwb_MDP0000400145|PACid:22662498 DRn.HFY..........GSQFAslqldeltsfikshatppstiigststgssldytaldvtlrs...
cwb_MDP0000919183|PACid:22661837 SPr.NHM..........VFTPLl............................................
cwb_MDP0000307336|PACid:22681275 EAe.GRA..........GGKLR.............................................
cwb_MDP0000263146|PACid:22654671 EAs.DHI..........LNMFD.............................................
cwb_MDP0000309730|PACid:22638555 DE..AGI..........GGGAS.............................................
cwb_MDP0000163903|PACid:22648802 HRg.SRL..........LEFIG.............................................
cwb_MDP0000611628|PACid:22643604 EAirNKS..........LDQ--.............................................
cwb_MDP0000119779|PACid:22649695 HRg.SRL..........LEFIG.............................................
cwb_MDP0000120904|PACid:22629470 --..---..........-----.............................................
cwb_MDP0000150544|PACid:22634453 ERr.HVI..........GGAAV.............................................
cwb_MDP0000902209|PACid:22678199 DE..AGI..........GGGAS.............................................
cwb_MDP0000269370|PACid:22680893 --..---..........-----.............................................
cwb_MDP0000146158|PACid:22623090 SPr.NHM..........VFTPL.............................................
cwb_MDP0000124051|PACid:22654473 DGv.YNF..........RGRVLgggsainggvfsrasedyvekvgwnkmvldaykw...........
cwb_MDP0000255696|PACid:22677008 PGv.KEL..........VKITL.............................................
cwb_MDP0000305861|PACid:22662391 EAg.DHI..........L----.............................................
cwb_MDP0000611628|PACid:22643604 SPr.NHM..........VFTPLl............................................
cwb_MDP0000309622|PACid:22670269 ERd.LTK..........PDRIVgellqpgaylrlielgledcvnkidaqkifgyvlykdgirtklpy
cwb_MDP0000239909|PACid:22648375 --..---..........-----.............................................
cwb_MDP0000126888|PACid:22675379 --..TLN..........IDRIA.............................................
cwb_MDP0000869086|PACid:22644121 --..---..........-----.............................................
cwb_MDP0000317524|PACid:22631851 EQn.HDV..........GGQWLydpnvegedplgraptlkvhsslytslrlmlpreiagftdfpfa.
cwb_MDP0000160099|PACid:22658087 --..---..........-----.............................................
cwb_MDP0000251205|PACid:22649529 --..---..........-----.............................................
cwb_MDP0000314335|PACid:22679828 --..---..........-----.............................................
cwb_MDP0000638870|PACid:22646063 ERd.LSE..........PDRIVgellqpggylklielgledcanesxdaqkvfgyalyknxndtkls
cwb_MDP0000790657|PACid:22654829 --..---..........-----.............................................
cwb_MDP0000748068|PACid:22649054 --..---..........-----.............................................
cwb_MDP0000727481|PACid:22682921 --..---..........-----.............................................
cwb_MDP0000301246|PACid:22669391 --..---..........-----.............................................
cwb_MDP0000190684|PACid:22677586 --..---..........-----.............................................
cwb_MDP0000456223|PACid:22643829 DRn.DYY..........GGECA.............................................
cwb_MDP0000745172|PACid:22667211 EQs.VSL..........GGGAW.............................................
cwb_MDP0000407932|PACid:22626437 --..---..........-----.............................................
cwb_MDP0000440896|PACid:22680420 --..---..........-----.............................................
cwb_MDP0000694227|PACid:22673619 --..---..........-----.............................................
cwb_MDP0000123987|PACid:22662898 --..---..........-----.............................................
cwb_MDP0000138005|PACid:22620884 ESr.DRL..........GGRIHtdysfgcpvdmgaswlhgvcnenplaplirrlgltlyrtsgddsv
cwb_MDP0000258205|PACid:22638470 DPs.PLSmwpnn.....YGVWVdefeslnlescfdktwpmasvhvndsqt.................
cwb_MDP0000245245|PACid:22671727 --..---..........-----.............................................
cwb_MDP0000306704|PACid:22680179 --..---..........-----.............................................
cwb_MDP0000478654|PACid:22674637 ERn.PVV..........GGRMA.............................................
cwb_MDP0000728219|PACid:22657389 --..---..........-----.............................................
cwb_MDP0000170414|PACid:22675630 --..---..........-----.............................................
cwb_MDP0000284363|PACid:22634918 PMv.KDL..........VKITV.............................................
cwb_MDP0000219560|PACid:22625984 --..---..........-----.............................................
cwb_MDP0000235930|PACid:22635275 DQ..KEY..........FEIPW.............................................
cwb_MDP0000755938|PACid:22650525 --..---..........-----.............................................
cwb_MDP0000138851|PACid:22674897 VRs.PVH..........-FLSRgmlyffvllklfpssmvdsllvllsklvfgnlasygi........
cwb_MDP0000261638|PACid:22646820 --..---..........-----.............................................
cwb_MDP0000317524|PACid:22631851 --..---..........-----.............................................
cwb_MDP0000294615|PACid:22655955 --..---..........-----.............................................
cwb_MDP0000208234|PACid:22624840 VR..SPV..........HFLSRgmvylalvllkhfplsmvdsllvllsklvygnlasygierpqe..
cwb_MDP0000216129|PACid:22668259 --..---..........-----.............................................
cwb_MDP0000219521|PACid:22657613 --..---..........-----.............................................
cwb_MDP0000248995|PACid:22642703 --..---..........-----.............................................
cwb_MDP0000256328|PACid:22629063 SPr.NHM..........VFTPL.............................................
cwb_MDP0000181673|PACid:22646891 --..---..........-----.............................................
cwb_MDP0000169201|PACid:22625917 --..---..........-----.............................................
cwb_MDP0000263530|PACid:22651991 ESa.RVP..........GRRICrevvedgkell..................................
cwb_MDP0000295839|PACid:22658517 SPv.HIL..........TKEIV.............................................
cwb_MDP0000297466|PACid:22645872 GP..DLP..........FTNNYdlglegciehvcqntivyldddsdpimipraygrvc.........
cwb_MDP0000281982|PACid:22629373 --..---..........-----.............................................
cwb_MDP0000053966|PACid:22620929 --..---..........-----.............................................
cwb_MDP0000795740|PACid:22666880 --..---..........-----.............................................
cwb_MDP0000212327|PACid:22630830 ERd.LSE..........PDRIVgellqpggylrlvelgledkqrncvneidaqrvfgyalykdgkst
cwb_MDP0000437365|PACid:22632357 EKg.R--..........-----.............................................
cwb_MDP0000135231|PACid:22629791 DKsvPCS..........GATGA.............................................
cwb_MDP0000167343|PACid:22638473 --..---..........-----.............................................
cwb_MDP0000222306|PACid:22645946 --..---..........-----.............................................
cwb_MDP0000183517|PACid:22634175 EKs.EAF..........SNHPQ.............................................
cwb_MDP0000686821|PACid:22637777 SPv.HVL..........SKEIVffgmvllkllpvtivdkvvvglgk.....................
cwb_MDP0000430157|PACid:22655785 --..---..........-----.............................................
cwb_MDP0000373054|PACid:22683333 --..---..........----Qpggylklielglegkqllkitanesidaqkvfgyalykngndtkl
cwb_MDP0000295306|PACid:22673308 --..---..........-----.............................................
cwb_MDP0000233995|PACid:22662680 SPv.HVL..........NKEIV.............................................
cwb_MDP0000209681|PACid:22642739 SPv.HVL..........NKEIV.............................................
cwb_MDP0000876898|PACid:22679933 --..---..........-----.............................................
cwb_MDP0000738522|PACid:22680891 --..---..........-----.............................................
cwb_MDP0000399642|PACid:22674547 --..---..........-----.............................................
cwb_MDP0000215521|PACid:22667208 --..---..........-----.............................................
cwb_MDP0000170521|PACid:22675770 --..---..........-----.............................................
cwb_MDP0000262982|PACid:22620906 SSv.HV-..........--MPReifgkstfelavfllkwlpvwladklllmxsw.............
cwb_MDP0000321186|PACid:22667177 DRl.PXP..........FGLVR.............................................
cwb_MDP0000266051|PACid:22641431 --..---..........-----.............................................
cwb_MDP0000837610|PACid:22643529 --..---..........-----.............................................
cwb_MDP0000582079|PACid:22634000 SPv.HVL..........NKEIV.............................................
cwb_MDP0000538071|PACid:22663035 DAl.RVI..........-----.............................................
cwb_MDP0000241703|PACid:22642424 --..---..........-----.............................................
cwb_MDP0000671114|PACid:22638724 EQs.VSX..........GGGAX.............................................
cwb_MDP0000315388|PACid:22681954 --..---..........-----.............................................
cwb_MDP0000134271|PACid:22620865 EAt.NSI..........GGVWR.............................................
cwb_MDP0000297581|PACid:22646099 --..---..........-----.............................................
cwb_MDP0000911003|PACid:22677366 ER..NVL..........KGREQewnisrkelmelveigvllegdieqvtaakfnpnrcgfegkgdi.
cwb_MDP0000576650|PACid:22634720 EAr.DRM..........GGNII.............................................
cwb_MDP0000149205|PACid:22670334 EAr.DRM..........GGNII.............................................
cwb_MDP0000315409|PACid:22681973 --..---..........-----.............................................
cwb_MDP0000320804|PACid:22671446 --..---..........-----.............................................
cwb_MDP0000474647|PACid:22667377 EAk.DQV..........GGNII.............................................
cwb_MDP0000566648|PACid:22666666 EAk.DQV..........GGNII.............................................
cwb_MDP0000171379|PACid:22629613 --..---..........-----.............................................
cwb_MDP0000814529|PACid:22673539 EAk.DQV..........GGNII.............................................
cwb_MDP0000218295|PACid:22671514 EAk.DQV..........GGNI-.............................................
cwb_MDP0000220943|PACid:22675739 EAt.DSI..........GGVWKhcsynstklqtprcdfefsdyp.......................
cwb_MDP0000795437|PACid:22664825 --..---..........-----.............................................
cwb_MDP0000919706|PACid:22656631 --..---..........-----.............................................
cwb_MDP0000295675|PACid:22626457 EAk.DQV..........GGNII.............................................
cwb_MDP0000147542|PACid:22652542 EAk.DHV..........GGNII.............................................
cwb_MDP0000272126|PACid:22655119 ERg.GSP..........YGNPNiinienfaptlldtsptspgqhftsedrvfnictrvl........
cwb_MDP0000196881|PACid:22654963 EAr.DRV..........GGNII.............................................
cwb_MDP0000268346|PACid:22678394 TKakDQV..........GGNI-.............................................
cwb_MDP0000147542|PACid:22652542 EAk.DHV..........GGNIItvekdgyaraetrlrlerkdptklsrgfgkdkqagvyppallafl
cwb_MDP0000948298|PACid:22676144 --..---..........-----.............................................
cwb_MDP0000220943|PACid:22675739 --..---..........-----.............................................
cwb_MDP0000182589|PACid:22648509 TKakDQV..........GGNI-.............................................
cwb_MDP0000557870|PACid:22631128 --..---..........-----.............................................
cwb_MDP0000308870|PACid:22652882 EQ..---..........-----.............................................
cwb_MDP0000322449|PACid:22657441 --..---..........-----.............................................
cwb_MDP0000286494|PACid:22671310 TKakDQV..........GGNI-.............................................
cwb_MDP0000150868|PACid:22621264 --..---..........-----.............................................
cwb_MDP0000155608|PACid:22665289 --..---..........-----.............................................
cwb_MDP0000168505|PACid:22672316 --..---..........-----.............................................
cwb_MDP0000196888|PACid:22670849 --..---..........-----.............................................
cwb_MDP0000154812|PACid:22632894 TKakDQV..........GGNII.............................................
cwb_MDP0000186080|PACid:22622639 TKakDQV..........GGNII.............................................
cwb_MDP0000220012|PACid:22626541 --..---..........-----.............................................
cwb_MDP0000169409|PACid:22673915 ERg.GSP..........YGNPNiinienfaptlldtsptspgqhftsedrvfnictrvl........
cwb_MDP0000373095|PACid:22661923 --..---..........-----.............................................
cwb_MDP0000235846|PACid:22627807 QQ..NRP..........GGRHHhhhplrelp....................................
cwb_MDP0000207126|PACid:22623152 --..---..........-----.............................................
cwb_MDP0000268357|PACid:22630891 --..---..........-----.............................................
cwb_MDP0000149067|PACid:22669209 --..---..........-----.............................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 pkavielenyglpfsrtedgriyqrafggqsldfgkggq............................
cwb_MDP0000251581|PACid:22621152 pkavielenyglpfsrtedgriyqrafggqsldfgkggq............................
cwb_MDP0000188391|PACid:22626210 pkavielenyglpfsrtedgriyqrafggqsldfgkggq............................
cwb_MDP0000254144|PACid:22644986 cplykpdgtpvnkdidsnieiifnklldkvmelrqtmggfgndislgsvleklrqlysvarstdekq
cwb_MDP0000321972|PACid:22643109 lydhdlesfalfdtdghqvpqkmvvevgdtfkkilretekvrnehtddmsvsqaisvvmdrhpelrq
cwb_MDP0000299806|PACid:22682346 dicplylpdgkavnsemdssietsfnklldrvcklrhamieevksvdvplgtaleafrrvysvardt
cwb_MDP0000283451|PACid:22680462 dicplylpdgkavnsemdssieasfnklldrvcklrhamieevksvdvslgtaleafqrvysvaqdp
cwb_MDP0000296714|PACid:22644308 vlnsdcplydiatgekvpadldealeaefnsllddmvllvaqegeqtrmslekglehalkrrrmakt
cwb_MDP0000162193|PACid:22629958 vlnsdcplydiatgekvpadldealeaefnsllddmvllvakegeqtrxsleegleyalkrrrmakt
cwb_MDP0000769741|PACid:22637873 lydhdlesyalfdmdgnqvpqdlvtkvgevfenilketdavrqefsedmpiarafsivferkpelrl
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 rireliamgasfdhgedgnlhlaregghs......................................
cwb_MDP0000241767|PACid:22665328 vlnsdcplydiatgxkvpadldealeaefnsllddmevslpnwn.......................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 lihtdvtkylyfkavdgsfvynkgkvhkvpatdmealksplmglfekrrarkffiyvqdynetdpkt
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 lihtdvtkylyfkavdgsfvynkgkvhkvpatdmealksplmglfekrrarkfilyvqdysetdpkt
cwb_MDP0000315409|PACid:22681973 lihtdvtkylnfkavdgsfvynkgkvhkvpandvealksplmglfekrrarkffiyvqdydendpks
cwb_MDP0000053966|PACid:22620929 lihtnvtkylnfkavdgsfvynkgkvhkvpandvealksplmglfekrrarkffiyvqdydendpks
cwb_MDP0000294615|PACid:22655955 lihtnvtkylnfkavdgsfvynkgkvhkvpandvealksplmglfekrrarkffiyvqdydendpks
cwb_MDP0000306147|PACid:22679041 vlnsdcplydiatgxkvpadldealeaefnsllddmevslpnwn.......................
cwb_MDP0000180064|PACid:22628138 dihysishrhatgnlnlitqalaavgcempvipdpttvhyhlpdnlsvvvhreysefiseltnkfph
cwb_MDP0000261625|PACid:22630921 aryniydrsgkifprglveetykkevesavqklkkleagggdfsnvteppttqktpielaidftlhd
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 fvnkggnigeldfrfpigapihgilaflstnqikagfpiatmtdftanhhhchislfwipllaeldf
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ggfysrasedfvekvgwdkemvtnayqwvesrivfkpeltpwqyaa.....................
cwb_MDP0000188994|PACid:22643055 sf.................................................................
cwb_MDP0000159189|PACid:22672554 sf.................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 laasn..............................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 lriiankfswtttkqvgadenllvkdhthtfvnkggsigeldfrfpigapihgilaflstnqikagf
cwb_MDP0000231632|PACid:22622264 yivrngmpvllptnpialitsnflsaqsklxiilepyxwkkkgvsdddtqesvggffqrhfgpevvd
cwb_MDP0000173300|PACid:22648712 ktpnyvlqewnkd......................................................
cwb_MDP0000158474|PACid:22655457 gfytrastrlnascvphvlklsshfyggrlgseivrpnkfikrvgwdakivnesypwiekqivhqpk
cwb_MDP0000276878|PACid:22649644 pnmmeffeslgvdmetsdmsfsasldngrgcewgsrnglsslfaqktnlinpyfwqmlreitkfkhd
cwb_MDP0000154720|PACid:22639222 dytglgytrydardvhkdslgcvvenkvlhss...................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ssdepttvaeg........................................................
cwb_MDP0000702799|PACid:22650781 ssdepttvaeg........................................................
cwb_MDP0000233110|PACid:22669060 rtphnvlrewsvdhkiplyasedyqsamdivckrisvtegcteenfqnqilrkgcenlglkvesvpr
cwb_MDP0000260827|PACid:22621315 plek...............................................................
cwb_MDP0000941459|PACid:22654340 ssdepttvaxxxlelepdvvdpisslfknlmdyaqgkqvfdesperecngdfeysklgdxasricas
cwb_MDP0000185338|PACid:22637072 agfysradqdfymktsvdwdlqmvnesyewveraivfrpelrtwqsavrdglleagvdpyngfn...
cwb_MDP0000451172|PACid:22678939 gfytrasthyikevgwnqrmvnqsyewvekvvafepeilqwetafrdgllevgvlphnr........
cwb_MDP0000136847|PACid:22626492 vglysradseflkksgikldmnlvnnsyewventlvfrpnlshwqsvvkdalleagvrpdngltldh
cwb_MDP0000177641|PACid:22624304 ggffsrasxdyvkrvgwnkxmvsdaykwvesrnafkpkltpwqyvaelsfleagifpyng.......
cwb_MDP0000413935|PACid:22663920 plek...............................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ggfysrasedfvekvawdketvtnayqwvesrvvfkpel............................
cwb_MDP0000137211|PACid:22645789 ggaysradsefykksgikldmnlvnksyewvedtivfr.............................
cwb_MDP0000130099|PACid:22624356 agvyaranisffsqsgvewnmdlvnatyewiedti................................
cwb_MDP0000425135|PACid:22674685 agfysradqdfytktsvdwdprmvnesyewveraivfrpe...........................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 iglysradseflkksgikldmnlvnnsyewventlvfrpnlshwqsvvkdalleagvrpdngl....
cwb_MDP0000869086|PACid:22644121 kkgr...............................................................
cwb_MDP0000318256|PACid:22681338 igxysradgefyqksgikldmnlvnnsyewven..................................
cwb_MDP0000231634|PACid:22622267 qtkryivrngtpvllptxpialiksnflsaqsklliilepylwkkkgvsdddtqesvggffqrhfgq
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 kkgr...............................................................
cwb_MDP0000162755|PACid:22662459 lqtfq..............................................................
cwb_MDP0000173666|PACid:22649255 yivrngmpvllptnpialitsnflsaqsklxiilepyxwkkkgvsdddtqesvggffqrhfgxemrh
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ggffsrasedyvkrvgwnkqivsdaykwvesrnafk...............................
cwb_MDP0000598927|PACid:22655979 rireliamgasfdhgedgnlhlaregghs......................................
cwb_MDP0000561228|PACid:22637769 agvyaranisffnesgvewdinlvnatyewiedtivykpnafawqtvtqkafleagv..........
cwb_MDP0000175650|PACid:22652650 lgsvdhmqpqdfeq.....................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 yplen..............................................................
cwb_MDP0000213381|PACid:22663844 yplet..............................................................
cwb_MDP0000168437|PACid:22624648 plen...............................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ypled..............................................................
cwb_MDP0000199319|PACid:22658752 yplet..............................................................
cwb_MDP0000857446|PACid:22649571 yplet..............................................................
cwb_MDP0000266638|PACid:22658651 yplet..............................................................
cwb_MDP0000208936|PACid:22641581 ktpdnvlrdwsvdhkiplyasedyksamdivckrigvtescteenfpnqi.................
cwb_MDP0000202883|PACid:22663993 yplen..............................................................
cwb_MDP0000288439|PACid:22643642 srasxdyvkrvgwnkemvsdaykwvesrnafkpkltpwqyva.........................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 valysradgefyeksgikldmnlvnnsyewventvaf..............................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 yplet..............................................................
cwb_MDP0000634676|PACid:22625957 yplet..............................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 yplet..............................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 kwtltrde...........................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 qksgikldmnlvnnsyxwven..............................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 yplet..............................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 eagvrpdngltldhikgtk................................................
cwb_MDP0000686885|PACid:22670382 ldmapandkvllavvdscrknsvafsvmnrdqlhqefsgrvmipedw....................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 tpcldgrylllgpnkdhnhseiskfskrdadayprygnqlgnfcefmdplldsappeslqcesscsv
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 idgekkvkwtltrde....................................................
cwb_MDP0000272655|PACid:22672104 igiysradsefyeksgikldmnlvnnsyewven..................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ykdgirtklpypsen....................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ldmapandkvlhavvescrknxvafrvmnrdqxdqefsgrvmipedwv...................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 lydhdlesfalfdmdgrqvpqkmvvevgdtfkkilkgtekvriensddmsvcqaisvvmdrhpelsl
cwb_MDP0000296599|PACid:22628159 ttlsltvsesetskpsgksnlpswvdgparspr..................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 agvxaranisfynesgiewdmdlvnktykwventivgrpnnsvggwqsvaqkafleaggydp.....
cwb_MDP0000309775|PACid:22670556 avmetlvhfgapegil...................................................
cwb_MDP0000232736|PACid:22657363 kclpysfdgkpvdpdmdmkveaafnhlldkanlisklslafwdqddpydmggdhcflpggngrlvha
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 reg................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 chalpcmtpcfdwfevvyywmglkmydlvaglrllhvsryysaqesvelfptlarkgnnkslk....
cwb_MDP0000253362|PACid:22653297 chalpcmtpcfdwfevvyywmglkmydlvaglrllhvsryysaqesvelfptlarkgnnkslk....
cwb_MDP0000182973|PACid:22649063 klivatgsseipnlhnlmhrgiqngvdglvmmegseamrmepelaclkallsplsgivd........
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 sietanyapeivadqsskflidlggprvlfcadkavdlivksgvdsyltfksidvsficdesgglsn
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 kclpysfdgkpvdpdmdmkveaafnhlldkanlisklsla...........................
cwb_MDP0000234830|PACid:22664319 qvidnaphlchalpcmtpcfdwfevvyywmglkmydlvaalrllhvsryysaqesvelfptlarkgn
cwb_MDP0000297861|PACid:22646554 pleq...............................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 pleq...............................................................
cwb_MDP0000258995|PACid:22632347 vlwdgklrpvpsspadipffdlmsiggklraafg.................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 nietanyapeilanqfskflidlggprxlfcadkaidliaksgvgsylsfksidvsficdengrlsn
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 rrivsdaykwvesrnafkpkltpwpyvaelslleagifpyngfsldhi...................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 idksgqyqdikvaddyvsvisltlelqdkaaksgrigvhavseyasdltpvylehqgfssvpksvay
cwb_MDP0000201011|PACid:22661057 idksgqyqdikvaddyvsvitltlelqdkaaksgrigvhavseyasdltpvylerqgfssipksvay
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 qaciysermmecnsvtnlgmrflvvsslhyspssvwfkvqtvpgkfkvavpnilgvrtpgfpasvfi
cwb_MDP0000130369|PACid:22663416 evlkcvnggsnvlqaefpvfqdlpqlpapfgtlyytqfaqlplvdrltslpltaavidfdntdtawr
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 elkte..............................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 evlkcvnggsnvlqaefpnvlspliqvglsapaeqcsaaatlgllsyifahqk..............
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 agvxaranisfynesgiewdmdlvnktykwventivgrpnnsvggwqsvaqkafleaggydp.....
cwb_MDP0000210966|PACid:22644665 gfytrappdyireaxwdgrlvnesyqwvehlvafrppiqawqsavrnglmeagvmpyngftydhi..
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 s..................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ekfgffdrisnkffdl...................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 safgiwdghqfvfktlsfkselpfvdkivslansllmlfrygyslirmdkfvetavnkfckyyesfe
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 chalpcmtpcfdwfev...................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 psen...............................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 yplen..............................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 lydhdlesfalfdmdgrqvpqkmvvevgdtfkkilkgtekvriensddmsvcqaisvvmdrhpelsl
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 klpyplen...........................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 syrlkn.............................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 lcvlsaeasv.........................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 lldwhlanleyanagclsnlsaay...........................................
cwb_MDP0000321972|PACid:22643109 nglahevlqwyicrmeawfaadadvislknwd...................................
cwb_MDP0000299806|PACid:22682346 qermlldwhlanleyanaslmsnlsmaywdqddpy................................
cwb_MDP0000283451|PACid:22680462 qermlldwhlanleyanaslmsnlsmaywdqddpy................................
cwb_MDP0000296714|PACid:22644308 stsveekelhdlmdgfidakknidrakkscqklellsplerrvmdwhfanleygcaaplkevslpnw
cwb_MDP0000162193|PACid:22629958 gtsieakelnglmdgfidakksidraeescqkqexlsplerrvmdwhfanleygcatllkevslpnw
cwb_MDP0000769741|PACid:22637873 egvahkvlqwylcrmegwfaadadtislkcwd...................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 hegmnltrvttrdliakyglddntvdfighalalhrddrylnepaldtvkrmklyaeslar......
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 hegmdltrvttrdliakyglddntvdfighalalhrddrylnepaldtvkrmklyaesfar......
cwb_MDP0000315409|PACid:22681973 hegldlnkvtareliskyglddntvdfighalalqqddnylaepamdfvkrmklyaeslar......
cwb_MDP0000053966|PACid:22620929 hegmdlnkvtarelilkyglddntvdfighalalhrddnylaepamafvkrmklyaeslar......
cwb_MDP0000294615|PACid:22655955 hegmdlnkvtarelilkyglddntvdfighalalhrddnylaepamafvkrmklyaeslar......
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ekqgilkfygvcwkifnalnslelksleepiylfgqffqkpvecltlayylpqnagdiarkyiqdpq
cwb_MDP0000261625|PACid:22630921 fempevepistfldygereflvadergyehmlykmaedvlftsegklldsrlkfnkmfnlnxyyryp
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 cyxisfitvqtydkarnavalalspvvkalvxpdgalqdvrnldsis....................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 pfatttdftanhhhchislfwiptydkarnav...................................
cwb_MDP0000231632|PACid:22622264 ylidpfvagtsggdpeslsmrhsfpdlwnmekrfgsvisgaiksklsakkeksgqtkgsvekgk...
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 lepwqvairdsllsvgvspfngftydhvygt....................................
cwb_MDP0000276878|PACid:22649644 ainyleelennqdidrsetlgqfiksrgyselfqkayxvpvcgsiwscpsegvmsfsafsvlsfcrn
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 nssad..............................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 nddvgklsvgsfxrqgl..................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 iqgtk..............................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 evvdylidpfvaftrcgypeslsmrhsfpdlwnmekrfgsvisgaiksklsakkeksgqtkgsvekg
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 sfpdlwnmekrfgsvisgaikskxsakkeksgqtkgsvekgk.........................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 sdrfknkmhnsmfwarclrqaaalgqkd.......................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 tdltpntsrqkglahevlqwyicrmeawfaadadvislknwdqayklrvlvvkehvlsgghglmvqg
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 la.................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 vpdsrsaifkdkslslieknqlmr...........................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 nkslk..............................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 vpdsrsaifkdkslslieknqlmrffklvqqhlaasagddggnesakiseedlespfadflkrmrlp
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 gytasgygfvqdmp.....................................................
cwb_MDP0000201011|PACid:22661057 gytasgygfvqdm......................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 vifcprwiyiiytllnetgfgaypniqnlfgelgindrlqwkehsmifampnkpgefsrfdflevlp
cwb_MDP0000130369|PACid:22663416 kydaitarelfkqfgcsenlyqnvlspliqvglsapaeqcsaaatlgllsyifahqk..........
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 trpxfetvde.........................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 tdltpntsrqkglahevlqwyicrmeawfaadadvislknwdqayklrvlvvkehvlsgghglmvqg
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 llsfidaecfivstvkalqtpminasmvmcdr...................................
cwb_MDP0000261625|PACid:22630921 xslnxxilwggflg.....................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 hhllqlf............................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 ...................................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 k..................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ydpiikalakdidvrlnhsigspkryltlessifrsgwmyntkgctflslhx...............
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 pkikssilyaisladddqdnsevcktvlktregmerldlyqksvgrfp...................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 apingkyyshllkiesslftnaensfcswegiwailknnemltwpekikfaigllpailggqayvea
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ydpiikalakdidvrlnhsigspkryltlessifrsgwmyntkgctflslhx...............
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                              50    
                                                                                               |    
d1xdia1                          ........................................................LDDCVPSKT.F
cwb_MDP0000813172|PACid:22649115 ........................................................AYRCACAAD.R
cwb_MDP0000251581|PACid:22621152 ........................................................AYRCACAAD.R
cwb_MDP0000188391|PACid:22626210 ........................................................AYRCACAAD.R
cwb_MDP0000254144|PACid:22644986 ........................................................W--------.-
cwb_MDP0000321972|PACid:22643109 ........................................................Q---EHVLS.G
cwb_MDP0000299806|PACid:22682346 ........................................................E--------.-
cwb_MDP0000283451|PACid:22680462 ........................................................E--------.-
cwb_MDP0000296714|PACid:22644308 ........................................................NQDDVYGGF.G
cwb_MDP0000162193|PACid:22629958 ........................................................NQDDVYGGF.G
cwb_MDP0000769741|PACid:22637873 ........................................................Q--------.-
cwb_MDP0000295277|PACid:22625688 ........................................................NVGCIPSKA.L
cwb_MDP0000897124|PACid:22647159 ........................................................NVGCIPSKA.L
cwb_MDP0000854208|PACid:22682207 ........................................................HRRIVHAAD.M
cwb_MDP0000241767|PACid:22665328 ........................................................QDDVYGGFG.G
cwb_MDP0000318858|PACid:22682838 ........................................................MMYGVPNMK.T
cwb_MDP0000248995|PACid:22642703 ........................................................F--------.-
cwb_MDP0000442206|PACid:22660061 ........................................................MMYGVPNMK.T
cwb_MDP0000181673|PACid:22646891 ........................................................F--------.-
cwb_MDP0000315409|PACid:22681973 ........................................................F--------.-
cwb_MDP0000053966|PACid:22620929 ........................................................F--------.-
cwb_MDP0000294615|PACid:22655955 ........................................................F--------.-
cwb_MDP0000306147|PACid:22679041 ........................................................QDDVYGGFG.G
cwb_MDP0000180064|PACid:22628138 ........................................................HYGGINYPV.G
cwb_MDP0000261625|PACid:22630921 ........................................................T--------.-
cwb_MDP0000300208|PACid:22651331 ........................................................IRGCVPKKI.L
cwb_MDP0000247171|PACid:22623108 ........................................................ALTLFPNAW.C
cwb_MDP0000308095|PACid:22667065 ........................................................F--------.-
cwb_MDP0000319421|PACid:22624123 ........................................................G--------.-
cwb_MDP0000232295|PACid:22657598 ........................................................E--------.-
cwb_MDP0000188994|PACid:22643055 ........................................................K--------.-
cwb_MDP0000159189|PACid:22672554 ........................................................K--------.-
cwb_MDP0000656178|PACid:22657871 ........................................................NRGCVPSKA.L
cwb_MDP0000910523|PACid:22620639 ........................................................GNDLVGPRS.V
cwb_MDP0000119941|PACid:22643547 ........................................................NVGCIPSKV.S
cwb_MDP0000231799|PACid:22673471 ........................................................NRGCVPSKA.L
cwb_MDP0000255025|PACid:22624807 ........................................................A--------.-
cwb_MDP0000231632|PACid:22622264 ........................................................RQRGSFSFH.G
cwb_MDP0000173300|PACid:22648712 ........................................................H--------.-
cwb_MDP0000158474|PACid:22655457 ........................................................K--------.-
cwb_MDP0000276878|PACid:22649644 ........................................................GRPQWLTVR.W
cwb_MDP0000154720|PACid:22639222 ........................................................LLSCMQNTD.F
cwb_MDP0000549646|PACid:22624756 ........................................................LGGQLFSAM.V
cwb_MDP0000158853|PACid:22672016 ........................................................G--------.-
cwb_MDP0000702799|PACid:22650781 ........................................................G--------.-
cwb_MDP0000233110|PACid:22669060 ........................................................H--------.-
cwb_MDP0000260827|PACid:22621315 ........................................................FHSDVSGRS.F
cwb_MDP0000941459|PACid:22654340 ........................................................D--------.-
cwb_MDP0000185338|PACid:22637072 ........................................................L--------.-
cwb_MDP0000451172|PACid:22678939 ........................................................FTYEHLYGT.K
cwb_MDP0000136847|PACid:22626492 ........................................................I--------.-
cwb_MDP0000177641|PACid:22624304 ........................................................F--------.-
cwb_MDP0000413935|PACid:22663920 ........................................................FHSDVSGRS.F
cwb_MDP0000206098|PACid:22637273 ........................................................LGGQLFSAM.I
cwb_MDP0000845788|PACid:22673064 ........................................................TTTEVENFP.G
cwb_MDP0000465595|PACid:22654474 ........................................................T--------.-
cwb_MDP0000137211|PACid:22645789 ........................................................P--------.-
cwb_MDP0000130099|PACid:22624356 ........................................................V--------.-
cwb_MDP0000425135|PACid:22674685 ........................................................L--------.-
cwb_MDP0000200780|PACid:22660656 ........................................................---------.-
cwb_MDP0000142434|PACid:22683351 ........................................................SYGGAEARC.L
cwb_MDP0000248951|PACid:22626490 ........................................................T--------.-
cwb_MDP0000869086|PACid:22644121 ........................................................D----MRRF.P
cwb_MDP0000318256|PACid:22681338 ........................................................TVAFRPNVT.H
cwb_MDP0000231634|PACid:22622267 ........................................................RQRGSFSFH.G
cwb_MDP0000626995|PACid:22630905 ........................................................LGGQLFSAM.V
cwb_MDP0000123832|PACid:22633934 ........................................................ALTLFPNAW.C
cwb_MDP0000236092|PACid:22632501 ........................................................LGGQLFSAM.V
cwb_MDP0000199159|PACid:22674497 ........................................................D-----MRR.F
cwb_MDP0000162755|PACid:22662459 ........................................................M--------.-
cwb_MDP0000173666|PACid:22649255 ........................................................RQRGSFSFH.G
cwb_MDP0000262982|PACid:22620906 ........................................................PFPEDFPEY.P
cwb_MDP0000184832|PACid:22636281 ........................................................PKLTPWPYV.A
cwb_MDP0000598927|PACid:22655979 ........................................................HHRIVHAAD.M
cwb_MDP0000561228|PACid:22637769 ........................................................L--------.-
cwb_MDP0000175650|PACid:22652650 ........................................................V--------.-
cwb_MDP0000233802|PACid:22672706 ........................................................NFPGFPDGI.L
cwb_MDP0000321186|PACid:22667177 ........................................................---------.-
cwb_MDP0000161955|PACid:22660959 ........................................................YPSDIAGRS.F
cwb_MDP0000213381|PACid:22663844 ........................................................YSSDIAGRS.F
cwb_MDP0000168437|PACid:22624648 ........................................................FHPDVAGRS.F
cwb_MDP0000823251|PACid:22668430 ........................................................NFPGFPDGI.L
cwb_MDP0000191389|PACid:22631180 ........................................................YTSDIAGRS.F
cwb_MDP0000199319|PACid:22658752 ........................................................YSSDIAGRS.F
cwb_MDP0000857446|PACid:22649571 ........................................................YSSDIAGRS.F
cwb_MDP0000266638|PACid:22658651 ........................................................YSSDIAGRS.F
cwb_MDP0000208936|PACid:22641581 ........................................................L--------.-
cwb_MDP0000202883|PACid:22663993 ........................................................YTLDIAGRX.F
cwb_MDP0000288439|PACid:22643642 ........................................................E--------.-
cwb_MDP0000295839|PACid:22658517 ........................................................PFPPNYPRY.L
cwb_MDP0000903805|PACid:22678063 ........................................................R----PNLS.H
cwb_MDP0000202123|PACid:22678734 ........................................................LRGCVPKKL.L
cwb_MDP0000227773|PACid:22639029 ........................................................VKKGRDMRR.F
cwb_MDP0000317524|PACid:22631851 ........................................................VKKGRDMRR.F
cwb_MDP0000320748|PACid:22658808 ........................................................YSSEIAGRS.F
cwb_MDP0000634676|PACid:22625957 ........................................................YSSDIAGRS.F
cwb_MDP0000235846|PACid:22627807 ........................................................NFPGFPDGI.L
cwb_MDP0000251344|PACid:22682514 ........................................................NFPGFPDGI.L
cwb_MDP0000501957|PACid:22671723 ........................................................YSSDIAGRS.F
cwb_MDP0000209681|PACid:22642739 ........................................................PFPSN-APT.Y
cwb_MDP0000293482|PACid:22637734 ........................................................DFNCRAAHW.-
cwb_MDP0000233995|PACid:22662680 ........................................................PFPSN-APT.Y
cwb_MDP0000257243|PACid:22657003 ........................................................T--------.-
cwb_MDP0000160099|PACid:22658087 ........................................................VKKGRDMRR.F
cwb_MDP0000193196|PACid:22649572 ........................................................YSSDIAGRS.F
cwb_MDP0000208234|PACid:22624840 ........................................................SFPTSCPTY.V
cwb_MDP0000251783|PACid:22654795 ........................................................ITGTIFDNR.G
cwb_MDP0000686885|PACid:22670382 ........................................................V--------.-
cwb_MDP0000138851|PACid:22674897 ........................................................SFPTSYPTY.V
cwb_MDP0000194930|PACid:22667971 ........................................................F--------.-
cwb_MDP0000169201|PACid:22625917 ........................................................WPSSVEEDF.P
cwb_MDP0000399642|PACid:22674547 ........................................................WPSSVEEDF.P
cwb_MDP0000582079|PACid:22634000 ........................................................TFPPNAPT-.Y
cwb_MDP0000129765|PACid:22673448 ........................................................ELNCRAGHW.G
cwb_MDP0000272655|PACid:22672104 ........................................................TVIFRPNVT.R
cwb_MDP0000686821|PACid:22637777 ........................................................MPFPSDTPT.Y
cwb_MDP0000170414|PACid:22675630 ........................................................WPSSVEXDF.P
cwb_MDP0000320804|PACid:22671446 ........................................................WPSSVTEGH.P
cwb_MDP0000189790|PACid:22676146 ........................................................FNPDVVGVS.F
cwb_MDP0000847111|PACid:22682055 ........................................................TFPXNAPTY.I
cwb_MDP0000289536|PACid:22677728 ........................................................G--------.-
cwb_MDP0000123987|PACid:22662898 ........................................................WPSSVEEDF.P
cwb_MDP0000245245|PACid:22671727 ........................................................WPSSVEEDF.P
cwb_MDP0000188553|PACid:22658192 ........................................................NLNCHCLFL.V
cwb_MDP0000296599|PACid:22628159 ........................................................TIGTAETTA.Q
cwb_MDP0000746652|PACid:22636428 ........................................................VFGYALYKN.G
cwb_MDP0000259265|PACid:22650727 ........................................................PHSFRTSTF.M
cwb_MDP0000151331|PACid:22656760 ........................................................NNGFVLDHI.E
cwb_MDP0000309775|PACid:22670556 ........................................................VDGKPHLGT.D
cwb_MDP0000232736|PACid:22657363 ........................................................E--------.-
cwb_MDP0000320539|PACid:22651795 ........................................................APARLPSFH.T
cwb_MDP0000239909|PACid:22648375 ........................................................DEERDPRRF.X
cwb_MDP0000259264|PACid:22650726 ........................................................PHSFRTSTF.M
cwb_MDP0000293613|PACid:22654008 ........................................................GTVVYYDGQ.M
cwb_MDP0000253362|PACid:22653297 ........................................................GTVVYYDGQ.M
cwb_MDP0000182973|PACid:22649063 ........................................................THSLMLSLV.Y
cwb_MDP0000138005|PACid:22620884 ........................................................L--------.-
cwb_MDP0000261301|PACid:22674262 ........................................................F--------.-
cwb_MDP0000771633|PACid:22649768 ........................................................TLLPHEFIA.M
cwb_MDP0000851102|PACid:22674240 ........................................................TLLPHEFIA.M
cwb_MDP0000159873|PACid:22673571 ........................................................TLKPHEYIG.M
cwb_MDP0000140206|PACid:22652348 ........................................................R---LPGFH.V
cwb_MDP0000261201|PACid:22657417 ........................................................TLKPHEYIG.M
cwb_MDP0000252244|PACid:22643267 ........................................................TLKPHEYIG.M
cwb_MDP0000261821|PACid:22664612 ........................................................SPARLPGFH.V
cwb_MDP0000124454|PACid:22663639 ........................................................F--------.-
cwb_MDP0000234830|PACid:22664319 ........................................................GTVVYYDGQ.M
cwb_MDP0000297861|PACid:22646554 ........................................................FNSDVAGRS.F
cwb_MDP0000152184|PACid:22632666 ........................................................APARLPSFH.T
cwb_MDP0000157871|PACid:22670351 ........................................................A-TRLPGFH.V
cwb_MDP0000250932|PACid:22662666 ........................................................WQPCNPAVG.G
cwb_MDP0000219521|PACid:22657613 ........................................................PWPDRDNTE.Y
cwb_MDP0000239289|PACid:22649630 ........................................................FHSDVAGRS.F
cwb_MDP0000258995|PACid:22632347 ........................................................A--------.-
cwb_MDP0000167343|PACid:22638473 ........................................................PWPDRDNTD.Y
cwb_MDP0000222306|PACid:22645946 ........................................................PWPDRDNTD.Y
cwb_MDP0000829384|PACid:22650105 ........................................................N--------.-
cwb_MDP0000145663|PACid:22632174 ........................................................KFLDRPYGR.V
cwb_MDP0000288439|PACid:22643642 ........................................................E--------.-
cwb_MDP0000267350|PACid:22676208 ........................................................---------.-
cwb_MDP0000155608|PACid:22665289 ........................................................---------.-
cwb_MDP0000194622|PACid:22683388 ........................................................KDLNRPYGR.V
cwb_MDP0000134271|PACid:22620865 ........................................................HCSYNSTKL.Q
cwb_MDP0000312748|PACid:22644976 ........................................................TEELVPGFK.F
cwb_MDP0000197715|PACid:22640206 ........................................................I--------.-
cwb_MDP0000220943|PACid:22675739 ........................................................W--------.-
cwb_MDP0000320539|PACid:22651795 ........................................................FPEEHCMAR.L
cwb_MDP0000140206|PACid:22652348 ........................................................---------.L
cwb_MDP0000215521|PACid:22667208 ........................................................W--------.-
cwb_MDP0000203847|PACid:22681509 ........................................................Y--------.-
cwb_MDP0000201011|PACid:22661057 ........................................................P--------.-
cwb_MDP0000204596|PACid:22635084 ........................................................---------.-
cwb_MDP0000148978|PACid:22620687 qdglsvkdwmrkqgipdrvttevfiamskalnfinpdelsmqcilialnrflqekhGSKMAFLDG.S
cwb_MDP0000130369|PACid:22663416 ........................................................NFDLVLCRG.T
cwb_MDP0000314606|PACid:22664349 ........................................................ELFXTLARK.M
cwb_MDP0000263146|PACid:22654671 ........................................................-LPSVTCGT.V
cwb_MDP0000250583|PACid:22633065 ........................................................-LYELLTGE.V
cwb_MDP0000208233|PACid:22624841 ........................................................SFPTSYPTY.V
cwb_MDP0000158720|PACid:22655873 ........................................................DDGRVFPVS.N
cwb_MDP0000152184|PACid:22632666 ........................................................FPEEHCMAR.L
cwb_MDP0000182702|PACid:22680484 ........................................................HYGGINYPI.G
cwb_MDP0000261638|PACid:22646820 ........................................................SLNLNQFM-.M
cwb_MDP0000130370|PACid:22654204 ........................................................NFDLVLCRG.T
cwb_MDP0000272119|PACid:22671033 ........................................................N--------.-
cwb_MDP0000305861|PACid:22662391 ........................................................-LPSVTCGT.V
cwb_MDP0000255696|PACid:22677008 ........................................................-LPSVTCGT.V
cwb_MDP0000214280|PACid:22681133 ........................................................NNGFVLDHI.E
cwb_MDP0000210966|PACid:22644665 ........................................................Y--------.-
cwb_MDP0000610999|PACid:22659782 ........................................................L--------.-
cwb_MDP0000242546|PACid:22662348 ........................................................L--------.-
cwb_MDP0000320742|PACid:22645070 ........................................................PFDNRGNYV.I
cwb_MDP0000654164|PACid:22658363 ........................................................NVRCIPSKA.L
cwb_MDP0000256300|PACid:22644503 ........................................................---------.-
cwb_MDP0000235080|PACid:22654616 ........................................................EQEGLISKR.Y
cwb_MDP0000284363|PACid:22634918 ........................................................-LPSVTCGT.V
cwb_MDP0000125043|PACid:22648273 ........................................................---------.-
cwb_MDP0000192359|PACid:22632529 ........................................................---------.-
cwb_MDP0000440005|PACid:22623062 ........................................................TSLRTMVEP.T
cwb_MDP0000609131|PACid:22633588 ........................................................M--------.-
cwb_MDP0000362000|PACid:22628256 ........................................................LASTCVGTL.E
cwb_MDP0000150210|PACid:22663655 ........................................................TEELVPGFK.F
cwb_MDP0000158790|PACid:22624362 ........................................................IMIDRAYGR.V
cwb_MDP0000427950|PACid:22623610 ........................................................---------.-
cwb_MDP0000569169|PACid:22666591 ........................................................V--------.-
cwb_MDP0000525742|PACid:22647174 ........................................................TTTEVENFP.G
cwb_MDP0000559829|PACid:22672870 ........................................................IXSNIVGXS.F
cwb_MDP0000321788|PACid:22641842 ........................................................HYGGINYPI.G
cwb_MDP0000919183|PACid:22661837 ........................................................---------.-
cwb_MDP0000146158|PACid:22623090 ........................................................---------.-
cwb_MDP0000832077|PACid:22645850 ........................................................HCSYNSTKL.Q
cwb_MDP0000621365|PACid:22669861 ........................................................E--------.-
cwb_MDP0000875229|PACid:22620206 ........................................................---FDPEIG.-
cwb_MDP0000251344|PACid:22682514 ........................................................TTTHFENFP.V
cwb_MDP0000168919|PACid:22641114 ........................................................---------.-
cwb_MDP0000267855|PACid:22645516 ........................................................GVSGGLLHP.Y
cwb_MDP0000195207|PACid:22668389 ........................................................E--------.-
cwb_MDP0000400145|PACid:22662498 ........................................................V--------.-
cwb_MDP0000919183|PACid:22661837 ........................................................ASTCVGTLE.F
cwb_MDP0000307336|PACid:22681275 ........................................................SV-------.-
cwb_MDP0000263146|PACid:22654671 ........................................................KRITAFA--.-
cwb_MDP0000309730|PACid:22638555 ........................................................GVSGGLLHP.Y
cwb_MDP0000163903|PACid:22648802 ........................................................---------.-
cwb_MDP0000611628|PACid:22643604 ........................................................GKFGLPSNT.X
cwb_MDP0000119779|PACid:22649695 ........................................................---------.-
cwb_MDP0000120904|PACid:22629470 ........................................................---------.-
cwb_MDP0000150544|PACid:22634453 ........................................................TEELVPGFK.F
cwb_MDP0000902209|PACid:22678199 ........................................................GVSGGLLHP.Y
cwb_MDP0000269370|PACid:22680893 ........................................................---------.-
cwb_MDP0000146158|PACid:22623090 ........................................................LASTCVGTLeF
cwb_MDP0000124051|PACid:22654473 ........................................................VEYRNAFKP.K
cwb_MDP0000255696|PACid:22677008 ........................................................LEAGDHILN.M
cwb_MDP0000305861|PACid:22662391 ........................................................--------N.M
cwb_MDP0000611628|PACid:22643604 ........................................................ASTCVGTLE.F
cwb_MDP0000309622|PACid:22670269 ........................................................FNPDVVGVS.F
cwb_MDP0000239909|PACid:22648375 ........................................................---------.-
cwb_MDP0000126888|PACid:22675379 ........................................................WQPCNPAVG.G
cwb_MDP0000869086|PACid:22644121 ........................................................---------.-
cwb_MDP0000317524|PACid:22631851 ........................................................VKKGRDMRR.F
cwb_MDP0000160099|PACid:22658087 ........................................................---------.-
cwb_MDP0000251205|PACid:22649529 ........................................................---------.-
cwb_MDP0000314335|PACid:22679828 ........................................................---------.-
cwb_MDP0000638870|PACid:22646063 ........................................................YTXDIAGRS.F
cwb_MDP0000790657|PACid:22654829 ........................................................---------.-
cwb_MDP0000748068|PACid:22649054 ........................................................---------.-
cwb_MDP0000727481|PACid:22682921 ........................................................---------.-
cwb_MDP0000301246|PACid:22669391 ........................................................---------.-
cwb_MDP0000190684|PACid:22677586 ........................................................---------.-
cwb_MDP0000456223|PACid:22643829 ........................................................S--------.-
cwb_MDP0000745172|PACid:22667211 ........................................................LSGHL----.-
cwb_MDP0000407932|PACid:22626437 ........................................................---------.-
cwb_MDP0000440896|PACid:22680420 ........................................................---------.-
cwb_MDP0000694227|PACid:22673619 ........................................................---------.-
cwb_MDP0000123987|PACid:22662898 ........................................................---------.-
cwb_MDP0000138005|PACid:22620884 ........................................................NLNCHCLFL.V
cwb_MDP0000258205|PACid:22638470 ........................................................KYLDRPYGR.V
cwb_MDP0000245245|PACid:22671727 ........................................................---------.-
cwb_MDP0000306704|PACid:22680179 ........................................................---------.-
cwb_MDP0000478654|PACid:22674637 ........................................................TVNXSGHIF.E
cwb_MDP0000728219|PACid:22657389 ........................................................---------.-
cwb_MDP0000170414|PACid:22675630 ........................................................---------.-
cwb_MDP0000284363|PACid:22634918 ........................................................IQSGDHILN.M
cwb_MDP0000219560|PACid:22625984 ........................................................---------.-
cwb_MDP0000235930|PACid:22635275 ........................................................GSLRAMVEP.S
cwb_MDP0000755938|PACid:22650525 ........................................................---------.-
cwb_MDP0000138851|PACid:22674897 ........................................................E--------.-
cwb_MDP0000261638|PACid:22646820 ........................................................---------.-
cwb_MDP0000317524|PACid:22631851 ........................................................---------.-
cwb_MDP0000294615|PACid:22655955 ........................................................---------.-
cwb_MDP0000208234|PACid:22624840 ........................................................GPFYMKVKY.G
cwb_MDP0000216129|PACid:22668259 ........................................................---------.-
cwb_MDP0000219521|PACid:22657613 ........................................................---------.-
cwb_MDP0000248995|PACid:22642703 ........................................................---------.-
cwb_MDP0000256328|PACid:22629063 ........................................................LASTCVGTLeF
cwb_MDP0000181673|PACid:22646891 ........................................................---------.-
cwb_MDP0000169201|PACid:22625917 ........................................................---------.-
cwb_MDP0000263530|PACid:22651991 ........................................................F--------.-
cwb_MDP0000295839|PACid:22658517 ........................................................FLGMVLAKY.L
cwb_MDP0000297466|PACid:22645872 ........................................................QYMLHEELL.R
cwb_MDP0000281982|PACid:22629373 ........................................................---------.-
cwb_MDP0000053966|PACid:22620929 ........................................................---------.-
cwb_MDP0000795740|PACid:22666880 ........................................................---------.-
cwb_MDP0000212327|PACid:22630830 ........................................................FHPDVAGRS.F
cwb_MDP0000437365|PACid:22632357 ........................................................---------.-
cwb_MDP0000135231|PACid:22629791 ........................................................GQGYIWMGH.K
cwb_MDP0000167343|PACid:22638473 ........................................................---------.-
cwb_MDP0000222306|PACid:22645946 ........................................................---------.-
cwb_MDP0000183517|PACid:22634175 ........................................................-VHFINNRS.M
cwb_MDP0000686821|PACid:22637777 ........................................................L--------.-
cwb_MDP0000430157|PACid:22655785 ........................................................---------.-
cwb_MDP0000373054|PACid:22683333 ........................................................YASDIVRRS.F
cwb_MDP0000295306|PACid:22673308 ........................................................---------.-
cwb_MDP0000233995|PACid:22662680 ........................................................HFGMVLLKF.I
cwb_MDP0000209681|PACid:22642739 ........................................................HFGMVLLKF.I
cwb_MDP0000876898|PACid:22679933 ........................................................---------.-
cwb_MDP0000738522|PACid:22680891 ........................................................------W--.-
cwb_MDP0000399642|PACid:22674547 ........................................................---------.-
cwb_MDP0000215521|PACid:22667208 ........................................................---------.-
cwb_MDP0000170521|PACid:22675770 ........................................................-------Y-.-
cwb_MDP0000262982|PACid:22620906 ........................................................L--------.-
cwb_MDP0000321186|PACid:22667177 ........................................................-SGVAPDH-.-
cwb_MDP0000266051|PACid:22641431 ........................................................---------.-
cwb_MDP0000837610|PACid:22643529 ........................................................---------.-
cwb_MDP0000582079|PACid:22634000 ........................................................HFGMVSLKF.L
cwb_MDP0000538071|PACid:22663035 ........................................................---------.-
cwb_MDP0000241703|PACid:22642424 ........................................................---------.-
cwb_MDP0000671114|PACid:22638724 ........................................................L--------.-
cwb_MDP0000315388|PACid:22681954 ........................................................---------.-
cwb_MDP0000134271|PACid:22620865 ........................................................HCSYNSTKL.Q
cwb_MDP0000297581|PACid:22646099 ........................................................---------.-
cwb_MDP0000911003|PACid:22677366 ........................................................WVEDILNLG.V
cwb_MDP0000576650|PACid:22634720 ........................................................---------.-
cwb_MDP0000149205|PACid:22670334 ........................................................---------.-
cwb_MDP0000315409|PACid:22681973 ........................................................---------.-
cwb_MDP0000320804|PACid:22671446 ........................................................---------.-
cwb_MDP0000474647|PACid:22667377 ........................................................---------.-
cwb_MDP0000566648|PACid:22666666 ........................................................---------.-
cwb_MDP0000171379|PACid:22629613 ........................................................---------.-
cwb_MDP0000814529|PACid:22673539 ........................................................---------.-
cwb_MDP0000218295|PACid:22671514 ........................................................---------.-
cwb_MDP0000220943|PACid:22675739 ........................................................W--------.-
cwb_MDP0000795437|PACid:22664825 ........................................................---------.-
cwb_MDP0000919706|PACid:22656631 ........................................................---------.-
cwb_MDP0000295675|PACid:22626457 ........................................................---------.-
cwb_MDP0000147542|PACid:22652542 ........................................................---------.-
cwb_MDP0000272126|PACid:22655119 ........................................................G--------.-
cwb_MDP0000196881|PACid:22654963 ........................................................---------.-
cwb_MDP0000268346|PACid:22678394 ........................................................---------.-
cwb_MDP0000147542|PACid:22652542 ........................................................H--------.-
cwb_MDP0000948298|PACid:22676144 ........................................................---------.-
cwb_MDP0000220943|PACid:22675739 ........................................................---------.-
cwb_MDP0000182589|PACid:22648509 ........................................................---------.-
cwb_MDP0000557870|PACid:22631128 ........................................................---------.-
cwb_MDP0000308870|PACid:22652882 ........................................................---------.-
cwb_MDP0000322449|PACid:22657441 ........................................................---------.-
cwb_MDP0000286494|PACid:22671310 ........................................................---------.-
cwb_MDP0000150868|PACid:22621264 ........................................................---------.-
cwb_MDP0000155608|PACid:22665289 ........................................................---------.-
cwb_MDP0000168505|PACid:22672316 ........................................................---------.-
cwb_MDP0000196888|PACid:22670849 ........................................................---------.-
cwb_MDP0000154812|PACid:22632894 ........................................................---------.-
cwb_MDP0000186080|PACid:22622639 ........................................................---------.-
cwb_MDP0000220012|PACid:22626541 ........................................................---------.-
cwb_MDP0000169409|PACid:22673915 ........................................................G--------.-
cwb_MDP0000373095|PACid:22661923 ........................................................---------.-
cwb_MDP0000235846|PACid:22627807 ........................................................G--------.-
cwb_MDP0000207126|PACid:22623152 ........................................................---------.-
cwb_MDP0000268357|PACid:22630891 ........................................................---------.-
cwb_MDP0000149067|PACid:22669209 ........................................................---------.-


                                           60                                                       
                                            |                                                       
d1xdia1                          I.....ASTGLR.......................................................
cwb_MDP0000813172|PACid:22649115 T.....GHALLH.......................................................
cwb_MDP0000251581|PACid:22621152 T.....GHALLH.......................................................
cwb_MDP0000188391|PACid:22626210 T.....GHALLH.......................................................
cwb_MDP0000254144|PACid:22644986 -.....-----Dqddpyemggdhcflaggng....................................
cwb_MDP0000321972|PACid:22643109 G.....HGLMVQ.......................................................
cwb_MDP0000299806|PACid:22682346 -.....-----Mggdhcfipggne...........................................
cwb_MDP0000283451|PACid:22680462 -.....-----Mggdhcfipggne...........................................
cwb_MDP0000296714|PACid:22644308 G.....AHCMIKg......................................................
cwb_MDP0000162193|PACid:22629958 G.....AHCMIKg......................................................
cwb_MDP0000769741|PACid:22637873 -.....-----Eellpgghglmvr...........................................
cwb_MDP0000295277|PACid:22625688 L.....HSSHMYyeakhafshhgvkfsdveidlpammsqkdkavsnltr..................
cwb_MDP0000897124|PACid:22647159 L.....HSSHMFheakhafshhgvkfsnveidlpammsqkdkavsnltr..................
cwb_MDP0000854208|PACid:22682207 T.....GREIER.......................................................
cwb_MDP0000241767|PACid:22665328 A.....HC---Xikg....................................................
cwb_MDP0000318858|PACid:22682838 D.....KVEIVQ.......................................................
cwb_MDP0000248995|PACid:22642703 -.....-----Qggspyiyplyglgelpq......................................
cwb_MDP0000442206|PACid:22660061 D.....KKEIVQ.......................................................
cwb_MDP0000181673|PACid:22646891 -.....-----Qggspyiyplyglgelpq......................................
cwb_MDP0000315409|PACid:22681973 -.....-----Qggspyiyplyglgelpq......................................
cwb_MDP0000053966|PACid:22620929 -.....-----Qggspyiyplyglgelpq......................................
cwb_MDP0000294615|PACid:22655955 -.....-----Qggspyiyplyglgelpq......................................
cwb_MDP0000306147|PACid:22679041 A.....HC---Xikg....................................................
cwb_MDP0000180064|PACid:22628138 G.....VGGIAK.......................................................
cwb_MDP0000261625|PACid:22630921 -.....-----Shvtfygxixif............................................
cwb_MDP0000300208|PACid:22651331 V.....YGASFGgeiedarnygwevnekvdfnwkkllqkktdeivrlng..................
cwb_MDP0000247171|PACid:22623108 A.....LDALGVsqhltslyapikkgyvtdidtgeiqevsfaasngndpvxprsvnrkallk.....
cwb_MDP0000308095|PACid:22667065 -.....-----Sdwflskggtrmsiqrmwdpvayalgfidcdnisarcmltiftlfatkteasllrm
cwb_MDP0000319421|PACid:22624123 -.....-----Vasllrqtsfpilsgqlislgsgeiexmdvgkeelrvlkrt...............
cwb_MDP0000232295|PACid:22657598 -.....-----Fsfleagvfpyngfsxdhiegtkigasvfdeqgrrhtsa.................
cwb_MDP0000188994|PACid:22643055 -.....-----Akgkngdhevrrvkrr........................................
cwb_MDP0000159189|PACid:22672554 -.....-----Akgkngdhevrrvkrr........................................
cwb_MDP0000656178|PACid:22657871 L.....AVSGRMrelqnehhlkalglqvsaagydrqgvadhannlatkirn................
cwb_MDP0000910523|PACid:22620639 H.....RKALLK.......................................................
cwb_MDP0000119941|PACid:22643547 L.....FSLLLAptvpylparallhsshmyyeakhafshhgvkfsdveidlpammsqkdkavsnltr
cwb_MDP0000231799|PACid:22673471 L.....AVSGRMrelqnehhlkalglqvsaagydrqgvadhannlatkirn................
cwb_MDP0000255025|PACid:22624807 -.....-----Lalspvvkalvnpdgalqdvrnldsisfsdwflskggtrmsiqrmwdpvayalgfi
cwb_MDP0000231632|PACid:22622264 G.....MQTLTD.......................................................
cwb_MDP0000173300|PACid:22648712 -.....-----Kikffggseylsamdtvcxrigvtencveegfqnqvlrkgcenlglgvdfvprnss
cwb_MDP0000158474|PACid:22655457 -.....-----Vggtiydrfgrrhtsa........................................
cwb_MDP0000276878|PACid:22649644 R.....SHCYVK.......................................................
cwb_MDP0000154720|PACid:22639222 Q.....KTIYPS.......................................................
cwb_MDP0000549646|PACid:22624756 V.....RKPAHLflnelgidydeqdnyvvikhaalftst............................
cwb_MDP0000158853|PACid:22672016 -.....------.......................................................
cwb_MDP0000702799|PACid:22650781 -.....------.......................................................
cwb_MDP0000233110|PACid:22669060 -.....-----Ycgfcnygcptgdkkgtds.....................................
cwb_MDP0000260827|PACid:22621315 H.....NGRFIQ.......................................................
cwb_MDP0000941459|PACid:22654340 -.....------.......................................................
cwb_MDP0000185338|PACid:22637072 -.....-----Dhvvgtkiggstfdtlgrrhsaa.................................
cwb_MDP0000451172|PACid:22678939 V.....GGSIFDadghrhtaa..............................................
cwb_MDP0000136847|PACid:22626492 -.....------.......................................................
cwb_MDP0000177641|PACid:22624304 -.....-----Sldhixgtkigattfdeqgrrhtsa...............................
cwb_MDP0000413935|PACid:22663920 H.....NGRFIQ.......................................................
cwb_MDP0000206098|PACid:22637273 L.....TDRHVDrmqqvvrkpahlflnelgidydeqdnyvvikhaalftst................
cwb_MDP0000845788|PACid:22673064 FpegitGPDLME.......................................................
cwb_MDP0000465595|PACid:22654474 -.....-----Pwqyaaefsfleagvfpyngfsldhikgtkvgasvfdeqgrrqtsa..........
cwb_MDP0000137211|PACid:22645789 -.....------.......................................................
cwb_MDP0000130099|PACid:22624356 -.....------.......................................................
cwb_MDP0000425135|PACid:22674685 -.....-----Rtwqsavrdglleagvdpyngfdlehavgtkiggstfdtsgrrhsaa.........
cwb_MDP0000200780|PACid:22660656 -.....--TLFK.......................................................
cwb_MDP0000142434|PACid:22683351 K.....RSD---.......................................................
cwb_MDP0000248951|PACid:22626490 -.....------.......................................................
cwb_MDP0000869086|PACid:22644121 G.....HRELLL.......................................................
cwb_MDP0000318256|PACid:22681338 W.....QSVVKD.......................................................
cwb_MDP0000231634|PACid:22622267 G.....MQTLTD.......................................................
cwb_MDP0000626995|PACid:22630905 V.....RKPAHLflnelgidydeqdnyvvikhaalftst............................
cwb_MDP0000123832|PACid:22633934 A.....LDALGVsqhltslyapikkgyvtdidtgeiqevsfaasngndpvxprsvnrkallk.....
cwb_MDP0000236092|PACid:22632501 V.....RKPAHLflnelgidydeqdnyvvikhaalftst............................
cwb_MDP0000199159|PACid:22674497 P.....GHTELLl......................................................
cwb_MDP0000162755|PACid:22662459 -.....-----Sfdakgkhgdhevrcvkrn.....................................
cwb_MDP0000173666|PACid:22649255 G.....MQTLTD.......................................................
cwb_MDP0000262982|PACid:22620906 T.....KRQFID.......................................................
cwb_MDP0000184832|PACid:22636281 E.....LSLLEA.......................................................
cwb_MDP0000598927|PACid:22655979 T.....GREIER.......................................................
cwb_MDP0000561228|PACid:22637769 -.....------.......................................................
cwb_MDP0000175650|PACid:22652650 -.....-----Vspvsvahfsqyklislllkqlenlsfkfctsdgle....................
cwb_MDP0000233802|PACid:22672706 G.....YD-LMD.......................................................
cwb_MDP0000321186|PACid:22667177 -.....------.......................................................
cwb_MDP0000161955|PACid:22660959 H.....NGRFIQ.......................................................
cwb_MDP0000213381|PACid:22663844 H.....NGRFIQ.......................................................
cwb_MDP0000168437|PACid:22624648 H.....HGRFIQ.......................................................
cwb_MDP0000823251|PACid:22668430 G.....YD-LMD.......................................................
cwb_MDP0000191389|PACid:22631180 H.....NGRFIQ.......................................................
cwb_MDP0000199319|PACid:22658752 H.....NGRFIQ.......................................................
cwb_MDP0000857446|PACid:22649571 H.....NGRFIQ.......................................................
cwb_MDP0000266638|PACid:22658651 H.....NGRFIQ.......................................................
cwb_MDP0000208936|PACid:22641581 -.....-----Rkgcenlglkgtrkgtds......................................
cwb_MDP0000202883|PACid:22663993 H.....NGRFIQ.......................................................
cwb_MDP0000288439|PACid:22643642 -.....-----Lsfleagifpyngfsldhiegtkigattfdeqgrrhtsa.................
cwb_MDP0000295839|PACid:22658517 S.....KNEFVQ.......................................................
cwb_MDP0000903805|PACid:22678063 W.....QSVVKD.......................................................
cwb_MDP0000202123|PACid:22678734 V.....YASKFAhefeesngfgwryeiepkhdwstlianknaelkrltg..................
cwb_MDP0000227773|PACid:22639029 P.....GHTELLl......................................................
cwb_MDP0000317524|PACid:22631851 P.....GHTELLl......................................................
cwb_MDP0000320748|PACid:22658808 H.....NGRFIQ.......................................................
cwb_MDP0000634676|PACid:22625957 H.....NGRFIQ.......................................................
cwb_MDP0000235846|PACid:22627807 -.....GFELMD.......................................................
cwb_MDP0000251344|PACid:22682514 -.....GFELMD.......................................................
cwb_MDP0000501957|PACid:22671723 H.....NGRFIQ.......................................................
cwb_MDP0000209681|PACid:22642739 I.....PKDMFV.......................................................
cwb_MDP0000293482|PACid:22637734 -.....--ADLH.......................................................
cwb_MDP0000233995|PACid:22662680 I.....PKDMFV.......................................................
cwb_MDP0000257243|PACid:22657003 -.....------.......................................................
cwb_MDP0000160099|PACid:22658087 P.....GHTELLl......................................................
cwb_MDP0000193196|PACid:22649572 H.....NGRFIQ.......................................................
cwb_MDP0000208234|PACid:22624840 P.....KHQFIQ.......................................................
cwb_MDP0000251783|PACid:22654795 R.....RHG-AV.......................................................
cwb_MDP0000686885|PACid:22670382 -.....-----Gvvtehggvikptkavs.......................................
cwb_MDP0000138851|PACid:22674897 P.....KNQFIR.......................................................
cwb_MDP0000194930|PACid:22667971 -.....-----Vefxdlllspaskvlnnwfesdvlkatlamdsvigttgsvhtpgsgyvllhhvmge
cwb_MDP0000169201|PACid:22625917 S.....QHQVLD.......................................................
cwb_MDP0000399642|PACid:22674547 S.....QHQVLD.......................................................
cwb_MDP0000582079|PACid:22634000 I.....PKDMFV.......................................................
cwb_MDP0000129765|PACid:22673448 D.....LHALLY.......................................................
cwb_MDP0000272655|PACid:22672104 W.....QSVVKD.......................................................
cwb_MDP0000686821|PACid:22637777 V.....PKNLFV.......................................................
cwb_MDP0000170414|PACid:22675630 S.....QHQVLD.......................................................
cwb_MDP0000320804|PACid:22671446 D.....QNQVLN.......................................................
cwb_MDP0000189790|PACid:22676146 H.....HGRFIQ.......................................................
cwb_MDP0000847111|PACid:22682055 P.....KDMFVQ.......................................................
cwb_MDP0000289536|PACid:22677728 -.....-----Vvtehggvikptkavs........................................
cwb_MDP0000123987|PACid:22662898 S.....QHQVLD.......................................................
cwb_MDP0000245245|PACid:22671727 S.....QHQVLD.......................................................
cwb_MDP0000188553|PACid:22658192 T.....ITSEVV.......................................................
cwb_MDP0000296599|PACid:22628159 V.....HPYLFT.......................................................
cwb_MDP0000746652|PACid:22636428 N.....ATKLSY.......................................................
cwb_MDP0000259265|PACid:22650727 S.....KYDFIA.......................................................
cwb_MDP0000151331|PACid:22656760 G.....TRFTGD.......................................................
cwb_MDP0000309775|PACid:22670556 R.....LVPLLR.......................................................
cwb_MDP0000232736|PACid:22657363 -.....------.......................................................
cwb_MDP0000320539|PACid:22651795 C.....VGANEE.......................................................
cwb_MDP0000239909|PACid:22648375 G.....HKEVLM.......................................................
cwb_MDP0000259264|PACid:22650726 S.....KYDFIA.......................................................
cwb_MDP0000293613|PACid:22654008 N.....DARLNV.......................................................
cwb_MDP0000253362|PACid:22653297 N.....DARLNV.......................................................
cwb_MDP0000182973|PACid:22649063 L.....SPLIPI.......................................................
cwb_MDP0000138005|PACid:22620884 -.....-----Hgvcnen.................................................
cwb_MDP0000261301|PACid:22674262 -.....------.......................................................
cwb_MDP0000771633|PACid:22649768 L.....RREVLD.......................................................
cwb_MDP0000851102|PACid:22674240 L.....RREVLD.......................................................
cwb_MDP0000159873|PACid:22673571 V.....RREVLD.......................................................
cwb_MDP0000140206|PACid:22652348 C.....VGSGGE.......................................................
cwb_MDP0000261201|PACid:22657417 V.....RREVLD.......................................................
cwb_MDP0000252244|PACid:22643267 V.....RREVLD.......................................................
cwb_MDP0000261821|PACid:22664612 C.....VGSGGE.......................................................
cwb_MDP0000124454|PACid:22663639 -.....------.......................................................
cwb_MDP0000234830|PACid:22664319 N.....DARLNV.......................................................
cwb_MDP0000297861|PACid:22646554 H.....NGRFIQ.......................................................
cwb_MDP0000152184|PACid:22632666 C.....VGANEE.......................................................
cwb_MDP0000157871|PACid:22670351 C.....VGSGGE.......................................................
cwb_MDP0000250932|PACid:22662666 P.....AKSQLVhevdalggeigkisdrcylqkrvlnasrgpavralraqtdkxeyamemrkiverq
cwb_MDP0000219521|PACid:22657613 P.....SHLEIL.......................................................
cwb_MDP0000239289|PACid:22649630 H.....NGRFIQ.......................................................
cwb_MDP0000258995|PACid:22632347 -.....------.......................................................
cwb_MDP0000167343|PACid:22638473 P.....SYLEIL.......................................................
cwb_MDP0000222306|PACid:22645946 P.....SYLEIL.......................................................
cwb_MDP0000829384|PACid:22650105 -.....------.......................................................
cwb_MDP0000145663|PACid:22632174 S.....RKKLKT.......................................................
cwb_MDP0000288439|PACid:22643642 -.....-----Gtkigatiydeqgrrhxsa.....................................
cwb_MDP0000267350|PACid:22676208 -.....------.......................................................
cwb_MDP0000155608|PACid:22665289 -.....------.......................................................
cwb_MDP0000194622|PACid:22683388 N.....RKQLKS.......................................................
cwb_MDP0000134271|PACid:22620865 T.....PRCDFEfsnypwaerdnssfpshvevle.................................
cwb_MDP0000312748|PACid:22644976 S.....RCSYLQ.......................................................
cwb_MDP0000197715|PACid:22640206 -.....-----Kfcwgreylsamdtvcerigvtencieegfqnqvlrkgcenlgfevdivprnssek
cwb_MDP0000220943|PACid:22675739 -.....-----Verdnssfpshvevle........................................
cwb_MDP0000320539|PACid:22651795 F.....TPKIAS.......................................................
cwb_MDP0000140206|PACid:22652348 F.....TKEIAA.......................................................
cwb_MDP0000215521|PACid:22667208 -.....-----Aerdnssfpshvevle........................................
cwb_MDP0000203847|PACid:22681509 -.....-----Ayiheftrtsmagkirrfkggyt.................................
cwb_MDP0000201011|PACid:22661057 -.....-----Yayiheftrtsmagkirrfnggyt................................
cwb_MDP0000204596|PACid:22635084 -.....------.......................................................
cwb_MDP0000148978|PACid:22620687 P.....PERLCA.......................................................
cwb_MDP0000130369|PACid:22663416 S.....RERIFK.......................................................
cwb_MDP0000314606|PACid:22664349 N.....DARLNV.......................................................
cwb_MDP0000263146|PACid:22654671 E.....ARSIVE.......................................................
cwb_MDP0000250583|PACid:22633065 D.....AWEIAP.......................................................
cwb_MDP0000208233|PACid:22624841 P.....KNQFXQ.......................................................
cwb_MDP0000158720|PACid:22655873 S.....SSTIID.......................................................
cwb_MDP0000152184|PACid:22632666 F.....TPKIAS.......................................................
cwb_MDP0000182702|PACid:22680484 G.....VGGIXK.......................................................
cwb_MDP0000261638|PACid:22646820 A.....NGG---.......................................................
cwb_MDP0000130370|PACid:22654204 S.....RERIFK.......................................................
cwb_MDP0000272119|PACid:22671033 -.....------.......................................................
cwb_MDP0000305861|PACid:22662391 E.....ARSIVE.......................................................
cwb_MDP0000255696|PACid:22677008 E.....ARSIVE.......................................................
cwb_MDP0000214280|PACid:22681133 G.....TRFTGD.......................................................
cwb_MDP0000210966|PACid:22644665 -.....-----Gtkvggtifdleghrhtaa.....................................
cwb_MDP0000610999|PACid:22659782 -.....------.......................................................
cwb_MDP0000242546|PACid:22662348 -.....------.......................................................
cwb_MDP0000320742|PACid:22645070 S.....LSELVR.......................................................
cwb_MDP0000654164|PACid:22658363 L.....HSSHMY.......................................................
cwb_MDP0000256300|PACid:22644503 -.....------.......................................................
cwb_MDP0000235080|PACid:22654616 V.....GMPGMN.......................................................
cwb_MDP0000284363|PACid:22634918 E.....ARSIVE.......................................................
cwb_MDP0000125043|PACid:22648273 -.....------.......................................................
cwb_MDP0000192359|PACid:22632529 -.....------.......................................................
cwb_MDP0000440005|PACid:22623062 F.....GERSII.......................................................
cwb_MDP0000609131|PACid:22633588 -.....-----Lkwaglynlttatlaveladaglsplliqelvtvitrinygqsvsmsglagavsla
cwb_MDP0000362000|PACid:22628256 Frsv..AEP-IA.......................................................
cwb_MDP0000150210|PACid:22663655 S.....RCSYLQ.......................................................
cwb_MDP0000158790|PACid:22624362 C.....RDMLHE.......................................................
cwb_MDP0000427950|PACid:22623610 -.....------.......................................................
cwb_MDP0000569169|PACid:22666591 -.....------.......................................................
cwb_MDP0000525742|PACid:22647174 FpegitGPDLME.......................................................
cwb_MDP0000559829|PACid:22672870 N.....NRRFIQ.......................................................
cwb_MDP0000321788|PACid:22641842 G.....VGGIXK.......................................................
cwb_MDP0000919183|PACid:22661837 -.....FDVGLR.......................................................
cwb_MDP0000146158|PACid:22623090 -.....-DXGLR.......................................................
cwb_MDP0000832077|PACid:22645850 T.....PRCDFEfsdypwverdnssfpshvevle.................................
cwb_MDP0000621365|PACid:22669861 -.....------.......................................................
cwb_MDP0000875229|PACid:22620206 -.....------.......................................................
cwb_MDP0000251344|PACid:22682514 F.....PQTILM.......................................................
cwb_MDP0000168919|PACid:22641114 -.....------.......................................................
cwb_MDP0000267855|PACid:22645516 S.....PKAKLL.......................................................
cwb_MDP0000195207|PACid:22668389 -.....------.......................................................
cwb_MDP0000400145|PACid:22662498 -.....------.......................................................
cwb_MDP0000919183|PACid:22661837 R.....SVAEPV.......................................................
cwb_MDP0000307336|PACid:22681275 -.....------.......................................................
cwb_MDP0000263146|PACid:22654671 -.....------.......................................................
cwb_MDP0000309730|PACid:22638555 S.....PKAKLL.......................................................
cwb_MDP0000163903|PACid:22648802 -.....-LKASQ.......................................................
cwb_MDP0000611628|PACid:22643604 X.....YFLLIL.......................................................
cwb_MDP0000119779|PACid:22649695 -.....-LKASQ.......................................................
cwb_MDP0000120904|PACid:22629470 -.....------.......................................................
cwb_MDP0000150544|PACid:22634453 S.....RCSYXQ.......................................................
cwb_MDP0000902209|PACid:22678199 S.....PKAKLL.......................................................
cwb_MDP0000269370|PACid:22680893 -.....------.......................................................
cwb_MDP0000146158|PACid:22623090 R.....SVAEPVs......................................................
cwb_MDP0000124051|PACid:22654473 L.....TPWLYV.......................................................
cwb_MDP0000255696|PACid:22677008 F.....DKRITA.......................................................
cwb_MDP0000305861|PACid:22662391 F.....DKRITS.......................................................
cwb_MDP0000611628|PACid:22643604 R.....SVAEPVs......................................................
cwb_MDP0000309622|PACid:22670269 H.....HGR---.......................................................
cwb_MDP0000239909|PACid:22648375 -.....------.......................................................
cwb_MDP0000126888|PACid:22675379 P.....AKSQLV.......................................................
cwb_MDP0000869086|PACid:22644121 -.....------.......................................................
cwb_MDP0000317524|PACid:22631851 P.....GHTELLl......................................................
cwb_MDP0000160099|PACid:22658087 -.....------.......................................................
cwb_MDP0000251205|PACid:22649529 -.....------.......................................................
cwb_MDP0000314335|PACid:22679828 -.....------.......................................................
cwb_MDP0000638870|PACid:22646063 H.....------.......................................................
cwb_MDP0000790657|PACid:22654829 -.....------.......................................................
cwb_MDP0000748068|PACid:22649054 -.....-----E.......................................................
cwb_MDP0000727481|PACid:22682921 -.....-----E.......................................................
cwb_MDP0000301246|PACid:22669391 -.....------.......................................................
cwb_MDP0000190684|PACid:22677586 -.....------.......................................................
cwb_MDP0000456223|PACid:22643829 -.....------.......................................................
cwb_MDP0000745172|PACid:22667211 -.....------.......................................................
cwb_MDP0000407932|PACid:22626437 -.....------.......................................................
cwb_MDP0000440896|PACid:22680420 -.....------.......................................................
cwb_MDP0000694227|PACid:22673619 -.....------.......................................................
cwb_MDP0000123987|PACid:22662898 -.....------.......................................................
cwb_MDP0000138005|PACid:22620884 T.....ITSEVV.......................................................
cwb_MDP0000258205|PACid:22638470 S.....RKKLKT.......................................................
cwb_MDP0000245245|PACid:22671727 -.....------.......................................................
cwb_MDP0000306704|PACid:22680179 -.....------.......................................................
cwb_MDP0000478654|PACid:22674637 A.....GASI--.......................................................
cwb_MDP0000728219|PACid:22657389 -.....------.......................................................
cwb_MDP0000170414|PACid:22675630 -.....------.......................................................
cwb_MDP0000284363|PACid:22634918 F.....DDRIST.......................................................
cwb_MDP0000219560|PACid:22625984 -.....------.......................................................
cwb_MDP0000235930|PACid:22635275 F.....AK---R.......................................................
cwb_MDP0000755938|PACid:22650525 -.....------.......................................................
cwb_MDP0000138851|PACid:22674897 -.....-----Rpqkgpiymkakygkypiidv...................................
cwb_MDP0000261638|PACid:22646820 -.....------.......................................................
cwb_MDP0000317524|PACid:22631851 -.....------.......................................................
cwb_MDP0000294615|PACid:22655955 -.....------.......................................................
cwb_MDP0000208234|PACid:22624840 K.....YPAIDV.......................................................
cwb_MDP0000216129|PACid:22668259 -.....------.......................................................
cwb_MDP0000219521|PACid:22657613 -.....------.......................................................
cwb_MDP0000248995|PACid:22642703 -.....------.......................................................
cwb_MDP0000256328|PACid:22629063 R.....SVAEPVs......................................................
cwb_MDP0000181673|PACid:22646891 -.....------.......................................................
cwb_MDP0000169201|PACid:22625917 -.....------.......................................................
cwb_MDP0000263530|PACid:22651991 -.....--DHCA.......................................................
cwb_MDP0000295839|PACid:22658517 P.....LKVLDNivvilgklkfgdlskygltrpklgpfflkenegqapiidv...............
cwb_MDP0000297466|PACid:22645872 T.....TFLLVL.......................................................
cwb_MDP0000281982|PACid:22629373 -.....------.......................................................
cwb_MDP0000053966|PACid:22620929 -.....------.......................................................
cwb_MDP0000795740|PACid:22666880 -.....------.......................................................
cwb_MDP0000212327|PACid:22630830 H.....HGXFIQ.......................................................
cwb_MDP0000437365|PACid:22632357 -.....------.......................................................
cwb_MDP0000135231|PACid:22629791 T.....PGSDLW.......................................................
cwb_MDP0000167343|PACid:22638473 -.....------.......................................................
cwb_MDP0000222306|PACid:22645946 -.....------.......................................................
cwb_MDP0000183517|PACid:22634175 E.....VFRKLD.......................................................
cwb_MDP0000686821|PACid:22637777 -.....-----Kygnlskygiqkpkqgpfylkatkgrsptidv........................
cwb_MDP0000430157|PACid:22655785 -.....------.......................................................
cwb_MDP0000373054|PACid:22683333 H.....NGRFIH.......................................................
cwb_MDP0000295306|PACid:22673308 -.....------.......................................................
cwb_MDP0000233995|PACid:22662680 P.....LKMVDKvvvrlgklkygnlskfgirrpkegp..............................
cwb_MDP0000209681|PACid:22642739 P.....LKMVDKvvvrlgklkygnlskfgirrpkegp..............................
cwb_MDP0000876898|PACid:22679933 -.....------.......................................................
cwb_MDP0000738522|PACid:22680891 -.....------.......................................................
cwb_MDP0000399642|PACid:22674547 -.....------.......................................................
cwb_MDP0000215521|PACid:22667208 -.....------.......................................................
cwb_MDP0000170521|PACid:22675770 -.....------.......................................................
cwb_MDP0000262982|PACid:22620906 -.....-----Vlgsiekyglkrpsmgpmemknvegktpvlxi........................
cwb_MDP0000321186|PACid:22667177 -.....------.......................................................
cwb_MDP0000266051|PACid:22641431 -.....------.......................................................
cwb_MDP0000837610|PACid:22643529 -.....------.......................................................
cwb_MDP0000582079|PACid:22634000 P.....LNIVDKavvllgklkygdltkygirkpkegpfflkaakgraptidv...............
cwb_MDP0000538071|PACid:22663035 -.....------.......................................................
cwb_MDP0000241703|PACid:22642424 -.....------.......................................................
cwb_MDP0000671114|PACid:22638724 -.....------.......................................................
cwb_MDP0000315388|PACid:22681954 -.....------.......................................................
cwb_MDP0000134271|PACid:22620865 T.....PRCDFEfsnypwaerdnssfpshvevle.................................
cwb_MDP0000297581|PACid:22646099 -.....------.......................................................
cwb_MDP0000911003|PACid:22677366 S.....PAKLIE.......................................................
cwb_MDP0000576650|PACid:22634720 -.....------.......................................................
cwb_MDP0000149205|PACid:22670334 -.....------.......................................................
cwb_MDP0000315409|PACid:22681973 -.....-----L.......................................................
cwb_MDP0000320804|PACid:22671446 -.....------.......................................................
cwb_MDP0000474647|PACid:22667377 -.....------.......................................................
cwb_MDP0000566648|PACid:22666666 -.....------.......................................................
cwb_MDP0000171379|PACid:22629613 -.....------.......................................................
cwb_MDP0000814529|PACid:22673539 -.....------.......................................................
cwb_MDP0000218295|PACid:22671514 -.....------.......................................................
cwb_MDP0000220943|PACid:22675739 -.....-----Verdnssfpshvevle........................................
cwb_MDP0000795437|PACid:22664825 -.....------.......................................................
cwb_MDP0000919706|PACid:22656631 -.....------.......................................................
cwb_MDP0000295675|PACid:22626457 -.....------.......................................................
cwb_MDP0000147542|PACid:22652542 -.....------.......................................................
cwb_MDP0000272126|PACid:22655119 -.....------.......................................................
cwb_MDP0000196881|PACid:22654963 -.....------.......................................................
cwb_MDP0000268346|PACid:22678394 -.....------.......................................................
cwb_MDP0000147542|PACid:22652542 -.....------.......................................................
cwb_MDP0000948298|PACid:22676144 -.....------.......................................................
cwb_MDP0000220943|PACid:22675739 -.....------.......................................................
cwb_MDP0000182589|PACid:22648509 -.....------.......................................................
cwb_MDP0000557870|PACid:22631128 -.....------.......................................................
cwb_MDP0000308870|PACid:22652882 -.....------.......................................................
cwb_MDP0000322449|PACid:22657441 -.....------.......................................................
cwb_MDP0000286494|PACid:22671310 -.....------.......................................................
cwb_MDP0000150868|PACid:22621264 -.....------.......................................................
cwb_MDP0000155608|PACid:22665289 -.....------.......................................................
cwb_MDP0000168505|PACid:22672316 -.....------.......................................................
cwb_MDP0000196888|PACid:22670849 -.....------.......................................................
cwb_MDP0000154812|PACid:22632894 -.....------.......................................................
cwb_MDP0000186080|PACid:22622639 -.....------.......................................................
cwb_MDP0000220012|PACid:22626541 -.....------.......................................................
cwb_MDP0000169409|PACid:22673915 -.....------.......................................................
cwb_MDP0000373095|PACid:22661923 -.....------.......................................................
cwb_MDP0000235846|PACid:22627807 -.....------.......................................................
cwb_MDP0000207126|PACid:22623152 -.....------.......................................................
cwb_MDP0000268357|PACid:22630891 -.....------.......................................................
cwb_MDP0000149067|PACid:22669209 -.....------.......................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 lkgspdvylsg........................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 gieglfkknkvtyvkgygkfispseisvdtidgenkvvkgkniiiatetcggwsriyrprdglgvgr
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 dcdnisarcmltiftlfatkteasllrmlkgspdvylsg............................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 enhycgscgygcrkgekkgtds.............................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 ...................................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 tdgergiwsfveggmgsvsl...............................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 vnyknglrtxxq.......................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 hycgscgygckkgekkgtds...............................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 gsggglwaikggnw.....................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                       70               80          
                                                                        |                |          
d1xdia1                          ........................TEL....RRAPHL..GF..H..I.DF.DD.AKISLPQI.....
cwb_MDP0000813172|PACid:22649115 ........................TLY....GQAMKH..NT..Q..F.FV.EY.FALDLLMDseggc
cwb_MDP0000251581|PACid:22621152 ........................TLY....GQAMKH..NT..Q..F.FV.EY.FALDLLMDseggc
cwb_MDP0000188391|PACid:22626210 ........................TLY....GQAMKH..NT..Q..F.FV.EY.FALDLLMDseglv
cwb_MDP0000254144|PACid:22644986 ........................RLI....RALCE-..RV..P..I.FY.GK.TVNTIRYG.....
cwb_MDP0000321972|PACid:22643109 ........................GYD....PIIKALakDI..D..V.RL.NH.RVTKXLNG.....
cwb_MDP0000299806|PACid:22682346 ........................TFV....RSLAE-..GL..P..I.FY.ER.TVQSIRYGs....
cwb_MDP0000283451|PACid:22680462 ........................TFV....RSLAE-..GL..P..I.FY.ER.TVQSIRYGs....
cwb_MDP0000296714|PACid:22644308 ........................GYS....TVVESLgeGL..H..I.HL.NH.VVTDISYVtkdag
cwb_MDP0000162193|PACid:22629958 ........................GYS....TVIESLgeGL..Q..I.RL.NH.VVTDVSYGtkdag
cwb_MDP0000769741|PACid:22637873 ........................GYL....PVINTLakGL..D..V.RL.SH.RVKKXTRRyn...
cwb_MDP0000295277|PACid:22625688 ........................GIE....GLFKKN..KV..T..Y.VK.GY.-GKFISPS.....
cwb_MDP0000897124|PACid:22647159 ........................GIE....GLFKKN..KV..T..Y.VK.GY.-GKFISPS.....
cwb_MDP0000854208|PACid:22682207 ........................ALLk...AALKDP..NI..F..M.FE.HH.LAIDLLTCqdgs.
cwb_MDP0000241767|PACid:22665328 ........................GYS....TVVESLgeGL..X..I.HL.NH.VVTDISYXtkdag
cwb_MDP0000318858|PACid:22682838 ........................RRV....NLMTEE..GV..N..F.VV.NA.NIGN----.....
cwb_MDP0000248995|PACid:22642703 ........................AFA....RLSAVY..GG..T..Y.ML.NK.PECKVEFNe....
cwb_MDP0000442206|PACid:22660061 ........................RRV....NLMAEE..GV..N..F.VV.NA.NIGN----.....
cwb_MDP0000181673|PACid:22646891 ........................AFA....RLSAVY..GG..T..Y.ML.NK.PECKVEFNe....
cwb_MDP0000315409|PACid:22681973 ........................AFA....RLSAVY..GG..T..Y.ML.SK.PECKVEFE.....
cwb_MDP0000053966|PACid:22620929 ........................AFA....RLSAVY..GG..T..Y.ML.SK.PECKVEFE.....
cwb_MDP0000294615|PACid:22655955 ........................AFA....RLSAVY..GG..T..Y.ML.SK.PECKVEFE.....
cwb_MDP0000306147|PACid:22679041 ........................GYS....TVVESLgeXL..X..I.HL.NH.VVTDISYXtkdag
cwb_MDP0000180064|PACid:22628138 ........................SLA....KGLVDQ..GS..E..I.LY.KA.NVTNIIVD.....
cwb_MDP0000261625|PACid:22630921 ........................TV-....IHLXED..DS..K..L.DL.GQ.VVRELQHSrn...
cwb_MDP0000300208|PACid:22651331 ........................IYK....RLLSNS..GV..K..F.FE.G-.EGKIVGPN.....
cwb_MDP0000247171|PACid:22623108 ........................TLA....DELPPN..--..S..I.RF.AS.KLTAIETQehe..
cwb_MDP0000308095|PACid:22667065 ........................PIR....DYIIAK..GG..R..F.HL.RW.GCREILYDkssdg
cwb_MDP0000319421|PACid:22624123 ........................DLV....SVLADNlpPN..T..V.RF.GC.EVHSVKLNp....
cwb_MDP0000232295|PACid:22657598 ........................DLL....EAGNPN..HI..T..V.LL.NA.TVTNVIFH.....
cwb_MDP0000188994|PACid:22643055 ........................LLLe...ALADELp.SG..T..I.RF.SS.KVVSIDE-.....
cwb_MDP0000159189|PACid:22672554 ........................LLLe...ALADELp.SG..T..I.RF.SS.KVVSIDE-.....
cwb_MDP0000656178|PACid:22657871 ........................SLT....NSMNSL..GV..D..I.LT.G-.-VGTILGP.....
cwb_MDP0000910523|PACid:22620639 ........................ALA....DELPPN..SI..R..F.AS.KL.TAIEAQEHe....
cwb_MDP0000119941|PACid:22643547 lgsevtvvefgpdivpsmdseirkQFQ....RSLEKQ..GM..K..F.ML.KT.KVVGVDTS.....
cwb_MDP0000231799|PACid:22673471 ........................SLT....NSMNSL..GV..D..I.LT.G-.-VGTILGP.....
cwb_MDP0000255025|PACid:22624807 ........................PIR....DYIIAK..GG..R..F.HL.RW.GCREILYDkssdg
cwb_MDP0000231632|PACid:22622264 ........................TLC....---NELg.KD..E..V.KL.NS.KVLSLSYShdgks
cwb_MDP0000173300|PACid:22648712 ........................TWL....MDAVDY..GA..V..I.IT.GC.KAERFVLEtnksx
cwb_MDP0000158474|PACid:22655457 ........................ELL....SSGNPQ..KL..T..V.LV.YA.TVQKIVFDisgkk
cwb_MDP0000276878|PACid:22649644 ........................KVR....EVLESK..GC..H..I.RT.SS.EVHRVSTSde...
cwb_MDP0000154720|PACid:22639222 ........................RLSt...MTLQPR..NL..S..M.GV.GS.TSSGLNEQ.....
cwb_MDP0000549646|PACid:22624756 ........................IMS....KLLARP..NV..K..L.FN.AV.AAEDLIIK.....
cwb_MDP0000158853|PACid:22672016 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000702799|PACid:22650781 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000233110|PACid:22669060 ........................TWL....VDAVEC..GA..V..I.LT.GC.KAEKFILEsdndg
cwb_MDP0000260827|PACid:22621315 ........................RMR....EKAATLp.NV..R..L.EQ.GT.-VTSLLEE.....
cwb_MDP0000941459|PACid:22654340 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000185338|PACid:22637072 ........................DLL....NYAKPL..NI..K..V.VT.HA.SVERILLAstgps
cwb_MDP0000451172|PACid:22678939 ........................DLL....QYADPR..KI..N..V.YL.NA.RVQKIXFRhipgr
cwb_MDP0000136847|PACid:22626492 ........................---....------..--..-..-.--.--.--TGTIFD.....
cwb_MDP0000177641|PACid:22624304 ........................DLL....TAGNPN..XI..T..L.LL.NA.TVTSIIFHekgsr
cwb_MDP0000413935|PACid:22663920 ........................RMR....EKAATLp.NV..L..L.EQ.GT.-VTSLLEE.....
cwb_MDP0000206098|PACid:22637273 ........................IMS....KLLARP..NV..K..L.FN.AV.AAEDLIIK.....
cwb_MDP0000845788|PACid:22673064 ........................RMR....KQAERW..GA..E..L.YQ.E-.DVESIDVKtr...
cwb_MDP0000465595|PACid:22654474 ........................DLL....EAGNPN..NI..T..V.LL.NA.TVKNVIFH.....
cwb_MDP0000137211|PACid:22645789 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000130099|PACid:22624356 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000425135|PACid:22674685 ........................DLL....KYANPL..NI..K..V.VT.HA.SVERILLAstmps
cwb_MDP0000200780|PACid:22660656 ........................NGW....RVXDAI..GV..G..N.HL.RT.QFLEIQ--.....
cwb_MDP0000142434|PACid:22683351 ........................-LIt...TLAESL..PVg.T..I.RL.GC.QAISVKLD.....
cwb_MDP0000248951|PACid:22626490 ........................---....------..-L..D..H.IQ.GT.KITGTIFD.....
cwb_MDP0000869086|PACid:22644121 ........................YLK....DFCDWF..GL..RelI.RF.NT.RVSYVGMLdgdhv
cwb_MDP0000318256|PACid:22681338 ........................AML....EAGVRPdnGLtlD..H.IL.GS.KVTATLFDdrg..
cwb_MDP0000231634|PACid:22622267 ........................TLC....NQLGK-..-D..E..L.KL.NS.RVLSLSYShdgks
cwb_MDP0000626995|PACid:22630905 ........................IMS....KLLARP..NV..K..L.FN.AV.AAEDLIIK.....
cwb_MDP0000123832|PACid:22633934 ........................TLA....DELPPN..--..S..I.RF.AS.KLTAIETQehe..
cwb_MDP0000236092|PACid:22632501 ........................IMS....KLLARP..NV..K..L.FN.AV.AAEDLIIK.....
cwb_MDP0000199159|PACid:22674497 ........................YLK....DFCDWF..GL..RelI.RF.NT.RVSYVGMLngdhv
cwb_MDP0000162755|PACid:22662459 ........................LLLe...ALANELp.NG..T..I.RF.SS.KVVSIDE-.....
cwb_MDP0000173666|PACid:22649255 ........................TLC....NQLGK-..-D..E..L.KL.NS.XVLSLSYShdgks
cwb_MDP0000262982|PACid:22620906 ........................YLE....SYAKHF..EI..N..P.KF.NX.CVQSARYDetsg.
cwb_MDP0000184832|PACid:22636281 ........................GIF....PYNGNR..NV..T..V.VR.GI.RFIKSDGSssq..
cwb_MDP0000598927|PACid:22655979 ........................ALLe...AVLKDP..KI..F..M.FE.HH.LAIDLL--.....
cwb_MDP0000561228|PACid:22637769 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000175650|PACid:22652650 ........................G-L....NHGTFQ..EK..Q..L.LM.GH.ECVSIKAS.....
cwb_MDP0000233802|PACid:22672706 ........................RCR....KQSIRF..GT..E..V.FT.ET.-VNKVDFSt....
cwb_MDP0000321186|PACid:22667177 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000161955|PACid:22660959 ........................KMR....ERATALk.NV..T..L.EQ.GT.-VTTLIEE.....
cwb_MDP0000213381|PACid:22663844 ........................RMR....ERAATLp.NV..K..L.EQ.GT.-VTTLLEE.....
cwb_MDP0000168437|PACid:22624648 ........................RMR....EKASSLp.NV..R..L.EQ.GT.-VTSLLEE.....
cwb_MDP0000823251|PACid:22668430 ........................RCR....KQSIRF..GT..E..V.FT.ET.-VNKVDFSt....
cwb_MDP0000191389|PACid:22631180 ........................KMR....ERVATLk.NV..T..L.EQ.GT.-VTTLIEE.....
cwb_MDP0000199319|PACid:22658752 ........................RMR....ERAATLp.NV..K..L.EQ.GT.-VTTLLEE.....
cwb_MDP0000857446|PACid:22649571 ........................RMR....ERAATLs.NV..K..L.EQ.GT.-VTTLIEE.....
cwb_MDP0000266638|PACid:22658651 ........................RMR....ERAXTLp.NV..K..L.XQ.GT.-VTTLLEE.....
cwb_MDP0000208936|PACid:22641581 ........................TWL....VDAVKF..GA..V..I.LT.GC.KAEKFILEndneg
cwb_MDP0000202883|PACid:22663993 ........................KLR....ERVATLk.NV..T..L.EQ.GT.-VTTLIEE.....
cwb_MDP0000288439|PACid:22643642 ........................DLL....TAGNPN..XI..T..L.LL.NA.TVTSIIFHekgsr
cwb_MDP0000295839|PACid:22658517 ........................YLE....AYVSHF..KI..T..P.RY.DR.VVETASYV.....
cwb_MDP0000903805|PACid:22678063 ........................AMVeagvRPDNGL..TV..D..H.IL.GS.KVTATLFDdrg..
cwb_MDP0000202123|PACid:22678734 ........................IYK....NVLSNA..NV..T..L.IE.G-.RGKIVDPH.....
cwb_MDP0000227773|PACid:22639029 ........................YLK....DFCDWF..GL..RelI.RF.NT.RVSYVGMLdgdhv
cwb_MDP0000317524|PACid:22631851 ........................YLK....DFCDWF..GL..RelI.RF.NT.RVSYVGMLdgdha
cwb_MDP0000320748|PACid:22658808 ........................RMR....ERAAALp.NV..K..L.EQ.GT.-VTTLLEE.....
cwb_MDP0000634676|PACid:22625957 ........................RMR....ERAATLs.NV..K..M.EQ.GT.-VTTLIEE.....
cwb_MDP0000235846|PACid:22627807 ........................RCR....KQSIRF..GT..A..V.FT.ET.-VNKVDFStt...
cwb_MDP0000251344|PACid:22682514 ........................RCR....KQSIRF..GT..A..V.FT.ET.-VNKVDFStt...
cwb_MDP0000501957|PACid:22671723 ........................RMR....GRASTLs.NV..K..L.EQ.GT.-VTXLIEE.....
cwb_MDP0000209681|PACid:22642739 ........................QYLd...NYVSQF..KI..N..P.KC.NR.SVKSAFFDanvek
cwb_MDP0000293482|PACid:22637734 ........................ALL....YNALPP..NL..-..F.LW.GH.HFLSFSISs....
cwb_MDP0000233995|PACid:22662680 ........................QYLd...NYVSQF..KI..N..P.KC.NR.SVKSAFFDanvek
cwb_MDP0000257243|PACid:22657003 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000160099|PACid:22658087 ........................YLK....DFCDWF..GL..RelI.RF.NT.RVSYVGMLdgdhv
cwb_MDP0000193196|PACid:22649572 ........................RMR....GRASTLs.NV..K..L.EQ.GT.-VTXLIEE.....
cwb_MDP0000208234|PACid:22624840 ........................YLE....DYVSHF..SI..S..P.MY.KR.NVESAEYDqvsk.
cwb_MDP0000251783|PACid:22654795 ........................ELL....NKGHPK..NL..R..V.AI.HA.AVERILFSskas.
cwb_MDP0000686885|PACid:22670382 ........................MFQ....TLALQN..GA..V..L.RD.NM.EVKGVERDgvrg.
cwb_MDP0000138851|PACid:22674897 ........................YLE....DYVSHF..SI..R..P.MY.KR.NVESAQYDqvsk.
cwb_MDP0000194930|PACid:22667971 ........................AIA....NAAKEA..GA..H..I.VT.CA.EVQQLLINd....
cwb_MDP0000169201|PACid:22625917 ........................YIQ....SYAQHF..DLlkH..I.KF.DT.KVCGIEYEgased
cwb_MDP0000399642|PACid:22674547 ........................YIQ....SYAQHF..DLlkH..I.KF.DT.KVCGIEYEgased
cwb_MDP0000582079|PACid:22634000 ........................QYLe...TNVSQL..GI..N..P.RC.NQ.NVKSALYEvdin.
cwb_MDP0000129765|PACid:22673448 ........................NALp...P-----..N-..L..F.LW.GH.RFLSFSISs....
cwb_MDP0000272655|PACid:22672104 ........................AML....EAGVRPdnGLtlD..H.IL.GS.KVTGTLLDnrg..
cwb_MDP0000686821|PACid:22637777 ........................QYL....DTYVSHf.NI..N..P.KC.NR.SVKSAXYDvdle.
cwb_MDP0000170414|PACid:22675630 ........................YIQ....SYAQHF..DLlkH..I.KF.DT.KVCGIEYEgased
cwb_MDP0000320804|PACid:22671446 ........................YIQ....SYAQHF..DLlkH..I.KF.NN.KVSGIEYEgpsgd
cwb_MDP0000189790|PACid:22676146 ........................RMR....DKASSLp.SV..E..L.EQ.GT.-VTSLLEE.....
cwb_MDP0000847111|PACid:22682055 ........................YLE....TNVSQL..GI..N..P.XC.NQ.NVKSALYEvdin.
cwb_MDP0000289536|PACid:22677728 ........................MFQ....TLALQN..GA..V..L.RD.NM.EVKGVERDrv...
cwb_MDP0000123987|PACid:22662898 ........................YIQ....SYAQHF..DLlkH..I.KF.DT.KVCGIEYEgased
cwb_MDP0000245245|PACid:22671727 ........................YIQ....SYAQHF..DLlkH..I.KF.DT.KVCGIEYEgased
cwb_MDP0000188553|PACid:22658192 ........................WFYs...QGATSYk.NL..C..F.LS.SQ.KVTKILYG.....
cwb_MDP0000296599|PACid:22628159 ........................RTLis..KAVEDY..GV..D..V.VI.G-.KLETVGVE.....
cwb_MDP0000746652|PACid:22636428 ........................PLE....NYTSDIa.GR..S..F.HN.GR.FIQRMRERk....
cwb_MDP0000259265|PACid:22650727 ........................YLD....EYVSRF..NV..K..P.RY.CR.HVDSAVCDe....
cwb_MDP0000151331|PACid:22656760 ........................ELL....NKGDPN..NL..R..V.AV.HA.TVEKIIFStlskk
cwb_MDP0000309775|PACid:22670556 ........................NFR....QHLQQL..GV..T..I.KF.GT.RVDDLLVD.....
cwb_MDP0000232736|PACid:22657363 ........................---....------..NV..P..I.LY.ER.I-------.....
cwb_MDP0000320539|PACid:22651795 ........................RLTa...KWYKEH..GV..E..L.VL.GT.RVKSVDVR.....
cwb_MDP0000239909|PACid:22648375 ........................YLK....DFSREF..GV..AemV.RL.ET.EVVVVDA-.....
cwb_MDP0000259264|PACid:22650726 ........................YLD....EYVSRF..NV..K..P.RY.CR.HVDSAVCDe....
cwb_MDP0000293613|PACid:22654008 ........................GLA....CTAAVA..GA..A..V.LN.HA.EVVALLKDeasnr
cwb_MDP0000253362|PACid:22653297 ........................GLA....CTAAVA..GA..A..V.LN.HA.EVVALLKDeasnr
cwb_MDP0000182973|PACid:22649063 ........................WVQ....GEAENH..GT..T..F.SY.NT.TVIGGHIQ.....
cwb_MDP0000138005|PACid:22620884 ........................PLA....PLIRRL..GL..T..L.YR.TS.GDDSVLYDh....
cwb_MDP0000261301|PACid:22674262 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000771633|PACid:22649768 ........................SYLr...TRAQSR..GA..N..L.IS.G-.LVTDLEVPtsvda
cwb_MDP0000851102|PACid:22674240 ........................SYLr...TRAQSR..GA..N..L.IS.G-.LVTDLEVPtsvda
cwb_MDP0000159873|PACid:22673571 ........................QYLr...NRASEN..GA..T..V.IN.GL.-FLKMDKPgdge.
cwb_MDP0000140206|PACid:22652348 ........................KLLp...EWYAEK..GI..E..L.LL.ST.EIVEADLH.....
cwb_MDP0000261201|PACid:22657417 ........................QYLr...NRASEN..GA..T..V.IN.GL.-FLKMDKPgdge.
cwb_MDP0000252244|PACid:22643267 ........................QYLr...NRASEN..GA..T..V.IN.GL.-FLKMDKPgdge.
cwb_MDP0000261821|PACid:22664612 ........................RLLp...DWYKEK..GI..E..L.IL.ST.EIVKADLP.....
cwb_MDP0000124454|PACid:22663639 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000234830|PACid:22664319 ........................GLA....CTAALA..GA..A..V.LN.HA.EVVDLLKDeasnr
cwb_MDP0000297861|PACid:22646554 ........................RMR....EKVAQLp.NV..Q..L.EQ.GT.-VTSLLEE.....
cwb_MDP0000152184|PACid:22632666 ........................RLTp...EWYKEH..GI..E..L.VI.GT.QVKSVDVR.....
cwb_MDP0000157871|PACid:22670351 ........................KLLp...EWYAEK..GI..V..L.LL.ST.EIVEADLH.....
cwb_MDP0000250932|PACid:22662666 ........................VSF....SSLNXP..NL..S..I.RE.A-.MVTDILLGk....
cwb_MDP0000219521|PACid:22657613 ........................AYLn...SYAEHF..DVlkF..V.RF.NS.KVVEVRFIgdren
cwb_MDP0000239289|PACid:22649630 ........................RMR....QKAAKL..--..-..-.--.--.--------.....
cwb_MDP0000258995|PACid:22632347 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000167343|PACid:22638473 ........................DYLk...SYAEHF..DVlkF..V.RF.NS.KVVEVRFVgdret
cwb_MDP0000222306|PACid:22645946 ........................DYLk...SYAEHF..DVlkF..V.RF.NS.KVVEVRFVgdret
cwb_MDP0000829384|PACid:22650105 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000145663|PACid:22632174 ........................LLL....ERCLXN..GV..Q..F.HR.A-.KVWKIEHEef...
cwb_MDP0000288439|PACid:22643642 ........................DLL....MAGNPN..NI..T..L.LL.NA.TVTSIIFHkkg..
cwb_MDP0000267350|PACid:22676208 ........................-LP....DWYKEK..GI..E..L.IL.NT.EIVNADLP.....
cwb_MDP0000155608|PACid:22665289 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000194622|PACid:22683388 ........................KML....QKCISN..GV..K..F.HQ.A-.KVTKVIHE.....
cwb_MDP0000134271|PACid:22620865 ........................YLH....GYATHF..DLlkY..V.KF.ES.KVVEVRYV.....
cwb_MDP0000312748|PACid:22644976 ........................SLL....------..--..-..-.--.--.--------.....
cwb_MDP0000197715|PACid:22640206 ........................TWL....VDAVDH..GA..V..I.LT.GC.KAEKFVLEtgkse
cwb_MDP0000220943|PACid:22675739 ........................YLH....GYATHF..DLlkY..V.KF.ES.KVVEIRYV.....
cwb_MDP0000320539|PACid:22651795 ........................FYE....EFYKSK..GV..K..F.VK.GT.ILSSFDIDs....
cwb_MDP0000140206|PACid:22652348 ........................FYE....GYYANK..GV..K..I.IK.GT.PAVSLDADt....
cwb_MDP0000215521|PACid:22667208 ........................YLH....GYATHF..DLlkY..V.KF.ES.KVVEIRYV.....
cwb_MDP0000203847|PACid:22681509 ........................SFW....EKISKS..LP..M..V.HC.NT.EVLEIRRY.....
cwb_MDP0000201011|PACid:22661057 ........................SLW....EKISKS..LP..M..V.HC.NT.EVLAIRRY.....
cwb_MDP0000204596|PACid:22635084 ........................---....TVVESLgeGL..Q..I.HL.NH.VVTDISYGtkdag
cwb_MDP0000148978|PACid:22620687 ........................PIV....DHIQSL..GG..E..V.RT.NS.RIQKIDLNn....
cwb_MDP0000130369|PACid:22663416 ........................PWM....ESLTTK..GC..K..F.EK.GM.QLTDFVLNee...
cwb_MDP0000314606|PACid:22664349 ........................GLA....CTAAVA..GA..A..V.XN.HA.EVVALLKDeasnr
cwb_MDP0000263146|PACid:22654671 ........................PIR....KITEKK..GL..D..V.EFrEA.ECYRIDPK.....
cwb_MDP0000250583|PACid:22633065 ........................RFL....DLLANT..SV..X..F.YQ.D-.KAKLLYPSdhygp
cwb_MDP0000208233|PACid:22624841 ........................YLE....DYVSHF..SI..S..P.MY.KR.NVESAEYDqvsk.
cwb_MDP0000158720|PACid:22655873 ........................CLM....SESTRL..GV..S..L.QT.GK.AVVTASSTdg...
cwb_MDP0000152184|PACid:22632666 ........................FYE....EFYKSK..GV..K..F.VX.GT.ILSXFDIAs....
cwb_MDP0000182702|PACid:22680484 ........................SLA....KGLVDQ..GS..Q..I.LY.KA.NVTNIIVD.....
cwb_MDP0000261638|PACid:22646820 ........................-LV....RVLIHT..NV..T..K.YL.NF.KAVDGS--.....
cwb_MDP0000130370|PACid:22654204 ........................PWM....ESLTTK..GC..K..F.EK.GM.QLTDFVLNee...
cwb_MDP0000272119|PACid:22671033 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000305861|PACid:22662391 ........................PIR....NIVRKK..NV..D..VqFT.EA.ACLKIDAQ.....
cwb_MDP0000255696|PACid:22677008 ........................PIR....NIVRKK..NV..D..V.QF.SEaACLKIDAQ.....
cwb_MDP0000214280|PACid:22681133 ........................ELL....NKGDPN..NL..R..V.AV.HA.TVEKIIF-.....
cwb_MDP0000210966|PACid:22644665 ........................DLL....EYANPT..GL..T..V.LL.HA.AVHKIL--.....
cwb_MDP0000610999|PACid:22659782 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000242546|PACid:22662348 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000320742|PACid:22645070 ........................WMG....VKAEEL..GV..E..I.YP.GF.AASEQIMK.....
cwb_MDP0000654164|PACid:22658363 ........................YEA....KHAFSHh.GV..K..F.--.--.--SNVEIDlpamm
cwb_MDP0000256300|PACid:22644503 ........................---....----D-..--..-..-.--.--.--------.....
cwb_MDP0000235080|PACid:22654616 ........................SICr...ALCQEP..GV..E..S.KF.GA.NVGRLEWLe....
cwb_MDP0000284363|PACid:22634918 ........................PXR....NIIKKR..NG..E..IkFW.EA.ECVKIDAA.....
cwb_MDP0000125043|PACid:22648273 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000192359|PACid:22632529 ........................---....----PN..SI..T..L.LL.NA.TVTSIIFHekgsr
cwb_MDP0000440005|PACid:22623062 ........................NHR....DYLTNG..QL..I..A.SR.AI.--------.....
cwb_MDP0000609131|PACid:22633588 ........................QMA....AGLIDXs.DV..E..L.HL.QE.EIESISSN.....
cwb_MDP0000362000|PACid:22628256 ........................RIQp...AISRET..GS..Y..F.FL.S-.NCIGLDPD.....
cwb_MDP0000150210|PACid:22663655 ........................SLL....------..--..-..-.--.--.--------.....
cwb_MDP0000158790|PACid:22624362 ........................ELL....RKCVES..GV..S..Y.LD.S-.RVESIVEA.....
cwb_MDP0000427950|PACid:22623610 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000569169|PACid:22666591 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000525742|PACid:22647174 ........................RMR....KQAERW..GA..E..L.YQ.E-.DVESIDVK.....
cwb_MDP0000559829|PACid:22672870 ........................RMR....ERAATLp.NV..K..L.EQ.GT.-VTTLLEE.....
cwb_MDP0000321788|PACid:22641842 ........................SLA....KGLVDQ..GS..Q..I.LY.KA.NVTNIIVD.....
cwb_MDP0000919183|PACid:22661837 ........................QYAt...NHLTKA..GV..R..L.MR.GV.-VKEVHP-.....
cwb_MDP0000146158|PACid:22623090 ........................QYAt...NHLTXV..GV..R..L.MR.GV.-VKEVHP-.....
cwb_MDP0000832077|PACid:22645850 ........................YLH....GYATHF..DLlkY..V.KF.ES.KVVEI---.....
cwb_MDP0000621365|PACid:22669861 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000875229|PACid:22620206 ........................KLAh...RVLINPr.KI..D..C.QT.GV.FASKITLAkdgkq
cwb_MDP0000251344|PACid:22682514 ........................ANYr...MQSDRF..HA..T..I.LS.E-.MVNKVDFSat...
cwb_MDP0000168919|PACid:22641114 ........................---....------..--..-..-.--.G-.TVTSLLEE.....
cwb_MDP0000267855|PACid:22645516 ........................WRA....------..--..-..-.--.--.--------.....
cwb_MDP0000195207|PACid:22668389 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000400145|PACid:22662498 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000919183|PACid:22661837 ........................SHIqs..AMATSP..NS..Y..F.YL.A-.SCVGLDTD.....
cwb_MDP0000307336|PACid:22681275 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000263146|PACid:22654671 ........................--E....GKFFRD..GI..D..V.KT.GS.LVVKLTDK.....
cwb_MDP0000309730|PACid:22638555 ........................WRA....------..--..-..-.--.--.--------.....
cwb_MDP0000163903|PACid:22648802 ........................KAL....DWLISK..NV..E..V.VL.NE.SVNLNNVS.....
cwb_MDP0000611628|PACid:22643604 ........................GMDlkc.GPFHQV..GV..R..L.MR.GV.-VKEVHP-.....
cwb_MDP0000119779|PACid:22649695 ........................KAL....DWLISK..NV..E..V.VL.NE.SVNLNNVS.....
cwb_MDP0000120904|PACid:22629470 ........................---....------..--..-..-.--.--.TVTSLLEE.....
cwb_MDP0000150544|PACid:22634453 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000902209|PACid:22678199 ........................WRA....------..--..-..-.--.--.--------.....
cwb_MDP0000269370|PACid:22680893 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000146158|PACid:22623090 ........................RIQ....SALAAS..PS..S..Y.FY.MA.SCVGLDTD.....
cwb_MDP0000124051|PACid:22654473 ........................AEL....SFLEA-..GI..F..P.YN.GF.---SLDHI.....
cwb_MDP0000255696|PACid:22677008 ........................FAE....EKFQRD..GI..D..L.KT.GS.MVVKVT--.....
cwb_MDP0000305861|PACid:22662391 ........................FAE....EKFQRE..GI..D..L.KT.GS.MVVKVT--.....
cwb_MDP0000611628|PACid:22643604 ........................RIQ....SALAXS..PS..S..Y.FY.MA.SCXGLDTD.....
cwb_MDP0000309622|PACid:22670269 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000239909|PACid:22648375 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000126888|PACid:22675379 ........................HEV....------..--..-..-.--.--.--------.....
cwb_MDP0000869086|PACid:22644121 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000317524|PACid:22631851 ........................YLK....DFCDWF..GL..RelI.RF.NT.RVSYVGMLdgdha
cwb_MDP0000160099|PACid:22658087 ........................---....------..--..-..-.--.--.-------E.....
cwb_MDP0000251205|PACid:22649529 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000314335|PACid:22679828 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000638870|PACid:22646063 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000790657|PACid:22654829 ........................---....--AATLp.NV..K..L.EQ.GT.-VTTLLEE.....
cwb_MDP0000748068|PACid:22649054 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000727481|PACid:22682921 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000301246|PACid:22669391 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000190684|PACid:22677586 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000456223|PACid:22643829 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000745172|PACid:22667211 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000407932|PACid:22626437 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000440896|PACid:22680420 ........................---....----SY..DA..T..T.HF.ET.TVQDVIA-.....
cwb_MDP0000694227|PACid:22673619 ........................---....------..--..R..L.KF.NK.VVRELQHXrn...
cwb_MDP0000123987|PACid:22662898 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000138005|PACid:22620884 ........................WFYs...QGATSYk.NL..C..F.LS.SQ.KVTKILYG.....
cwb_MDP0000258205|PACid:22638470 ........................LLL....ERCLSN..GV..Q..F.HK.A-.KVWKIEHE.....
cwb_MDP0000245245|PACid:22671727 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000306704|PACid:22680179 ........................---....--ALALh.RD..D..C.YL.NE.PALDIVKRmklef
cwb_MDP0000478654|PACid:22674637 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000728219|PACid:22657389 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000170414|PACid:22675630 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000284363|PACid:22634918 ........................FAE....KKFTRD..GI..D..V.QT.GC.RVVSVSDK.....
cwb_MDP0000219560|PACid:22625984 ........................---....------..--..-..-.QL.GK.KVRKIQWQpdnrk
cwb_MDP0000235930|PACid:22635275 ........................SII....NHCDYLp.NV..R..I.VA.ST.AA------.....
cwb_MDP0000755938|PACid:22650525 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000138851|PACid:22674897 ........................GTC....RKIKSG..EI..Q..V.LP.A-.EIGSIR--.....
cwb_MDP0000261638|PACid:22646820 ........................---....----SY..DA..T..T.HF.ET.TVQDVIA-.....
cwb_MDP0000317524|PACid:22631851 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000294615|PACid:22655955 ........................---....----SY..DA..T..T.HF.ET.TVQDVIA-.....
cwb_MDP0000208234|PACid:22624840 ........................GAY....RKIKSG..EI..Q..V.LP.A-.EIGSIR--.....
cwb_MDP0000216129|PACid:22668259 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000219521|PACid:22657613 ........................---....------..--..-..-.--.--.-------S.....
cwb_MDP0000248995|PACid:22642703 ........................---....------..DA..T..T.HF.ES.TVMDV---.....
cwb_MDP0000256328|PACid:22629063 ........................RIQ....SALATS..PS..S..Y.FY.MA.SCAGLDTD.....
cwb_MDP0000181673|PACid:22646891 ........................---....------..DA..T..T.HF.ES.TVLDV---.....
cwb_MDP0000169201|PACid:22625917 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000263530|PACid:22651991 ........................PFF....------..--..-..-.--.--.--------.....
cwb_MDP0000295839|PACid:22658517 ........................GSI....NKIIAG..EI..K..V.VP.S-.-ITKIL--.....
cwb_MDP0000297466|PACid:22645872 ........................CLQ....ALCVES..GV..S..Y.LD.S-.RVESIVEA.....
cwb_MDP0000281982|PACid:22629373 ........................PAL....DTMKRM..KV..E..F.NE.--.--------.....
cwb_MDP0000053966|PACid:22620929 ........................---....----SY..DA..T..T.HF.ET.TVQDVI--.....
cwb_MDP0000795740|PACid:22666880 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000212327|PACid:22630830 ........................RMR....EKASSLp.KV..S..F.VC.HF.LNFDINVRleqgm
cwb_MDP0000437365|PACid:22632357 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000135231|PACid:22629791 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000167343|PACid:22638473 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000222306|PACid:22645946 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000183517|PACid:22634175 ........................GLA....EEIQR-..--..-..-.--.--.--------.....
cwb_MDP0000686821|PACid:22637777 ........................GCI....KKIKTR..EI..T..V.LP.S-.-ITSIE--.....
cwb_MDP0000430157|PACid:22655785 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000373054|PACid:22683333 ........................KMHe...RGATHK..NV..T..L.EQ.GT.-VTALIEE.....
cwb_MDP0000295306|PACid:22673308 ........................---....------..DA..T..T.HF.ES.TVLD----.....
cwb_MDP0000233995|PACid:22662680 ........................FYL....KATKGRsaTI..D..V.LP.S-.-ITSID--.....
cwb_MDP0000209681|PACid:22642739 ........................FYL....KATKGRsaTI..D..V.LP.S-.-ITSID--.....
cwb_MDP0000876898|PACid:22679933 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000738522|PACid:22680891 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000399642|PACid:22674547 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000215521|PACid:22667208 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000170521|PACid:22675770 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000262982|PACid:22620906 ........................GAL....DKIKSG..GI..K..V.VP.GI.K--RFX--.....
cwb_MDP0000321186|PACid:22667177 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000266051|PACid:22641431 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000837610|PACid:22643529 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000582079|PACid:22634000 ........................GSI....NKIKTG..EI..K..V.LP.S-.-ITSID--.....
cwb_MDP0000538071|PACid:22663035 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000241703|PACid:22642424 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000671114|PACid:22638724 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000315388|PACid:22681954 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000134271|PACid:22620865 ........................YLH....GYATHF..DLlkY..V.KF.ES.KVVEVRYV.....
cwb_MDP0000297581|PACid:22646099 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000911003|PACid:22677366 ........................VVK....NRFTSL..GG..V..M.FE.GY.SVSGVSIY.....
cwb_MDP0000576650|PACid:22634720 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000149205|PACid:22670334 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000315409|PACid:22681973 ........................HLH....LIIISY..DA..T..T.HF.ET.TVQDVIAM.....
cwb_MDP0000320804|PACid:22671446 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000474647|PACid:22667377 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000566648|PACid:22666666 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000171379|PACid:22629613 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000814529|PACid:22673539 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000218295|PACid:22671514 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000220943|PACid:22675739 ........................YLH....GYATHF..DLlkY..V.KF.ES.KVVEIRYV.....
cwb_MDP0000795437|PACid:22664825 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000919706|PACid:22656631 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000295675|PACid:22626457 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000147542|PACid:22652542 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000272126|PACid:22655119 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000196881|PACid:22654963 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000268346|PACid:22678394 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000147542|PACid:22652542 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000948298|PACid:22676144 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000220943|PACid:22675739 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000182589|PACid:22648509 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000557870|PACid:22631128 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000308870|PACid:22652882 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000322449|PACid:22657441 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000286494|PACid:22671310 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000150868|PACid:22621264 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000155608|PACid:22665289 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000168505|PACid:22672316 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000196888|PACid:22670849 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000154812|PACid:22632894 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000186080|PACid:22622639 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000220012|PACid:22626541 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000169409|PACid:22673915 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000373095|PACid:22661923 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000235846|PACid:22627807 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000207126|PACid:22623152 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000268357|PACid:22630891 ........................---....------..--..-..-.--.--.--------.....
cwb_MDP0000149067|PACid:22669209 ........................---....------..--..-..-.--.--.--------.....


                                                      90                                            
                                                       |                                            
d1xdia1                          .................HARV.K.TL.......AAAQS...AD........................
cwb_MDP0000813172|PACid:22649115 ................qGVIA.L.NM.......EDGTL...HR........................
cwb_MDP0000251581|PACid:22621152 ................qGVIA.L.NM.......EDGTL...HR........................
cwb_MDP0000188391|PACid:22626210 ........lyadalvyyQGTC.Q.GVialnm..EDGTL...HR........................
cwb_MDP0000254144|PACid:22644986 .................----.-.--.......-----...--........................
cwb_MDP0000321972|PACid:22643109 .................SNKV.-.MV.......TIEDG...RN........................
cwb_MDP0000299806|PACid:22682346 .................DGVL.-.--.......VYANG...QE........................
cwb_MDP0000283451|PACid:22680462 .................DGVL.-.--.......VYANG...QE........................
cwb_MDP0000296714|PACid:22644308 ..........lntnrcnKVKV.-.--.......STSNG...SD........................
cwb_MDP0000162193|PACid:22629958 ............lntnpGNKV.-.KV.......STSNG...ND........................
cwb_MDP0000769741|PACid:22637873 .................GVKV.-.--.......TVEDG...RT........................
cwb_MDP0000295277|PACid:22625688 .................EISV.D.T-.......IDGEN...KV........................
cwb_MDP0000897124|PACid:22647159 .................EISV.-.DA.......IDGEN...TV........................
cwb_MDP0000854208|PACid:22682207 .................DTVC.L.GVdtlnt..ETQEV...IR........................
cwb_MDP0000241767|PACid:22665328 ..........lntnrxnKVKV.-.--.......STSNG...SD........................
cwb_MDP0000318858|PACid:22682838 .................DPLY.-.--.......SLERL...RE........................
cwb_MDP0000248995|PACid:22642703 .................EGKV.V.G-.......VTSEG...ET........................
cwb_MDP0000442206|PACid:22660061 .................DPLY.-.--.......SLDRL...RE........................
cwb_MDP0000181673|PACid:22646891 .................EGKV.I.G-.......VTSEG...ET........................
cwb_MDP0000315409|PACid:22681973 .................NGKA.I.G-.......VTSEG...ET........................
cwb_MDP0000053966|PACid:22620929 .................NKKA.I.G-.......VTSEG...ET........................
cwb_MDP0000294615|PACid:22655955 .................NKKA.I.G-.......VTSEG...ET........................
cwb_MDP0000306147|PACid:22679041 ..........lntnrxnKVKV.-.--.......STSNG...SD........................
cwb_MDP0000180064|PACid:22628138 .................QGRA.V.GV.......RLSDG...RE........................
cwb_MDP0000261625|PACid:22630921 .................GVTV.-.--.......MTEDG...CV........................
cwb_MDP0000300208|PACid:22651331 .................DVEV.T.Q-.......LDGTK...LS........................
cwb_MDP0000247171|PACid:22623108 .................GSSI.S.VI.......HMGDG...TI........................
cwb_MDP0000308095|PACid:22667065 .................ETYV.T.GFsms....RATNK...KI........................
cwb_MDP0000319421|PACid:22624123 .................GTSS.P.VL.......QLQDG...TI........................
cwb_MDP0000232295|PACid:22657598 .................ERGD.R.NE.......TXARG...IRfiksngnsseiyeahlnqpensc.
cwb_MDP0000188994|PACid:22643055 .................SGYL.K.LV.......HXADG...TI........................
cwb_MDP0000159189|PACid:22672554 .................SGYL.K.LV.......HXADG...TI........................
cwb_MDP0000656178|PACid:22657871 .................QKVQ.-.--.......IGSSD...KV........................
cwb_MDP0000910523|PACid:22620639 .................GSSI.S.VI.......HLGDG...TI........................
cwb_MDP0000119941|PACid:22643547 .................----.-.--.......-----...--........................
cwb_MDP0000231799|PACid:22673471 .................QKVQ.-.--.......IGSSD...KV........................
cwb_MDP0000255025|PACid:22624807 .................ETYV.A.GFsms....KATNK...KV........................
cwb_MDP0000231632|PACid:22622264 ..............afeNWSV.S.SA.......AKDDKhs.QS........................
cwb_MDP0000173300|PACid:22648712 ..............skrKKKC.L.GVmakplsnN----...-Itkrlq...................
cwb_MDP0000158474|PACid:22655457 .............pravGVIF.K.DE.......KGNQH...QA........................
cwb_MDP0000276878|PACid:22649644 .................GCTV.-.--.......ISGDG...LE........................
cwb_MDP0000154720|PACid:22639222 .................GNLA.K.LD.......LI-DG...NS........................
cwb_MDP0000549646|PACid:22624756 .................GGRV.G.GV.......VTNWA...LVsmnhdtqscmdpnvmeakvvvss.
cwb_MDP0000158853|PACid:22672016 .................----.-.--.......-----...--........................
cwb_MDP0000702799|PACid:22650781 .................----.-.--.......-----...--........................
cwb_MDP0000233110|PACid:22669060 ...............grRKRC.L.GV.......QATSX...SKnikrklk.................
cwb_MDP0000260827|PACid:22621315 .................KGTI.K.GVqykt...KTGEE...MT........................
cwb_MDP0000941459|PACid:22654340 .................----.-.--.......-----...--........................
cwb_MDP0000185338|PACid:22637072 ..............pasRQSA.V.GV.......VFRDS...VGryhhav..................
cwb_MDP0000451172|PACid:22678939 ................lR---.-.--.......-----...--........................
cwb_MDP0000136847|PACid:22626492 .................----.-.--.......-----...--........................
cwb_MDP0000177641|PACid:22624304 ................yE---.-.--.......TIVRG...IRfiksdgsssqtheaylntqnnsrs
cwb_MDP0000413935|PACid:22663920 .................KGTI.K.GVqykt...KTGEE...MT........................
cwb_MDP0000206098|PACid:22637273 .................GGRV.G.GV.......VTNWA...LVsmnhdtqscmdpnvmeakvvvss.
cwb_MDP0000845788|PACid:22673064 .................PFTV.-.--.......ESSER...-K........................
cwb_MDP0000465595|PACid:22654474 .................RKGD.R.NE.......TI---...--........................
cwb_MDP0000137211|PACid:22645789 .................----.-.--.......NVSQW...QS........................
cwb_MDP0000130099|PACid:22624356 .................----.-.--.......-----...--........................
cwb_MDP0000425135|PACid:22674685 ..........pasrqsaAGVV.F.RD.......RVGRY...HH........................
cwb_MDP0000200780|PACid:22660656 .................GMVV.-.--.......KTDNG...RElrsfkfkeedesqevraverrill
cwb_MDP0000142434|PACid:22683351 .................SLTS.YpTL.......QLHNG...ST........................
cwb_MDP0000248951|PACid:22626490 .................----.-.--.......-----...--........................
cwb_MDP0000869086|PACid:22644121 ...........vgckdlKWVV.K.SV.......E----...-Kkteifie.................
cwb_MDP0000318256|PACid:22681338 .................KRHG.A.VE.......LLNKG...HP........................
cwb_MDP0000231634|PACid:22622267 ..............afeNWSV.S.SA.......AKDDKhs.QS........................
cwb_MDP0000626995|PACid:22630905 .................GGRV.G.GV.......VTNW-...--........................
cwb_MDP0000123832|PACid:22633934 .................GSSI.S.VI.......HMGDG...TI........................
cwb_MDP0000236092|PACid:22632501 .................GGRV.G.GV.......VTNW-...--........................
cwb_MDP0000199159|PACid:22674497 ...........vgckdlKWVV.K.SVen.....KTESF...VE........................
cwb_MDP0000162755|PACid:22662459 .................SGLF.K.LV.......HLADG...TV........................
cwb_MDP0000173666|PACid:22649255 ..............afeNWSV.S.SA.......AKDDKhs.QS........................
cwb_MDP0000262982|PACid:22620906 .................FWRV.K.XVtste...STRSE...VE........................
cwb_MDP0000184832|PACid:22636281 .................THEA.Y.LN.......TQNNS...RS........................
cwb_MDP0000598927|PACid:22655979 .................TCQV.-.--.......ATGDG...IAmahraqavisnmef..........
cwb_MDP0000561228|PACid:22637769 .................----.-.--.......-----...--........................
cwb_MDP0000175650|PACid:22652650 .................DDFV.S.VTas.....FLKDG...KRmern....................
cwb_MDP0000233802|PACid:22672706 .................TPFK.-.--.......IFADE...RT........................
cwb_MDP0000321186|PACid:22667177 .................----.-.--.......-----...--........................
cwb_MDP0000161955|PACid:22660959 .................KGTV.K.GVmykn...KAGDE...MR........................
cwb_MDP0000213381|PACid:22663844 .................KGTV.K.GVmykn...KAGEE...MR........................
cwb_MDP0000168437|PACid:22624648 .................KGTV.K.GV.......QYKSKgxdLE........................
cwb_MDP0000823251|PACid:22668430 .................TPFK.-.--.......IFADE...RT........................
cwb_MDP0000191389|PACid:22631180 .................KGTV.K.GVmykn...RAGEE...MR........................
cwb_MDP0000199319|PACid:22658752 .................KGTV.K.GVmykn...KAGEE...MR........................
cwb_MDP0000857446|PACid:22649571 .................KGTI.K.GVmykn...KAGEE...MR........................
cwb_MDP0000266638|PACid:22658651 .................KGTV.K.GVmykn...KAGEE...MR........................
cwb_MDP0000208936|PACid:22641581 ...............giRKQC.L.GV.......QATSL...SKnikrklq.................
cwb_MDP0000202883|PACid:22663993 .................KGTV.K.GVlykn...RAGKE...MR........................
cwb_MDP0000288439|PACid:22643642 ................yE---.-.--.......TIVRG...IRfiksdgsssqtheaylntqnnsrs
cwb_MDP0000295839|PACid:22658517 .................GEKK.W.CVrvhn...TLSDVq..EM........................
cwb_MDP0000903805|PACid:22678063 .................KRHG.A.VE.......HLNKG...HP........................
cwb_MDP0000202123|PACid:22678734 .................TVDV.-.--.......---DG...KL........................
cwb_MDP0000227773|PACid:22639029 ...........vgckdlK---.-.--.......-----...-Wvvrsmekkaeifve..........
cwb_MDP0000317524|PACid:22631851 ...........ggckdlKWVV.R.SV.......EKKTEif.VE........................
cwb_MDP0000320748|PACid:22658808 .................KGTI.Q.GVmykn...KAGEE...M-........................
cwb_MDP0000634676|PACid:22625957 .................NGXI.R.GVmykn...KAGEE...MR........................
cwb_MDP0000235846|PACid:22627807 .................P-FK.-.--.......IFANE...RT........................
cwb_MDP0000251344|PACid:22682514 .................P-FK.-.--.......IFANE...RT........................
cwb_MDP0000501957|PACid:22671723 .................KGTI.K.GVmykn...KAGEE...MR........................
cwb_MDP0000209681|PACid:22642739 ................wRVTV.E.NI.......LSGEQ...EI........................
cwb_MDP0000293482|PACid:22637734 .................DKSS.V.IVkassh..QTNEI...IE........................
cwb_MDP0000233995|PACid:22662680 ................wRVTV.E.NI.......LSGEQ...EI........................
cwb_MDP0000257243|PACid:22657003 .................----.-.--.......-----...--........................
cwb_MDP0000160099|PACid:22658087 ...........vgckdlK---.-.--.......-----...-Wvvrsmekkaeifve..........
cwb_MDP0000193196|PACid:22649572 .................KGTI.K.GVmykn...KAGEE...MR........................
cwb_MDP0000208234|PACid:22624840 .................KWTV.K.AKn......IGGSG...EM........................
cwb_MDP0000251783|PACid:22654795 .................GLSA.K.GI.......IYSDL...NGrshral..................
cwb_MDP0000686885|PACid:22670382 .................GVW-.-.-V.......STAKG...KR........................
cwb_MDP0000138851|PACid:22674897 .................KWIV.K.AKn......VGGSG...EM........................
cwb_MDP0000194930|PACid:22667971 .................SGTA.D.GV.......LLTDG...SQ........................
cwb_MDP0000169201|PACid:22625917 .................EMQA.W.SH.......WGGTG...EPfssxgkwkvavedkhsrstev...
cwb_MDP0000399642|PACid:22674547 .................EMQA.W.SH.......WGGTG...EPfssxgkwkvavedkhsrstev...
cwb_MDP0000582079|PACid:22634000 .................KWRV.T.AEnt.....LLGAQ...EE........................
cwb_MDP0000129765|PACid:22673448 .................DKSS.V.IVkassh..ETNEX...IE........................
cwb_MDP0000272655|PACid:22672104 .................KRHG.A.VE.......HLNKG...HP........................
cwb_MDP0000686821|PACid:22637777 .................KWYV.K.VE.......NTLSGaq.EM........................
cwb_MDP0000170414|PACid:22675630 .................EMQA.W.SH.......WGGTG...EPfssxgkwkvavedkhsrstev...
cwb_MDP0000320804|PACid:22671446 .....emqawshwggtgE---.-.--.......-----...-Pfssggkwkvvvedkqslstki...
cwb_MDP0000189790|PACid:22676146 .................KGTI.K.GV.......KFRRKgs.QE........................
cwb_MDP0000847111|PACid:22682055 .................KWRV.T.AEnt.....LLGAQ...EE........................
cwb_MDP0000289536|PACid:22677728 .................RGGV.W.V-.......CTANG...ER........................
cwb_MDP0000123987|PACid:22662898 ..............emqA---.W.SH.......WGGTG...EPfsskgkwkvavedkhsrstev...
cwb_MDP0000245245|PACid:22671727 ..............emqA---.W.SH.......WGGTG...EPfsskgkwkvavedkhsrstev...
cwb_MDP0000188553|PACid:22658192 .................SNTV.M.X-.......TIEDG...RN........................
cwb_MDP0000296599|PACid:22628159 .................NGRV.N.SV.......VLEGG...RV........................
cwb_MDP0000746652|PACid:22636428 .................KGTI.K.GVmykn...KAGEE...MR........................
cwb_MDP0000259265|PACid:22650727 .................DEEI.W.KVkv.....TGPDQy..EY........................
cwb_MDP0000151331|PACid:22656760 .............stxlS---.-.--.......-----...--........................
cwb_MDP0000309775|PACid:22670556 .................NAQV.V.GVxvsd...SADNS...QK........................
cwb_MDP0000232736|PACid:22657363 .................----.-.--.......-----...--........................
cwb_MDP0000320539|PACid:22651795 .................RKTL.-.--.......LTGSG...ET........................
cwb_MDP0000239909|PACid:22648375 .................----.-.--.......-----...--........................
cwb_MDP0000259264|PACid:22650726 .................DEEI.W.KVkv.....TGPDQy..EY........................
cwb_MDP0000293613|PACid:22654008 ...............tiGARI.R.DN.......LSGKE...FD........................
cwb_MDP0000253362|PACid:22653297 ...............tiGARI.R.DN.......LSGKE...FD........................
cwb_MDP0000182973|PACid:22649063 .................QNHX.C.LH.......V----...--........................
cwb_MDP0000138005|PACid:22620884 .................DLES.F.AL.......FDMDG...RQ........................
cwb_MDP0000261301|PACid:22674262 .................----.-.--.......-----...--........................
cwb_MDP0000771633|PACid:22649768 .................PYVI.S.YT.......ADNKR...ES........................
cwb_MDP0000851102|PACid:22674240 .................PYVI.S.YT.......ADNKR...ES........................
cwb_MDP0000159873|PACid:22673571 .................APYV.L.HY.......TEYDG...KAggigvkkt................
cwb_MDP0000140206|PACid:22652348 .................SKIL.-.--.......TSETG...GM........................
cwb_MDP0000261201|PACid:22657417 .................APYV.L.HY.......TEYDG...KAggagvkkt................
cwb_MDP0000252244|PACid:22643267 .................APYV.L.HY.......TEYDG...KAggagvkkt................
cwb_MDP0000261821|PACid:22664612 .................GKTL.-.--.......VSGTG...ES........................
cwb_MDP0000124454|PACid:22663639 .................----.-.--.......WDQDG...PYd.......................
cwb_MDP0000234830|PACid:22664319 ...............tiGARI.R.DN.......LSGKE...FN........................
cwb_MDP0000297861|PACid:22646554 .................NGTI.K.GVqykp...KDGQE...LK........................
cwb_MDP0000152184|PACid:22632666 .................RKTL.-.--.......LXGSG...ET........................
cwb_MDP0000157871|PACid:22670351 .................SKIL.-.--.......TSATG...GM........................
cwb_MDP0000250932|PACid:22662666 .................NDNI.E.GV.......QTFFG...MN........................
cwb_MDP0000219521|PACid:22657613 iefgvkpveyrslspagG---.-.--.......-----...-Qpvwevavqtndsetiqw.......
cwb_MDP0000239289|PACid:22649630 .................----.-.--.......-----...--........................
cwb_MDP0000258995|PACid:22632347 .................----.-.--.......-----...--........................
cwb_MDP0000167343|PACid:22638473 ............tdfdvK---.-.--.......-----...-Pveyqslsxaggqpvwevavqtnds
cwb_MDP0000222306|PACid:22645946 ............tdfdvK---.-.--.......-----...-Pveyqslsxaggqpvwevavqtnds
cwb_MDP0000829384|PACid:22650105 .................----.-.--.......-----...--........................
cwb_MDP0000145663|PACid:22632174 .................ESSI.-.--.......LCDDG...NE........................
cwb_MDP0000288439|PACid:22643642 .................NRNV.T.VVrgirf..I----...-Ksdgsssqtheaylntqnnsrs...
cwb_MDP0000267350|PACid:22676208 .................GKTL.-.--.......VSGSG...ES........................
cwb_MDP0000155608|PACid:22665289 .................----.-.--.......---DG...NS........................
cwb_MDP0000194622|PACid:22683388 .................EEKS.-.LL.......TCNDG...VT........................
cwb_MDP0000134271|PACid:22620865 .................GGIG.H.QT.......-----...-Ttqfpgnsnsxeygnllngdpvwev
cwb_MDP0000312748|PACid:22644976 .................----.-.--.......-----...--........................
cwb_MDP0000197715|PACid:22640206 .............skrkK---.-.--.......-----...-Kclevmakalsniitkrlq......
cwb_MDP0000220943|PACid:22675739 .................GGID.D.HQ.......T----...-Ttqfpmnsisgeygnllnghpvwev
cwb_MDP0000320539|PACid:22651795 .................DGKV.T.AV.......NLRDG...SS........................
cwb_MDP0000140206|PACid:22652348 .................NGDV.K.AV.......KLKDG...RV........................
cwb_MDP0000215521|PACid:22667208 .................GGID.-.--.......---DH...QTitqlpmnsisgeygsllsghpvwe
cwb_MDP0000203847|PACid:22681509 .................SDSV.X.VVvks....CDGEV...KS........................
cwb_MDP0000201011|PACid:22661057 .................SDSVsV.DVks.....CDGEV...KA........................
cwb_MDP0000204596|PACid:22635084 ..........lntnrynKVKV.-.--.......STSNG...SD........................
cwb_MDP0000148978|PACid:22620687 .................DGTV.K.SF.......VLNNG...SV........................
cwb_MDP0000130369|PACid:22663416 .................TGSI.S.EV.......VCNGG...V-........................
cwb_MDP0000314606|PACid:22664349 ...............tiGARI.R.DN.......LSGKE...FD........................
cwb_MDP0000263146|PACid:22654671 .................NKKV.L.CR.......STQHS...NLglkeaefs................
cwb_MDP0000250583|PACid:22633065 ............tqsslGGTV.-.--.......LLESG...LL........................
cwb_MDP0000208233|PACid:22624841 .................KWIV.-.--.......-----...--........................
cwb_MDP0000158720|PACid:22655873 .................GKFL.L.GVenr....TFSSP...EY........................
cwb_MDP0000152184|PACid:22632666 .................NRKV.T.AV.......NLRDG...SS........................
cwb_MDP0000182702|PACid:22680484 .................PGRV.V.GV.......RLSDG...RE........................
cwb_MDP0000261638|PACid:22646820 .................----.-.--.......-----...--........................
cwb_MDP0000130370|PACid:22654204 .................TGSI.S.EV.......VCNGG...V-........................
cwb_MDP0000272119|PACid:22671033 .................----.-.--.......-----...--........................
cwb_MDP0000305861|PACid:22662391 .................NNKI.Y.CHsnlennlDGQEE...FV........................
cwb_MDP0000255696|PACid:22677008 .................NKKI.Y.CRsnlennlNGQEE...FV........................
cwb_MDP0000214280|PACid:22681133 .................----.-.--.......-----...--........................
cwb_MDP0000210966|PACid:22644665 .................----.-.--.......-----...--........................
cwb_MDP0000610999|PACid:22659782 .................----.-.--.......-----...--........................
cwb_MDP0000242546|PACid:22662348 .................----.-.--.......-----...--........................
cwb_MDP0000320742|PACid:22645070 .................KYNL.R.EK.......GHSQ-...--........................
cwb_MDP0000654164|PACid:22658363 ...............sqKDKV.V.SN.......LTRGI...EG........................
cwb_MDP0000256300|PACid:22644503 .................----.-.--.......-----...--........................
cwb_MDP0000235080|PACid:22654616 .................DENL.W.SL.......IGSDG...QN........................
cwb_MDP0000284363|PACid:22634918 .................NKXV.S.LRanfdxnlVGNKE...FS........................
cwb_MDP0000125043|PACid:22648273 .................----.-.--.......-----...--........................
cwb_MDP0000192359|PACid:22632529 ................yE---.-.--.......TIVRG...IRfiksdgsssqtheaylntqnnsrs
cwb_MDP0000440005|PACid:22623062 .................NVTD.T.EV.......LTAEG...RL........................
cwb_MDP0000609131|PACid:22633588 .................GEYY.-.--.......ELNSTlr.NS........................
cwb_MDP0000362000|PACid:22628256 .................KHXV.K.CE.......TVTDG...AEplkpwkfe................
cwb_MDP0000150210|PACid:22663655 .................----.-.--.......-----...--........................
cwb_MDP0000158790|PACid:22624362 .................SNGI.S.LV.......SCGHN...IV........................
cwb_MDP0000427950|PACid:22623610 .................----.-.--.......--GTG...DT........................
cwb_MDP0000569169|PACid:22666591 .................----.-.--.......-----...--........................
cwb_MDP0000525742|PACid:22647174 .................TRPF.-.--.......-----...--........................
cwb_MDP0000559829|PACid:22672870 .................KSTI.K.GV.......MYKNK...T-........................
cwb_MDP0000321788|PACid:22641842 .................PGRV.V.GV.......RLSDG...RE........................
cwb_MDP0000919183|PACid:22661837 .................-KKI.-.--.......VLNDG...TD........................
cwb_MDP0000146158|PACid:22623090 .................-KKI.-.--.......VLNDG...TD........................
cwb_MDP0000832077|PACid:22645850 .................----.-.--.......-----...--........................
cwb_MDP0000621365|PACid:22669861 .................----.-.--.......-----...--........................
cwb_MDP0000875229|PACid:22620206 ................xTI--.-.-Elida...KTKEPk..XT........................
cwb_MDP0000251344|PACid:22682514 .................PFKI.-.--.......STEEK...T-........................
cwb_MDP0000168919|PACid:22641114 .................KGTI.K.GV.......KFRRKgs.QX........................
cwb_MDP0000267855|PACid:22645516 .................----.-.--.......-----...--........................
cwb_MDP0000195207|PACid:22668389 .................----.-.--.......-----...--........................
cwb_MDP0000400145|PACid:22662498 .................----.-.--.......-----...--........................
cwb_MDP0000919183|PACid:22661837 .................KHEV.Y.CE.......TVSNG...GLshepyrfk................
cwb_MDP0000307336|PACid:22681275 .................----.-.--.......-----...--........................
cwb_MDP0000263146|PACid:22654671 .................EVSA.K.DR.......DTGKI...SN........................
cwb_MDP0000309730|PACid:22638555 .................----.-.--.......-----...--........................
cwb_MDP0000163903|PACid:22648802 .................DGFI.-.--.......QTSSG...EV........................
cwb_MDP0000611628|PACid:22643604 .................-KKI.-.--.......VLNDG...TD........................
cwb_MDP0000119779|PACid:22649695 .................DGFI.-.--.......QTSSG...EV........................
cwb_MDP0000120904|PACid:22629470 .................KGTI.K.GV.......KFRRKgs.QE........................
cwb_MDP0000150544|PACid:22634453 .................----.-.--.......-----...--........................
cwb_MDP0000902209|PACid:22678199 .................----.-.--.......-----...--........................
cwb_MDP0000269370|PACid:22680893 .................----.-.--.......-----...--........................
cwb_MDP0000146158|PACid:22623090 .................KHEV.Y.CE.......TISNG...GLshepyrfk................
cwb_MDP0000124051|PACid:22654473 .................GGTK.I.GV.......TTRDErgrRN........................
cwb_MDP0000255696|PACid:22677008 .................DKEI.F.TK.......ELKNG...GE........................
cwb_MDP0000305861|PACid:22662391 .................DKEI.F.TK.......EMKNG...GE........................
cwb_MDP0000611628|PACid:22643604 .................KHEV.Y.CX.......TISNG...GLshepyrfk................
cwb_MDP0000309622|PACid:22670269 .................----.-.--.......-----...--........................
cwb_MDP0000239909|PACid:22648375 .................DGSV.-.--.......VFKDG...SV........................
cwb_MDP0000126888|PACid:22675379 .................----.-.--.......-----...--........................
cwb_MDP0000869086|PACid:22644121 .................DGKV.-.--.......LFVDG...SW........................
cwb_MDP0000317524|PACid:22631851 ...........ggckdlKWVV.R.SV.......EKKTEif.VE........................
cwb_MDP0000160099|PACid:22658087 .................DGKV.-.--.......LFVDG...SW........................
cwb_MDP0000251205|PACid:22649529 .................----.-.--.......-----...--........................
cwb_MDP0000314335|PACid:22679828 .................----.-.--.......-----...--........................
cwb_MDP0000638870|PACid:22646063 .................----.-.--.......-----...--........................
cwb_MDP0000790657|PACid:22654829 .................KSTI.K.GVmykn...KTGXE...MR........................
cwb_MDP0000748068|PACid:22649054 .................----.-.--.......-----...--........................
cwb_MDP0000727481|PACid:22682921 .................----.-.--.......-----...--........................
cwb_MDP0000301246|PACid:22669391 .................----.-.--.......-----...--........................
cwb_MDP0000190684|PACid:22677586 .................----.-.--.......---DG...SW........................
cwb_MDP0000456223|PACid:22643829 .................----.-.--.......-----...--........................
cwb_MDP0000745172|PACid:22667211 .................----.-.--.......-----...--........................
cwb_MDP0000407932|PACid:22626437 .................----.-.--.......-----...--........................
cwb_MDP0000440896|PACid:22680420 .................----.-.--.......-----...--........................
cwb_MDP0000694227|PACid:22673619 .................GVTV.-.--.......MTEDG...CI........................
cwb_MDP0000123987|PACid:22662898 .................----.-.--.......-EGEA...SP........................
cwb_MDP0000138005|PACid:22620884 .................SNTV.M.A-.......TIEDG...RN........................
cwb_MDP0000258205|PACid:22638470 .................EFES.S.I-.......LCDDE...NE........................
cwb_MDP0000245245|PACid:22671727 .................----.-.--.......-EGEA...SP........................
cwb_MDP0000306704|PACid:22680179 ...............neEGKV.I.GV.......TY-EG...ET........................
cwb_MDP0000478654|PACid:22674637 .................----.-.--.......-----...--........................
cwb_MDP0000728219|PACid:22657389 .................----.-.--.......-----...--........................
cwb_MDP0000170414|PACid:22675630 .................----.-.--.......-----...-P........................
cwb_MDP0000284363|PACid:22634918 .................EITM.K.VK.......SKGEV...CS........................
cwb_MDP0000219560|PACid:22625984 ...........nkgyesDTRL.V.KL.......HFSDG...SV........................
cwb_MDP0000235930|PACid:22635275 .................NITD.R.EV.......LTTDG...RL........................
cwb_MDP0000755938|PACid:22650525 .................----.-.GI.......EFDDN...TK........................
cwb_MDP0000138851|PACid:22674897 .................GGQV.-.--.......ELKNG...KS........................
cwb_MDP0000261638|PACid:22646820 .................----.-.--.......-----...--........................
cwb_MDP0000317524|PACid:22631851 .................-GNV.-.--.......LFVDG...SW........................
cwb_MDP0000294615|PACid:22655955 .................----.-.--.......-----...--........................
cwb_MDP0000208234|PACid:22624840 .................GGQV.-.--.......ELKNG...KS........................
cwb_MDP0000216129|PACid:22668259 .................----.-.--.......-----...--........................
cwb_MDP0000219521|PACid:22657613 .................ADGI.-.--.......EFDDN...TK........................
cwb_MDP0000248995|PACid:22642703 .................----.-.--.......-----...--........................
cwb_MDP0000256328|PACid:22629063 .................KHEV.Y.CK.......TISNG...GLshxpyrfk................
cwb_MDP0000181673|PACid:22646891 .................----.-.--.......-----...--........................
cwb_MDP0000169201|PACid:22625917 .................----.-.--.......-----...-P........................
cwb_MDP0000263530|PACid:22651991 .................----.-.--.......-----...--........................
cwb_MDP0000295839|PACid:22658517 .................RNQI.-.--.......KFENG...YS........................
cwb_MDP0000297466|PACid:22645872 .................SNGI.S.LV.......ACGHI...IV........................
cwb_MDP0000281982|PACid:22629373 .................EGKV.I.G-.......VTSEG...ET........................
cwb_MDP0000053966|PACid:22620929 .................----.-.--.......-----...--........................
cwb_MDP0000795740|PACid:22666880 .................--DV.V.AI.......KTSRN...T-........................
cwb_MDP0000212327|PACid:22630830 ..........vtslleeKGTV.K.GVqyk....FKGSD...LE........................
cwb_MDP0000437365|PACid:22632357 .................----.-.--.......-----...--........................
cwb_MDP0000135231|PACid:22629791 .................----.-.--.......-----...--........................
cwb_MDP0000167343|PACid:22638473 .................ADGI.-.--.......EFDDN...TK........................
cwb_MDP0000222306|PACid:22645946 .................ADGI.-.--.......EFDDN...TK........................
cwb_MDP0000183517|PACid:22634175 .................----.-.--.......-----...--........................
cwb_MDP0000686821|PACid:22637777 .................GNLI.-.--.......RFENG...IY........................
cwb_MDP0000430157|PACid:22655785 .................----.-.--.......-----...--........................
cwb_MDP0000373054|PACid:22683333 .................KGTI.K.GV.......TYKNK...AG........................
cwb_MDP0000295306|PACid:22673308 .................----.-.--.......-----...--........................
cwb_MDP0000233995|PACid:22662680 .................GNLI.-.--.......KFANG...NY........................
cwb_MDP0000209681|PACid:22642739 .................GNLI.-.--.......KFANG...NY........................
cwb_MDP0000876898|PACid:22679933 .................----.-.--.......-----...--........................
cwb_MDP0000738522|PACid:22680891 .................----.-.--.......-----...--........................
cwb_MDP0000399642|PACid:22674547 .................----.-.--.......-----...-P........................
cwb_MDP0000215521|PACid:22667208 .................----.-.-I.......EFEDN...TK........................
cwb_MDP0000170521|PACid:22675770 .................----.-.--.......-----...--........................
cwb_MDP0000262982|PACid:22620906 .................PXQV.-.--.......ELVNG...ET........................
cwb_MDP0000321186|PACid:22667177 .................----.-.--.......-----...--........................
cwb_MDP0000266051|PACid:22641431 .................----.-.--.......-----...--........................
cwb_MDP0000837610|PACid:22643529 .................----.-.--.......-----...--........................
cwb_MDP0000582079|PACid:22634000 .................GDLI.-.--.......RFQNG...NV........................
cwb_MDP0000538071|PACid:22663035 .................----.-.--.......-----...--........................
cwb_MDP0000241703|PACid:22642424 .................----.-.--.......-----...--........................
cwb_MDP0000671114|PACid:22638724 .................----.-.--.......-----...--........................
cwb_MDP0000315388|PACid:22681954 .................----.-.--.......-----...--........................
cwb_MDP0000134271|PACid:22620865 .................GGIG.H.QT.......-----...-Ttqfpgnsnsxeygnllngdpvwev
cwb_MDP0000297581|PACid:22646099 .................---V.K.TVtste...STRSE...VE........................
cwb_MDP0000911003|PACid:22677366 .................EDAA.V.-L.......QLNEE...KI........................
cwb_MDP0000576650|PACid:22634720 .................----.-.--.......-----...--........................
cwb_MDP0000149205|PACid:22670334 .................----.-.--.......-----...--........................
cwb_MDP0000315409|PACid:22681973 .................----.-.--.......-----...--........................
cwb_MDP0000320804|PACid:22671446 .................----.-.--.......-----...--........................
cwb_MDP0000474647|PACid:22667377 .................----.-.--.......-----...--........................
cwb_MDP0000566648|PACid:22666666 .................----.-.--.......-----...--........................
cwb_MDP0000171379|PACid:22629613 .................----.-.--.......-----...--........................
cwb_MDP0000814529|PACid:22673539 .................----.-.--.......-----...--........................
cwb_MDP0000218295|PACid:22671514 .................----.-.--.......-----...--........................
cwb_MDP0000220943|PACid:22675739 .................GGID.D.HQ.......T----...-Ttqfpmnsisgeygnllnghpvwev
cwb_MDP0000795437|PACid:22664825 .................----.-.--.......-----...--........................
cwb_MDP0000919706|PACid:22656631 .................----.-.--.......-----...--........................
cwb_MDP0000295675|PACid:22626457 .................----.-.--.......-----...--........................
cwb_MDP0000147542|PACid:22652542 .................----.-.--.......-----...--........................
cwb_MDP0000272126|PACid:22655119 .................----.-.--.......-----...--........................
cwb_MDP0000196881|PACid:22654963 .................----.-.--.......-----...--........................
cwb_MDP0000268346|PACid:22678394 .................----.-.--.......-----...--........................
cwb_MDP0000147542|PACid:22652542 .................----.-.--.......-----...--........................
cwb_MDP0000948298|PACid:22676144 .................----.-.--.......-----...--........................
cwb_MDP0000220943|PACid:22675739 .................--GI.-.--.......EFEDN...TK........................
cwb_MDP0000182589|PACid:22648509 .................----.-.--.......-----...--........................
cwb_MDP0000557870|PACid:22631128 .................SNSV.-.--.......EFNNG...AR........................
cwb_MDP0000308870|PACid:22652882 .................----.-.--.......-----...--........................
cwb_MDP0000322449|PACid:22657441 .................----.-.--.......-----...--........................
cwb_MDP0000286494|PACid:22671310 .................----.-.--.......-----...--........................
cwb_MDP0000150868|PACid:22621264 .................----.-.--.......-----...--........................
cwb_MDP0000155608|PACid:22665289 .................----.-.--.......---DG...NS........................
cwb_MDP0000168505|PACid:22672316 .................----.-.--.......-----...--........................
cwb_MDP0000196888|PACid:22670849 .................----.-.--.......-----...--........................
cwb_MDP0000154812|PACid:22632894 .................----.-.--.......-----...--........................
cwb_MDP0000186080|PACid:22622639 .................----.-.--.......-----...--........................
cwb_MDP0000220012|PACid:22626541 .................----.-.--.......-----...--........................
cwb_MDP0000169409|PACid:22673915 .................----.-.--.......-----...--........................
cwb_MDP0000373095|PACid:22661923 .................----.-.--.......-----...--........................
cwb_MDP0000235846|PACid:22627807 .................----.-.--.......-----...--........................
cwb_MDP0000207126|PACid:22623152 .................----.-.--.......-----...--........................
cwb_MDP0000268357|PACid:22630891 .................----.-.--.......-----...--........................
cwb_MDP0000149067|PACid:22669209 .................----.-.--.......-----...--........................


                                             100                            110                     
                                               |                              |                     
d1xdia1                          ..............I.TAQ......LLSM........G......VQV.IAGRGEL............
cwb_MDP0000813172|PACid:22649115 ..............F.QASst....ILAT........G......GYG.RAYFSATsahtctgdgnam
cwb_MDP0000251581|PACid:22621152 ..............F.QASst....ILAT........G......GYG.RAYFSATsahtctgdgnam
cwb_MDP0000188391|PACid:22626210 ..............F.QASst....ILAT........G......GYG.RAYFSATsahtctgdgnam
cwb_MDP0000254144|PACid:22644986 ..............-.---......----........-......---.-------............
cwb_MDP0000321972|PACid:22643109 ..............F.IADaa....IITV........Ph.....GIL.KAKLIEFvpqlpewkvaai
cwb_MDP0000299806|PACid:22682346 ..............F.RGDm.....VLCTvplgvlkkG......SIE.F------............
cwb_MDP0000283451|PACid:22680462 ..............F.RGDm.....VLCTvplgvlkkG......SIE.F------............
cwb_MDP0000296714|PACid:22644308 ..............F.SGDai....LITV........Pl.....GCL.KAETIKF............
cwb_MDP0000162193|PACid:22629958 ..............F.SGDa.....VLVTv.......Pl.....GCL.KAETIKF............
cwb_MDP0000769741|PACid:22637873 ..............F.VADaa....VVAV........Pl.....GVL.KAKSITF............
cwb_MDP0000295277|PACid:22625688 ..............V.KGKni....IIAT........G......SDV.K------............
cwb_MDP0000897124|PACid:22647159 ..............V.KGKni....IIAT........G......SDV.K------............
cwb_MDP0000854208|PACid:22682207 ..............F.ISKvt....LLAS........G......GAG.QIYPTTT............
cwb_MDP0000241767|PACid:22665328 ..............F.SGDai....LITV........Pl.....GCL.KAETIKF............
cwb_MDP0000318858|PACid:22682838 ..............E.NNAi.....VLAV........Ga.....TKP.R------............
cwb_MDP0000248995|PACid:22642703 ..............A.KCKk.....VVCD........P......SY-.-------............
cwb_MDP0000442206|PACid:22660061 ..............E.NNAi.....VLAV........Ga.....TKP.R------............
cwb_MDP0000181673|PACid:22646891 ..............A.KCKk.....VVCD........P......SY-.-------............
cwb_MDP0000315409|PACid:22681973 ..............A.KCKk.....VVCD........-......---.-------............
cwb_MDP0000053966|PACid:22620929 ..............A.KCKk.....VVCD........P......S--.-------............
cwb_MDP0000294615|PACid:22655955 ..............A.KCKk.....VVCD........P......S--.-------............
cwb_MDP0000306147|PACid:22679041 ..............F.SGDai....LITV........Pl.....GCL.KAETIKF............
cwb_MDP0000180064|PACid:22628138 ..............F.FAKt.....IISN........A......TRW.NTFGKLIkadqvpkqeedf
cwb_MDP0000261625|PACid:22630921 ..............F.QANym....ILSV........Si.....GVL.QSNLIAF............
cwb_MDP0000300208|PACid:22651331 ..............Y.SAKhi....LIAT........G......SRA.Q------............
cwb_MDP0000247171|PACid:22623108 ..............I.KAKil....IGCD........G......IHS.V------............
cwb_MDP0000308095|PACid:22667065 ..............V.TADay....VAAC........-......---.-------............
cwb_MDP0000319421|PACid:22624123 ..............L.NPKvv....IGCD........G......VNS.I------............
cwb_MDP0000232295|PACid:22657598 ..............S.GGDv.....ILAA........Gal....GSP.Q--ILLLsgigphqhlnn.
cwb_MDP0000188994|PACid:22643055 ..............L.KAKvl....VGCD........G......VNS.V------............
cwb_MDP0000159189|PACid:22672554 ..............L.KAKvl....VGCD........G......VNS.V------............
cwb_MDP0000656178|PACid:22657871 ..............V.TAKdi....IIAT........G......SVP.F------............
cwb_MDP0000910523|PACid:22620639 ..............I.KAKvl....IGCD........G......IHS.VVGRSLGlaepvyagrsgv
cwb_MDP0000119941|PACid:22643547 ..............-.---......----........-......---.-------............
cwb_MDP0000231799|PACid:22673471 ..............X.TAKdi....IIAT........G......SVP.F------............
cwb_MDP0000255025|PACid:22624807 ..............V.KADay....VAAC........D......VPG.I------............
cwb_MDP0000231632|PACid:22622264 ..............L.SVDa.....VVM-........-......---.-------............
cwb_MDP0000173300|PACid:22648712 ..............I.EAKvt....ISAC........G......ALL.TPPLML-............
cwb_MDP0000158474|PACid:22655457 ..............L.LADkpqsevILST........G......AI-.-------............
cwb_MDP0000276878|PACid:22649644 ..............E.VFNgc....IIAV........-......---.-------............
cwb_MDP0000154720|PACid:22639222 ..............L.YAKlv....VGAD........G......SKS.R------............
cwb_MDP0000549646|PACid:22624756 ..............C.GHDgp....MGAT........Gvkrlr.S--.-------............
cwb_MDP0000158853|PACid:22672016 ..............-.---......----........-......---.-------............
cwb_MDP0000702799|PACid:22650781 ..............-.---......----........-......---.-------............
cwb_MDP0000233110|PACid:22669060 ..............I.EAKvt....ISAC........G......SLL.T------............
cwb_MDP0000260827|PACid:22621315 ..............A.YAPlt....VVCD........G......CFS.NLRRTLCdpkvdvpscfvg
cwb_MDP0000941459|PACid:22654340 ..............-.---......----........-......---.-------............
cwb_MDP0000185338|PACid:22637072 ..............L.--Rehgev.ILSA........G......AIG.SPQLLLLsgigp.......
cwb_MDP0000451172|PACid:22678939 ..............-.---......----........-......---.-------............
cwb_MDP0000136847|PACid:22626492 ..............-.---......----........-......---.-------............
cwb_MDP0000177641|PACid:22624304 ..............S.TGDv.....ILAA........G......ALG.S------............
cwb_MDP0000413935|PACid:22663920 ..............A.YAPlt....IVCD........G......CFS.NLRRSLCdpkvdvpscfvg
cwb_MDP0000206098|PACid:22637273 ..............C.GHDgp....MGAT........Gvkrlr.S--.-------............
cwb_MDP0000845788|PACid:22673064 ..............V.KCNsl....IFAT........G......ATA.K------............
cwb_MDP0000465595|PACid:22654474 ..............-.---......----........-......---.-------............
cwb_MDP0000137211|PACid:22645789 ..............V.VKDa.....LLEA........G......VRP.D------............
cwb_MDP0000130099|PACid:22624356 ..............-.---......----........-......---.-------............
cwb_MDP0000425135|PACid:22674685 ..............A.VLRehgev.ILSA........G......AIG.SPQLLLLsgigp.......
cwb_MDP0000200780|PACid:22660656 ........etlakeL.PPGaiv...IGCD........G......IRS.P------............
cwb_MDP0000142434|PACid:22683351 ..............I.KAXvv....IGCD........G......TKS.V------............
cwb_MDP0000248951|PACid:22626490 ..............-.---......----........-......---.-------............
cwb_MDP0000869086|PACid:22644121 ..............E.VFDav....VVAT........Ghy....SKP.R------............
cwb_MDP0000318256|PACid:22681338 ..............K.NLRva....IHAT........-......---.-VERIIF............
cwb_MDP0000231634|PACid:22622267 ..............L.SVDa.....VVMT........A......---.------Plcnxkemnitkr
cwb_MDP0000626995|PACid:22630905 ..............-.---......----........-......---.-------............
cwb_MDP0000123832|PACid:22633934 ..............I.KAKil....IGCD........G......IHS.V------............
cwb_MDP0000236092|PACid:22632501 ..............-.---......----........-......---.-------............
cwb_MDP0000199159|PACid:22674497 ..............E.VFDav....VVAT........Ghy....SKP.R------............
cwb_MDP0000162755|PACid:22662459 ..............L.KAKvl....VGCD........G......VNS.L------............
cwb_MDP0000173666|PACid:22649255 ..............L.SVDav....VM--........-......---.-------............
cwb_MDP0000262982|PACid:22620906 ..............Y.ICRwl....IVAT........Gen....AEC.V------............
cwb_MDP0000184832|PACid:22636281 ..............S.TGDv.....ILAA........G......ALG.SPQILLL............
cwb_MDP0000598927|PACid:22655979 ..............V.---......----........-......---.------Qfhptaladeglp
cwb_MDP0000561228|PACid:22637769 ..............-.---......----........-......---.-------............
cwb_MDP0000175650|PACid:22652650 ..............I.RCNil....VGTD........G......AGS.T------............
cwb_MDP0000233802|PACid:22672706 ..............V.LADsv....VVAT........G......AVA.K------............
cwb_MDP0000321186|PACid:22667177 ..............-.---......----........-......---.-------............
cwb_MDP0000161955|PACid:22660959 ..............S.YAPlt....IVCD........G......CFS.NLRRNLC............
cwb_MDP0000213381|PACid:22663844 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000168437|PACid:22624648 ..............L.SAHaplt..IVCD........G......CYS.NLRHSLCnpkvdipscfvg
cwb_MDP0000823251|PACid:22668430 ..............V.LADsv....VVAT........G......AVA.K------............
cwb_MDP0000191389|PACid:22631180 ..............S.YAPlt....IVCD........G......CFS.NLRRNLC............
cwb_MDP0000199319|PACid:22658752 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000857446|PACid:22649571 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000266638|PACid:22658651 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000208936|PACid:22641581 ..............I.EANvt....ISAC........G......SLL.T------............
cwb_MDP0000202883|PACid:22663993 ..............S.YAPlt....IVCD........G......CFS.NLRRNLC............
cwb_MDP0000288439|PACid:22643642 ..............S.TGDv.....ILAA........G......ALG.S------............
cwb_MDP0000295839|PACid:22658517 ..............Y.LAKfl....VVAS........Gen....SEG.Y------............
cwb_MDP0000903805|PACid:22678063 ..............K.NLRva....ILAT........-......---.-VERIIF............
cwb_MDP0000202123|PACid:22678734 ..............Y.SARhi....LVSV........G......GRP.F------............
cwb_MDP0000227773|PACid:22639029 ..............E.VFDav....VVAS........Ghy....SNP.R------............
cwb_MDP0000317524|PACid:22631851 ..............E.VFDav....VVAS........Ghy....SKP.R------............
cwb_MDP0000320748|PACid:22658808 ..............X.TYAplt...IVCD........G......CFS.NLRRSIS............
cwb_MDP0000634676|PACid:22625957 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000235846|PACid:22627807 ..............V.LADsv....VVAT........G......AVA.K------............
cwb_MDP0000251344|PACid:22682514 ..............V.LADsv....VVAT........G......AVA.K------............
cwb_MDP0000501957|PACid:22671723 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000209681|PACid:22642739 ..............Y.LGKfl....VVAS........Gensvg.YIP.H------............
cwb_MDP0000293482|PACid:22637734 ..............I.VGDll....VAAD........G......CLS.SIR----............
cwb_MDP0000233995|PACid:22662680 ..............Y.LGKfl....VVAS........Gensvg.YIP.H------............
cwb_MDP0000257243|PACid:22657003 ..............-.---......----........-......---.-------............
cwb_MDP0000160099|PACid:22658087 ..............E.VFDav....VVAS........Ghy....SNP.R------............
cwb_MDP0000193196|PACid:22649572 ..............T.YAPlt....IVCD........G......CFS.NLRRSIS............
cwb_MDP0000208234|PACid:22624840 ..............E.EYFggfl..VVAT........Gea....TNP.Y------............
cwb_MDP0000251783|PACid:22654795 ..............I.RGKgev...ILSA........G......---.-------............
cwb_MDP0000686885|PACid:22670382 ..............F.WGKxc....VVTV........G......AWT.TKLVKTVggielpiqplet
cwb_MDP0000138851|PACid:22674897 ..............E.EYFggfl..VLAT........Get....TDP.Y------............
cwb_MDP0000194930|PACid:22667971 ..............V.HSSi.....VLSN........-......---.-------............
cwb_MDP0000169201|PACid:22625917 ..............Y.LVDfv....ILCI........G......RFS.D------............
cwb_MDP0000399642|PACid:22674547 ..............Y.LVDfv....ILCI........G......RFS.D------............
cwb_MDP0000582079|PACid:22634000 ..............Y.LGKfl....VVAS........Gen....SIG.Y------............
cwb_MDP0000129765|PACid:22673448 ..............I.IGDll....IAAD........G......CLS.SIR----............
cwb_MDP0000272655|PACid:22672104 ..............K.NLRva....IHAT........-......---.-------............
cwb_MDP0000686821|PACid:22637777 ..............Y.LGKfl....VVAS........Gensvg.YIP.Q------............
cwb_MDP0000170414|PACid:22675630 ..............Y.LVDfv....ILCI........G......RFS.D------............
cwb_MDP0000320804|PACid:22671446 ..............H.VVDfv....ILCI........G......RFS.D------............
cwb_MDP0000189790|PACid:22676146 ..............F.TAHaplt..IVCD........G......CCS.NLRRYLCnp..........
cwb_MDP0000847111|PACid:22682055 ..............Y.LGKfl....VVAS........Gen....SIG.Y------............
cwb_MDP0000289536|PACid:22677728 ..............F.WGKkc....VVTV........G......AWT.TKLVKTVggvelpiqplet
cwb_MDP0000123987|PACid:22662898 ..............Y.LVDfv....ILCI........G......RFS.D------............
cwb_MDP0000245245|PACid:22671727 ..............Y.LVDfv....ILCI........G......RFS.D------............
cwb_MDP0000188553|PACid:22658192 ..............F.IADaa....IITV........Ph.....GIL.KANLIEFepqlpewkvaai
cwb_MDP0000296599|PACid:22628159 ..............I.DSDav....VLAM........Gp.....WCG.KFELLSS............
cwb_MDP0000746652|PACid:22636428 ..............S.YAPlt....IVCD........G......CFS.NLRRNLC............
cwb_MDP0000259265|PACid:22650727 ..............Y.SSDfl....VVAT........G......ENN.QAIIPAD............
cwb_MDP0000151331|PACid:22656760 ..............-.---......----........-......---.-------............
cwb_MDP0000309775|PACid:22670556 ..............W.GYDav....VLAV........G......HSA.RDFYQTLlshnidlipkdf
cwb_MDP0000232736|PACid:22657363 ..............-.---......----........-......---.-------............
cwb_MDP0000320539|PACid:22651795 ..............I.SYKil....IIAT........G......ARA.L------............
cwb_MDP0000239909|PACid:22648375 ..............-.---......----........-......---.-------............
cwb_MDP0000259264|PACid:22650726 ..............Y.SSDfl....VVAT........G......ENN.QAIIPAD............
cwb_MDP0000293613|PACid:22654008 ..............I.YAKvv....VNAA........G......---.-------............
cwb_MDP0000253362|PACid:22653297 ..............I.YAKvv....VNAA........G......---.-------............
cwb_MDP0000182973|PACid:22649063 ..............-.---......----........-......---.-------............
cwb_MDP0000138005|PACid:22620884 ..............V.PQ-......----........-......---.-------............
cwb_MDP0000261301|PACid:22674262 ..............-.---......----........-......---.-------............
cwb_MDP0000771633|PACid:22649768 ..............L.AVDvv....IGAD........G......ANS.RVAKSIKagdyacaiafqe
cwb_MDP0000851102|PACid:22674240 ..............L.AVDvv....IGAD........G......ANS.RVAKSIKagdyacaiafqe
cwb_MDP0000159873|PACid:22673571 ..............M.EVDav....IGAD........G......ANS.RVAKNIDagdyeyaiafqe
cwb_MDP0000140206|PACid:22652348 ..............F.EFEtl....IIAT........G......SRV.L---RLT............
cwb_MDP0000261201|PACid:22657417 ..............M.EVDav....IGAD........G......ANS.RVAKSIDagdyeyaiafqe
cwb_MDP0000252244|PACid:22643267 ..............M.EVDav....IGAD........G......ANS.RVAKSIDagdyeyaiafqe
cwb_MDP0000261821|PACid:22664612 ..............F.KYEtl....VIAT........G......STV.I---RLS............
cwb_MDP0000124454|PACid:22663639 ..............M.GGD......----........-......---.-------............
cwb_MDP0000234830|PACid:22664319 ..............T.YAKvv....VNAA........G......---.-------............
cwb_MDP0000297861|PACid:22646554 ..............V.YAPlt....IVCD........G......CFS.NLRCTLCkpqvevlscfvg
cwb_MDP0000152184|PACid:22632666 ..............I.SYKvl....IIAT........G......ARA.L------............
cwb_MDP0000157871|PACid:22670351 ..............F.EFEtl....IIAT........G......SRV.I---RLT............
cwb_MDP0000250932|PACid:22662666 ..............F.YAPsv....ILTT........G......TFM.S------............
cwb_MDP0000219521|PACid:22657613 ..............Y.AFEfi....VVCI........Gkyg...DTP.K------............
cwb_MDP0000239289|PACid:22649630 ..............-.---......----........-......---.-------............
cwb_MDP0000258995|PACid:22632347 ..............-.---......----........-......---.-------............
cwb_MDP0000167343|PACid:22638473 .........etiqwY.AFEfi....VVCI........G......KYG.D------............
cwb_MDP0000222306|PACid:22645946 .........etiqwY.AFEfi....VVCI........G......KYG.D------............
cwb_MDP0000829384|PACid:22650105 ..............-.---......----........-......---.-------............
cwb_MDP0000145663|PACid:22632174 ..............L.KASli....VDAS........G......FAS.S------............
cwb_MDP0000288439|PACid:22643642 ..............S.TGDv.....ILAA........Gal....GSP.Q------............
cwb_MDP0000267350|PACid:22676208 ..............F.KYQtl....VIAT........G......STV.I---RLT............
cwb_MDP0000155608|PACid:22665289 ..............L.YAKlv....VGAD........G......SKS.R------............
cwb_MDP0000194622|PACid:22683388 ..............I.QASvv....LDAT........G......FSR.C-LVQYD............
cwb_MDP0000134271|PACid:22620865 .avqmcsnpntiqwY.AFEfi....VVCI........G......KYG.DIPR---............
cwb_MDP0000312748|PACid:22644976 ..............-.---......----........-......---.-------............
cwb_MDP0000197715|PACid:22640206 ..............I.EAKvt....VSAC........G......ALL.TPHLMLS............
cwb_MDP0000220943|PACid:22675739 .avqmsnnpnmiqwY.AFEfi....VVCI........G......KYG.DIPRMPS............
cwb_MDP0000320539|PACid:22651795 ..............L.PADmv....VVGI........G......IRP.N------............
cwb_MDP0000140206|PACid:22652348 ..............L.QADiv....VVGV........G......AKP.L------............
cwb_MDP0000215521|PACid:22667208 vavqmsnipniiqwY.AFEfi....VVCI........G......KYG.DIPRMPS............
cwb_MDP0000203847|PACid:22681509 ..............M.EFDk.....IIIS........G......SFP.L------............
cwb_MDP0000201011|PACid:22661057 ..............L.EFDk.....IIIS........G......SFP.L------............
cwb_MDP0000204596|PACid:22635084 ..............F.SGDai....LITV........Pl.....GC-.------Lkaetikfspplp
cwb_MDP0000148978|PACid:22620687 ..............I.EADay....VFAT........P......VDI.L------............
cwb_MDP0000130369|PACid:22663416 ..............Y.NADav....VLAI........G......IST.-------............
cwb_MDP0000314606|PACid:22664349 ..............I.YAKvv....VNAA........G......PF-.-------............
cwb_MDP0000263146|PACid:22654671 ..............V.DYDyl....IVAM........G......AKT.N------............
cwb_MDP0000250583|PACid:22633065 ..............V.EYDwl....VLAL........G......AES.K------............
cwb_MDP0000208233|PACid:22624841 ..............-.KAKn.....I---........G......GSS.E------............
cwb_MDP0000158720|PACid:22655873 ..............V.EADyl....LIAS........GnskqgyS--.----LASqlghsivdpvps
cwb_MDP0000152184|PACid:22632666 ..............L.PADvv....VVGI........G......IRP.N------............
cwb_MDP0000182702|PACid:22680484 ..............F.FAKt.....IISN........A......TRW.NTFEEDFqkvyvqapsfls
cwb_MDP0000261638|PACid:22646820 ..............-.---......----........-......---.-------............
cwb_MDP0000130370|PACid:22654204 ..............Y.NADav....VLAI........G......IST.LQKIIENsavlctreeflk
cwb_MDP0000272119|PACid:22671033 ..............-.---......----........-......---.-------............
cwb_MDP0000305861|PACid:22662391 ..............V.DYDyl....IIAV........G......ANV.N------............
cwb_MDP0000255696|PACid:22677008 ..............V.DYDyl....IIAV........G......ANV.N------............
cwb_MDP0000214280|PACid:22681133 ..............-.---......----........-......---.-------............
cwb_MDP0000210966|PACid:22644665 ..............-.---......----........-......---.-------............
cwb_MDP0000610999|PACid:22659782 ..............-.---......----........-......---.-------............
cwb_MDP0000242546|PACid:22662348 ..............-.---......----........-......---.-------............
cwb_MDP0000320742|PACid:22645070 ..............-.--Hq.....TYAL........G......IKE.V------............
cwb_MDP0000654164|PACid:22658363 ..............L.FKKnkni..IIAT........G......SDV.K------............
cwb_MDP0000256300|PACid:22644503 ..............-.---......----........-......---.-------............
cwb_MDP0000235080|PACid:22654616 ..............LgQFKg.....VVAT........D......KNL.V------............
cwb_MDP0000284363|PACid:22634918 ..............L.EYDyl....VIAL........G......AQV.N------............
cwb_MDP0000125043|PACid:22648273 ..............-.---......----........-......---.-------............
cwb_MDP0000192359|PACid:22632529 ..............S.TGDv.....ILAA........Gal....GSP.-------............
cwb_MDP0000440005|PACid:22623062 ..............I.PYDyl....VIAT........G......HSD.R------............
cwb_MDP0000609131|PACid:22633588 ..............Y.TCDia....VVA-........-......---.-------............
cwb_MDP0000362000|PACid:22628256 ..............I.AYDkl....VIAL........G......AMP.T------............
cwb_MDP0000150210|PACid:22663655 ..............-.---......----........-......---.-------............
cwb_MDP0000158790|PACid:22624362 ..............V.SCRla....TVAS........G......AAS.G------............
cwb_MDP0000427950|PACid:22623610 ..............L.RQQhgal..LGCD........G......VNS.V------............
cwb_MDP0000569169|PACid:22666591 ..............-.---......----........-......---.-------............
cwb_MDP0000525742|PACid:22647174 ..............-.---......----........-......---.-------............
cwb_MDP0000559829|PACid:22672870 ..............-.---......----........-......---.-------............
cwb_MDP0000321788|PACid:22641842 ..............F.FAKt.....IISN........A......TRW.-------............
cwb_MDP0000919183|PACid:22661837 ..............V.PYGll....VWST........G......VGP.S------............
cwb_MDP0000146158|PACid:22623090 ..............V.PYGll....VWST........G......VGP.S------............
cwb_MDP0000832077|PACid:22645850 ..............-.---......----........-......---.-------............
cwb_MDP0000621365|PACid:22669861 ..............-.---......----........-......---.-------............
cwb_MDP0000875229|PACid:22620206 ..............L.EVDas....LIAT........G......RAP.F------............
cwb_MDP0000251344|PACid:22682514 ..............V.LADsv....VVAT........G......TVA.R------............
cwb_MDP0000168919|PACid:22641114 ..............F.TAHaplt..IVCD........G......CCS.NLRRYLCnpkvdipscfvg
cwb_MDP0000267855|PACid:22645516 ..............-.---......----........-......---.-------............
cwb_MDP0000195207|PACid:22668389 ..............-.---......----........-......---.-------............
cwb_MDP0000400145|PACid:22662498 ..............-.---......----........-......---.-------............
cwb_MDP0000919183|PACid:22661837 ..............V.AYDkl....VIAA........G......AEP.L------............
cwb_MDP0000307336|PACid:22681275 ..............-.---......----........-......---.-------............
cwb_MDP0000263146|PACid:22654671 ..............I.PYGmv....LWAT........G......IGP.R------............
cwb_MDP0000309730|PACid:22638555 ..............-.---......----........-......---.-------............
cwb_MDP0000163903|PACid:22648802 ..............I.AADch....FVCT........Akpm...GSS.-------............
cwb_MDP0000611628|PACid:22643604 ..............V.PYGll....VWST........G......VGP.S------............
cwb_MDP0000119779|PACid:22649695 ..............I.AADch....FVCT........Akpm...GSS.-------............
cwb_MDP0000120904|PACid:22629470 ..............F.TAHaplt..IVCD........G......CCS.NLRRYLCnp..........
cwb_MDP0000150544|PACid:22634453 ..............-.---......----........-......---.-------............
cwb_MDP0000902209|PACid:22678199 ..............-.---......----........-......---.-------............
cwb_MDP0000269370|PACid:22680893 ..............-.---......----........-......---.-------............
cwb_MDP0000146158|PACid:22623090 ..............V.AYDkl....XIAA........G......AEP.L------............
cwb_MDP0000124051|PACid:22654473 ..............T.SAD......FLAA........G......NPN.Y------............
cwb_MDP0000255696|PACid:22677008 ..............V.SAMpygma.LWST........G......IGT.R------............
cwb_MDP0000305861|PACid:22662391 ..............V.SAMpygma.LWST........Gig....TRP.F------............
cwb_MDP0000611628|PACid:22643604 ..............V.AYDkl....XIAA........G......AEP.L------............
cwb_MDP0000309622|PACid:22670269 ..............-.---......----........-......---.-------............
cwb_MDP0000239909|PACid:22648375 ..............V.LADti....LHCT........G......YKY.HFPFLETngtvtvddnr..
cwb_MDP0000126888|PACid:22675379 ..............-.---......----........-......---.-------............
cwb_MDP0000869086|PACid:22644121 ..............V.IADti....MYCT........G......YSY.TFPFLDTkgivtvdddrvs
cwb_MDP0000317524|PACid:22631851 ..............E.VFDav....VVAS........Ghy....SKP.R------............
cwb_MDP0000160099|PACid:22658087 ..............I.TADti....IYCT........G......YSY.TFSFLDTkgivtvddnrvg
cwb_MDP0000251205|PACid:22649529 ..............-.---......----........-......---.-------............
cwb_MDP0000314335|PACid:22679828 ..............-.---......----........-......---.-------............
cwb_MDP0000638870|PACid:22646063 ..............-.---......----........-......---.-------............
cwb_MDP0000790657|PACid:22654829 ..............T.YAPlt....IVCD........G......CFS.NLRCSIS............
cwb_MDP0000748068|PACid:22649054 ..............-.---......----........-......---.-------............
cwb_MDP0000727481|PACid:22682921 ..............-.---......----........-......---.-------............
cwb_MDP0000301246|PACid:22669391 ..............-.---......----........-......---.-------............
cwb_MDP0000190684|PACid:22677586 ..............I.IADti....IYCT........G......YSY.TFPFLDTkgivavdddrvg
cwb_MDP0000456223|PACid:22643829 ..............-.---......----........-......---.-------............
cwb_MDP0000745172|PACid:22667211 ..............-.---......----........-......---.-------............
cwb_MDP0000407932|PACid:22626437 ..............-.---......----........-......---.------M............
cwb_MDP0000440896|PACid:22680420 ..............-.---......----........-......---.-------............
cwb_MDP0000694227|PACid:22673619 ..............F.QANym....ILSV........S......---.-------............
cwb_MDP0000123987|PACid:22662898 ..............L.QTDlv....ILAT........G......FRG.D------............
cwb_MDP0000138005|PACid:22620884 ..............F.IADaa....IITV........P......---.-------............
cwb_MDP0000258205|PACid:22638470 ..............F.KASli....VDAS........G......FAS.S------............
cwb_MDP0000245245|PACid:22671727 ..............L.QTDlv....ILAT........G......FRG.D------............
cwb_MDP0000306704|PACid:22680179 ..............T.KCKk.....VVCD........P......SY-.-------............
cwb_MDP0000478654|PACid:22674637 ..............-.---......----........-......---.-------............
cwb_MDP0000728219|PACid:22657389 ..............-.---......----........-......---.-------............
cwb_MDP0000170414|PACid:22675630 ..............V.KTDxv....ILAT........G......FRG.D------............
cwb_MDP0000284363|PACid:22634918 ..............I.PHGlv....VWST........Gxg....TRP.V------............
cwb_MDP0000219560|PACid:22625984 ..............L.LADh.....VI--........-......---.-------............
cwb_MDP0000235930|PACid:22635275 ..............L.VYDyl....VIAT........G......HKD.S------............
cwb_MDP0000755938|PACid:22650525 ..............I.KADvv....VLAT........G......YDG.KKKLKFIlpdpfrs.....
cwb_MDP0000138851|PACid:22674897 ..............Y.QFDai....IFCT........G......FKS.S------............
cwb_MDP0000261638|PACid:22646820 ..............-.---......----........-......---.-------............
cwb_MDP0000317524|PACid:22631851 ..............V.IADti....IYCT........G......YSY.TFPFLDTkgivtiddn...
cwb_MDP0000294615|PACid:22655955 ..............-.---......----........-......---.-------............
cwb_MDP0000208234|PACid:22624840 ..............Y.QFDai....ILCT........G......FKR.LT-----............
cwb_MDP0000216129|PACid:22668259 ..............-.---......----........-......---.-------............
cwb_MDP0000219521|PACid:22657613 ..............I.KADvv....VLAT........G......YDG.KKKLKFIlpdpfrs.....
cwb_MDP0000248995|PACid:22642703 ..............-.---......----........-......---.-------............
cwb_MDP0000256328|PACid:22629063 ..............V.AYDkl....VIAA........G......AEP.L------............
cwb_MDP0000181673|PACid:22646891 ..............-.---......----........-......---.-------............
cwb_MDP0000169201|PACid:22625917 ..............V.KTDvm....ILAT........G......FRG.D------............
cwb_MDP0000263530|PACid:22651991 ..............-.---......----........-......---.-------............
cwb_MDP0000295839|PACid:22658517 ..............N.HYDai....VFAT........G......YKS.T------............
cwb_MDP0000297466|PACid:22645872 ..............V.SCRla....TVAS........G......AAS.GK-----............
cwb_MDP0000281982|PACid:22629373 ..............A.KCKk.....VVCD........P......SY-.-------............
cwb_MDP0000053966|PACid:22620929 ..............-.---......----........-......---.-------............
cwb_MDP0000795740|PACid:22666880 ..............L.HCKkai...VVAA........G......CWS.GSL----............
cwb_MDP0000212327|PACid:22630830 ..............L.NAHaplt..IVGD........G......CYS.NLR----............
cwb_MDP0000437365|PACid:22632357 ..............-.---......----........-......---.-------............
cwb_MDP0000135231|PACid:22629791 ..............-.---......----........-......---.-------............
cwb_MDP0000167343|PACid:22638473 ..............I.KADvv....VLAT........G......YDG.KKKLKSIlxxpfrsllecp
cwb_MDP0000222306|PACid:22645946 ..............I.KADvv....VLAT........G......YDG.KKKLKSIlxxpfrsllecp
cwb_MDP0000183517|PACid:22634175 ..............-.---......----........-......---.-------............
cwb_MDP0000686821|PACid:22637777 ..............N.WYDai....IFAT........G......YKS.S------............
cwb_MDP0000430157|PACid:22655785 ..............-.---......----........-......---.-------............
cwb_MDP0000373054|PACid:22683333 ..............E.EMRsyvpltIVCD........G......CFS.YLR----............
cwb_MDP0000295306|PACid:22673308 ..............-.---......----........-......---.-------............
cwb_MDP0000233995|PACid:22662680 ..............N.WYDai....IFAT........G......YSS.S------............
cwb_MDP0000209681|PACid:22642739 ..............N.WYDai....IFAT........G......YSS.S------............
cwb_MDP0000876898|PACid:22679933 ..............-.---......----........-......---.-------............
cwb_MDP0000738522|PACid:22680891 ..............-.---......----........-......---.-------............
cwb_MDP0000399642|PACid:22674547 ..............V.KTDxx....ILAT........G......FRG.D------............
cwb_MDP0000215521|PACid:22667208 ..............L.QADvv....XLAT........G......YEG.KQKLQSIlpepfrslmvds
cwb_MDP0000170521|PACid:22675770 ..............-.---......----........-......---.-------............
cwb_MDP0000262982|PACid:22620906 ..............L.EIDsv....VLAT........G......YRS.N------............
cwb_MDP0000321186|PACid:22667177 ..............P.ETKv.....VLAY........G......AESdR------............
cwb_MDP0000266051|PACid:22641431 ..............-.---......----........-......---.-------............
cwb_MDP0000837610|PACid:22643529 ..............-.---......----........-......---.-------............
cwb_MDP0000582079|PACid:22634000 ..............D.SYNai....IFAT........G......YKS.S------............
cwb_MDP0000538071|PACid:22663035 ..............-.---......----........-......---.-------............
cwb_MDP0000241703|PACid:22642424 ..............-.---......----........-......---.-------............
cwb_MDP0000671114|PACid:22638724 ..............-.---......----........-......---.-------............
cwb_MDP0000315388|PACid:22681954 ..............-.---......----........-......---.-------............
cwb_MDP0000134271|PACid:22620865 .avqmcsnpntiqwY.AFEfi....VVCI........G......KYG.DIPR---............
cwb_MDP0000297581|PACid:22646099 ..............Y.ICRwl....IVAI........Gen....AEC.V------............
cwb_MDP0000911003|PACid:22677366 ..............L.SSRli....IDAM........G......NFS.PIVKQI-............
cwb_MDP0000576650|PACid:22634720 ..............-.---......----........-......---.-------............
cwb_MDP0000149205|PACid:22670334 ..............-.---......----........-......---.-------............
cwb_MDP0000315409|PACid:22681973 ..............-.---......----........-......---.-------............
cwb_MDP0000320804|PACid:22671446 ..............V.KSDli....ILAT........G......FRG.E------............
cwb_MDP0000474647|PACid:22667377 ..............-.---......----........-......---.-------............
cwb_MDP0000566648|PACid:22666666 ..............-.---......----........-......---.-------............
cwb_MDP0000171379|PACid:22629613 ..............-.---......----........-......---.-------............
cwb_MDP0000814529|PACid:22673539 ..............-.---......----........-......---.-------............
cwb_MDP0000218295|PACid:22671514 ..............-.---......----........-......---.-------............
cwb_MDP0000220943|PACid:22675739 .avqmsnnpnmiqwY.AFEfi....VVCI........G......KYG.DIPRMPS............
cwb_MDP0000795437|PACid:22664825 ..............-.---......----........-......---.-------............
cwb_MDP0000919706|PACid:22656631 ..............-.---......----........-......---.-------............
cwb_MDP0000295675|PACid:22626457 ..............-.---......----........-......---.-------............
cwb_MDP0000147542|PACid:22652542 ..............-.---......----........-......---.-------............
cwb_MDP0000272126|PACid:22655119 ..............-.---......----........-......---.-------............
cwb_MDP0000196881|PACid:22654963 ..............-.---......----........-......---.-------............
cwb_MDP0000268346|PACid:22678394 ..............-.---......----........-......---.-------............
cwb_MDP0000147542|PACid:22652542 ..............-.---......----........-......---.-------............
cwb_MDP0000948298|PACid:22676144 ..............-.---......----........-......---.-------............
cwb_MDP0000220943|PACid:22675739 ..............L.QADvv....ILAT........G......YEG.KQKLQSI............
cwb_MDP0000182589|PACid:22648509 ..............-.---......----........-......---.-------............
cwb_MDP0000557870|PACid:22631128 ..............Q.SFDai....LLAT........G......YKS.VAHK---............
cwb_MDP0000308870|PACid:22652882 ..............-.---......----........-......---.-------............
cwb_MDP0000322449|PACid:22657441 ..............-.---......----........-......---.-------............
cwb_MDP0000286494|PACid:22671310 ..............-.---......----........-......---.-------............
cwb_MDP0000150868|PACid:22621264 ..............-.---......----........-......---.-------............
cwb_MDP0000155608|PACid:22665289 ..............L.YAKlv....VGAD........G......SKS.R------............
cwb_MDP0000168505|PACid:22672316 ..............-.---......----........-......---.-------............
cwb_MDP0000196888|PACid:22670849 ..............-.---......----........-......---.-------............
cwb_MDP0000154812|PACid:22632894 ..............-.---......----........-......---.-------............
cwb_MDP0000186080|PACid:22622639 ..............-.---......----........-......---.-------............
cwb_MDP0000220012|PACid:22626541 ..............-.---......----........-......---.-------............
cwb_MDP0000169409|PACid:22673915 ..............-.---......----........-......---.-------............
cwb_MDP0000373095|PACid:22661923 ..............-.---......----........-......---.-------............
cwb_MDP0000235846|PACid:22627807 ..............-.---......----........-......---.-------............
cwb_MDP0000207126|PACid:22623152 ..............-.---......----........-......---.-------............
cwb_MDP0000268357|PACid:22630891 ..............-.---......----........-......---.-------............
cwb_MDP0000149067|PACid:22669209 ..............-.---......----........-......---.-------............


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 varaglplqdlefvqfhptgiygagcliteg....................................
cwb_MDP0000251581|PACid:22621152 varaglplqdlefvqfhptgiygagcliteg....................................
cwb_MDP0000188391|PACid:22626210 varaglplqdlefvqfhptgiygagcliteg....................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 sdlgvgnenkvalrfekxfwp..............................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 qkvyvkapsflsihmgvkaevlppetdchhfvleddwtrlee.........................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 rglavfpqghgldnnvqqyvglnrrag........................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 lvlencnlp..........................................................
cwb_MDP0000941459|PACid:22654340 ...................................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 lile...............................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 gtlfpldffpevtyxpxsviittf...........................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 vxptkarenaflixeavrgdggilynldmerfmplyderaelaprdv....................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 lvlencqlpyanhghviladpspilfypissteirc...............................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 tvcywrikeghegafaiggdfptfasygnpyiygtpsleypglikvavnggypcdpdkrpwgpgnpl
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 tvcywrikegheggfaiggdfptfasygnpyiygtpsleypglikvavhggypcdpdnrpwgpgnpl
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 sdlgvgnenkialrfekvfwp..............................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 avglriehpqevvnslqysglatevrrgrgkvpvadykvakyvsgkdgeepsgatsrscysfcmcpg
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 riklpddkmdyyqdlaemyvgndvspdfy......................................
cwb_MDP0000851102|PACid:22674240 riklpddkmdyyqdlaemyvgndvspdfy......................................
cwb_MDP0000159873|PACid:22673571 rikipddkmvyyenlaemyvgddv...........................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 rikipddkmvyyenlaemyvgddv...........................................
cwb_MDP0000252244|PACid:22643267 rikipddkmvyyenlaemyvgddv...........................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 lvlencrlpfanhghv...................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 hwkhssilrlgfgvlnkv.................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 lftfkiedxq.........................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ihmev..............................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 vlnlasidalsvklwldrkvnipna..........................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 liledcqlpyanhahvilgdpslvsfypignmeirc...............................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 plyehtfppslapsls...................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 plyehtfppslapslsfvgipkkvigflffesq..................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 plyehtfppslapflsfvgiprk............................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 sgiipl.............................................................
cwb_MDP0000222306|PACid:22645946 sgiiplyrgti........................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 sg.................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                       120                130       140             
                                                         |                  |         |             
d1xdia1                          .......................IDSTPG.........LARHRIKATAADGSTS.............
cwb_MDP0000813172|PACid:22649115 .......................S-----.........----------------.............
cwb_MDP0000251581|PACid:22621152 .......................S-----.........----------------.............
cwb_MDP0000188391|PACid:22626210 .......................S-----.........----------------.............
cwb_MDP0000254144|PACid:22644986 .......................------.........----------------.............
cwb_MDP0000321972|PACid:22643109 .......................N-----.........----------------.............
cwb_MDP0000299806|PACid:22682346 .......................VPGLPQ.........RKKDAIQSIGFGLL--.............
cwb_MDP0000283451|PACid:22680462 .......................VPELPQ.........RKKDAIHGLGFGLLNK.............
cwb_MDP0000296714|PACid:22644308 .......................SPPLPH.........WKHSSILRLGF----Gvlnkvvlefpdv.
cwb_MDP0000162193|PACid:22629958 .......................SPPLPH.........WKHSSILR-------Lgfgvlnkvvlefp
cwb_MDP0000769741|PACid:22637873 .......................EPKLPD.........WKEAAIEDLG------.............
cwb_MDP0000295277|PACid:22625688 .......................SLPGIT.........IDEKKIVSSTGALALQ.............
cwb_MDP0000897124|PACid:22647159 .......................SLPGIT.........IDEKKIVSSTGALALQ.............
cwb_MDP0000854208|PACid:22682207 .......................NPPVAT.........--GDGIAMAHRAQAV-.............
cwb_MDP0000241767|PACid:22665328 .......................SPPLPH.........WKHSSILRLGF----Gvlnkvvlefpxv.
cwb_MDP0000318858|PACid:22682838 .......................DLPVPG.........RELSGVHFAMEFLRANtkslldsnledgn
cwb_MDP0000248995|PACid:22642703 .......................------.........----------------.............
cwb_MDP0000442206|PACid:22660061 .......................DLPVPG.........RELSGVHFAMEFLHANtkslldsnledgn
cwb_MDP0000181673|PACid:22646891 .......................------.........----------------.............
cwb_MDP0000315409|PACid:22681973 .......................------.........----------------.............
cwb_MDP0000053966|PACid:22620929 .......................------.........----------------.............
cwb_MDP0000294615|PACid:22655955 .......................------.........----------------.............
cwb_MDP0000306147|PACid:22679041 .......................SPPLPH.........WKHSSILRLGF----Gvlnkvvlefpxv.
cwb_MDP0000180064|PACid:22628138 .......................P-----.........----------------.............
cwb_MDP0000261625|PACid:22630921 .......................NPPLPR.........WKTEAIQKCDVIVYTKifl..........
cwb_MDP0000300208|PACid:22651331 .......................RPAIPG.........QELG--ISSDEALSLE.............
cwb_MDP0000247171|PACid:22623108 .......................VARWLG.........LAEPVYSGRWAVRGLA.............
cwb_MDP0000308095|PACid:22667065 .......................--DVPG.........IKRLLPSQWREWDFF-.............
cwb_MDP0000319421|PACid:22624123 .......................VSNVMG.........XKASNIFRICVIRGFT.............
cwb_MDP0000232295|PACid:22657598 .......................F-----.........----------------.............
cwb_MDP0000188994|PACid:22643055 .......................VAKWLG.........FKQPAFTGRSAIRGLAnfksshgfdpifm
cwb_MDP0000159189|PACid:22672554 .......................VAKWLG.........FKQPAFTGRSAIRGLAnfksshgfdpifm
cwb_MDP0000656178|PACid:22657871 .......................VPKGIE.........VDGKTVITSDHALKLE.............
cwb_MDP0000910523|PACid:22620639 .......................F-----.........----------------.............
cwb_MDP0000119941|PACid:22643547 .......................------.........----------------.............
cwb_MDP0000231799|PACid:22673471 .......................VPKGVE.........VDGKTVITSDHALKLE.............
cwb_MDP0000255025|PACid:22624807 .......................KRLLPS.........-------QWRELDFFN.............
cwb_MDP0000231632|PACid:22622264 .......................TAPLCN.........VKEMNITKRGTLFPLD.............
cwb_MDP0000173300|PACid:22648712 .......................-----S.........----------------.............
cwb_MDP0000158474|PACid:22655457 .......................------.........----------------.............
cwb_MDP0000276878|PACid:22649644 .......................------.........----------------.............
cwb_MDP0000154720|PACid:22639222 .......................VRELAG.........FKTTGWSYSQNAIICTvehsvenrcawqr
cwb_MDP0000549646|PACid:22624756 .......................VGMIES.........VPGMKALDMNTAEDAI.............
cwb_MDP0000158853|PACid:22672016 .......................------.........----------------.............
cwb_MDP0000702799|PACid:22650781 .......................------.........----------------.............
cwb_MDP0000233110|PACid:22669060 .......................PPLMI-.........----------------.............
cwb_MDP0000260827|PACid:22621315 .......................H-----.........----------------.............
cwb_MDP0000941459|PACid:22654340 .......................------.........----------------.............
cwb_MDP0000185338|PACid:22637072 .......................RPYLSS.........WGIPVAHHLSYVGQYL.............
cwb_MDP0000451172|PACid:22678939 .......................------.........----------------.............
cwb_MDP0000136847|PACid:22626492 .......................------.........----------------.............
cwb_MDP0000177641|PACid:22624304 .......................------.........----------------.............
cwb_MDP0000413935|PACid:22663920 .......................N-----.........----------------.............
cwb_MDP0000206098|PACid:22637273 .......................VGMIES.........VPGMKALDMNTAEDAI.............
cwb_MDP0000845788|PACid:22673064 .......................RLRIPRede......FWSRGISACAICDGASpl...........
cwb_MDP0000465595|PACid:22654474 .......................------.........----------------.............
cwb_MDP0000137211|PACid:22645789 .......................------.........----------------.............
cwb_MDP0000130099|PACid:22624356 .......................------.........----------------.............
cwb_MDP0000425135|PACid:22674685 .......................R-----.........----------------.............
cwb_MDP0000200780|PACid:22660656 .......................IATWMG.........FPEPKYVGHCAFRGLAsypdgqp......
cwb_MDP0000142434|PACid:22683351 .......................VADFIG.........VKPSKPFMLSEVRGFTv............
cwb_MDP0000248951|PACid:22626490 .......................------.........----------------.............
cwb_MDP0000869086|PACid:22644121 .......................LPSIQGmda......WKRKQLHSHIYRVPEP.............
cwb_MDP0000318256|PACid:22681338 .......................SSKASG.........LSAKGIIYSDSNGRSHral..........
cwb_MDP0000231634|PACid:22622267 .......................K-----.........----------------.............
cwb_MDP0000626995|PACid:22630905 .......................------.........----------------.............
cwb_MDP0000123832|PACid:22633934 .......................VARWLG.........LAEPVYSGRWAVRGLA.............
cwb_MDP0000236092|PACid:22632501 .......................------.........----------------.............
cwb_MDP0000199159|PACid:22674497 .......................LPSIKGmda......WKRKQMHSHIYR----.............
cwb_MDP0000162755|PACid:22662459 .......................VAKWLG.........FKQPAFTGRSAVRGY-.............
cwb_MDP0000173666|PACid:22649255 .......................TAPLCN.........XKEMNITKRGTLFPLD.............
cwb_MDP0000262982|PACid:22620906 .......................VPEINGlse......FGAEVMHACEYKSGEN.............
cwb_MDP0000184832|PACid:22636281 .......................------.........----------------.............
cwb_MDP0000598927|PACid:22655979 .......................VAR---.........---------------Ciddqlkkrnekyv
cwb_MDP0000561228|PACid:22637769 .......................------.........----------------.............
cwb_MDP0000175650|PACid:22652650 .......................VRKLAG.........VDMRGEKDLQKLVSVH.............
cwb_MDP0000233802|PACid:22672706 .......................RLPFPGsee......YWNRGISACAVCDGAApi...........
cwb_MDP0000321186|PACid:22667177 .......................VLGIPG.........EDLSGVYAAREFVWWYnghpnsrylnpdl
cwb_MDP0000161955|PACid:22660959 .......................TPKVDN.........PSCFVGLILENCDLPY.............
cwb_MDP0000213381|PACid:22663844 .......................TPNIEN.........PSCFVGLIL-------.............
cwb_MDP0000168437|PACid:22624648 .......................L-----.........----------------.............
cwb_MDP0000823251|PACid:22668430 .......................RLPFPGsee......YWNRGISACAVCDGAApi...........
cwb_MDP0000191389|PACid:22631180 .......................TPKVDN.........PSCFVGLILENCD---.............
cwb_MDP0000199319|PACid:22658752 .......................TPNIEN.........PSCFVGLI--------.............
cwb_MDP0000857446|PACid:22649571 .......................TPNIEN.........PSCFVGLIL-------.............
cwb_MDP0000266638|PACid:22658651 .......................TPNIEN.........PSCFVGLIL-------.............
cwb_MDP0000208936|PACid:22641581 .......................PPLMIS.........----------------.............
cwb_MDP0000202883|PACid:22663993 .......................TPKVDN.........PSCF------------.............
cwb_MDP0000288439|PACid:22643642 .......................------.........----------------.............
cwb_MDP0000295839|PACid:22658517 .......................IPQVEGlns......FKGEFVHSSEYENGKK.............
cwb_MDP0000903805|PACid:22678063 .......................SSKASG.........LSAKGIIYSDSNGRSHral..........
cwb_MDP0000202123|PACid:22678734 .......................IPEIPG.........SEY--AIDSDAALDLP.............
cwb_MDP0000227773|PACid:22639029 .......................LPSIKGmda......WKRKQMHSHIYRVPEP.............
cwb_MDP0000317524|PACid:22631851 .......................LPSIKGmda......WKRKQMHSHIYRVPEP.............
cwb_MDP0000320748|PACid:22658808 .......................SPNIEN.........PSCFVGL---------.............
cwb_MDP0000634676|PACid:22625957 .......................TPNIEN.........PSCFVGLI--------.............
cwb_MDP0000235846|PACid:22627807 .......................RLQFPGsee......YWNRGISACAVCDGAApi...........
cwb_MDP0000251344|PACid:22682514 .......................RLQFPGsee......YWNRGISACAVCDGAApi...........
cwb_MDP0000501957|PACid:22671723 .......................TPNIEN.........PSCFVGMIL-------.............
cwb_MDP0000209681|PACid:22642739 .......................VQGLDG.........FKGEAVHSSKYENGRK.............
cwb_MDP0000293482|PACid:22637734 .......................QSFVPD.........HKLRYSGYCAWRGXLD.............
cwb_MDP0000233995|PACid:22662680 .......................VQGLDG.........FKGEAVHSSKYENGRK.............
cwb_MDP0000257243|PACid:22657003 .......................------.........----------------.............
cwb_MDP0000160099|PACid:22658087 .......................LPSIKGmda......WKRKQMHSHIYRVPEP.............
cwb_MDP0000193196|PACid:22649572 .......................TPNIEN.........PSCFVGMIL-------.............
cwb_MDP0000208234|PACid:22624840 .......................TPEIEGlss......FNGDVLHSTKYKSGKE.............
cwb_MDP0000251783|PACid:22654795 .......................------.........----------------.............
cwb_MDP0000686885|PACid:22670382 ..........aplkewiegtfsgV-----.........---------------Vdsggpvatqlcmy
cwb_MDP0000138851|PACid:22674897 .......................IPEIEGlss......FNGDVLHSTKYKSGKE.............
cwb_MDP0000194930|PACid:22667971 .......................------.........----------------.............
cwb_MDP0000169201|PACid:22625917 .......................VPNIPEfpfnkgpeaFHGEVIHSKDYAAMDYerarnf.......
cwb_MDP0000399642|PACid:22674547 .......................VPNIPEfpfnkgpeaFHGEVIHSKDYAAMDYerarnf.......
cwb_MDP0000582079|PACid:22634000 .......................VPEVQGlde......FKGEAIHSSNYENGKK.............
cwb_MDP0000129765|PACid:22673448 .......................QSFVPD.........HKLRYSGYCAWRGVLD.............
cwb_MDP0000272655|PACid:22672104 .......................------.........----------------.............
cwb_MDP0000686821|PACid:22637777 .......................VRGLDG.........FNGQAIHSSKYENGKK.............
cwb_MDP0000170414|PACid:22675630 .......................VPNIPEfpfnkgpeaFHGEVIHSKDYAAMDYerarnf.......
cwb_MDP0000320804|PACid:22671446 .......................VPNIPEfppnkgpeaFHGEVIHSMNYADMDYesaakf.......
cwb_MDP0000189790|PACid:22676146 .......................K-----.........VDIPSCFVGLILEDCQl............
cwb_MDP0000847111|PACid:22682055 .......................VPEVQGlde......FKGEAIHSSNYENGKK.............
cwb_MDP0000289536|PACid:22677728 ..........aplkewiegrfsgV-----.........---------------Vdsggpvatqlcmy
cwb_MDP0000123987|PACid:22662898 .......................VPNIPEfxfnkgpeaFHGEVIHSKDYAAMDYerarnf.......
cwb_MDP0000245245|PACid:22671727 .......................VPNIPEflfnkgpeaFHGEVIHSKDYAAMDYerarnf.......
cwb_MDP0000188553|PACid:22658192 .......................N-----.........----------------.............
cwb_MDP0000296599|PACid:22628159 .......................LFRVYG.........LKAHSIVLEPKEAEAItphalflsyypsq
cwb_MDP0000746652|PACid:22636428 .......................TPNVEN.........PSCFVGLILENCDLPH.............
cwb_MDP0000259265|PACid:22650727 .......................LPGLES.........FTGKVVHACDYKNGES.............
cwb_MDP0000151331|PACid:22656760 .......................------.........----------------.............
cwb_MDP0000309775|PACid:22670556 gqvvltstnpseicingmsfskrA-----.........----------------.............
cwb_MDP0000232736|PACid:22657363 .......................------.........----------------.............
cwb_MDP0000320539|PACid:22651795 .......................KLEEFGvkg......SDSENVCYLRDLADANrlvnlmes.....
cwb_MDP0000239909|PACid:22648375 .......................AEGINT.........WKGKQFHSHNYRHPEP.............
cwb_MDP0000259264|PACid:22650726 .......................LPGLES.........FTGKVVHACDYKNGES.............
cwb_MDP0000293613|PACid:22654008 .......................------.........----------------.............
cwb_MDP0000253362|PACid:22653297 .......................------.........----------------.............
cwb_MDP0000182973|PACid:22649063 .......................------.........----------------.............
cwb_MDP0000138005|PACid:22620884 .......................------.........----------------.............
cwb_MDP0000261301|PACid:22674262 .......................------.........----------------.............
cwb_MDP0000771633|PACid:22649768 .......................AWVFPK.........CDHVAVGTGTVCSKQDikvfqrai.....
cwb_MDP0000851102|PACid:22674240 .......................AWVFPK.........CDHVAVGTGTVCSKQDikvfqrai.....
cwb_MDP0000159873|PACid:22673571 .......................S-----.........----------------.............
cwb_MDP0000140206|PACid:22652348 .......................EFGVQG.........ADAKNIFYLREISDADklveaika.....
cwb_MDP0000261201|PACid:22657417 .......................S-----.........----------------.............
cwb_MDP0000252244|PACid:22643267 .......................S-----.........----------------.............
cwb_MDP0000261821|PACid:22664612 .......................DFGVKG.........ADAKNIFYLREIDDADklneaika.....
cwb_MDP0000124454|PACid:22663639 .......................HCFLPG.........GNGRLVHALAENLPILyerivntvrygi.
cwb_MDP0000234830|PACid:22664319 .......................------.........----------------.............
cwb_MDP0000297861|PACid:22646554 .......................I-----.........----------------.............
cwb_MDP0000152184|PACid:22632666 .......................KLEEFGvkg......SDSGNVCYLRDLADANrlvdlmes.....
cwb_MDP0000157871|PACid:22670351 .......................EFGVQG.........DHAKNIFYLREISDADklveaira.....
cwb_MDP0000250932|PACid:22662666 .......................------.........----------------.............
cwb_MDP0000219521|PACid:22657613 .......................IPEFPH.........NKGPEVFQGQALHALDyckldkdaasql.
cwb_MDP0000239289|PACid:22649630 .......................------.........----------------.............
cwb_MDP0000258995|PACid:22632347 .......................------.........----------------.............
cwb_MDP0000167343|PACid:22638473 .......................XPQIPEfplnkgpevFQGQALHTLDYCKLDKdaasel.......
cwb_MDP0000222306|PACid:22645946 .......................XPQIPEfplnkgpevFQGQALHTLDYCKLDKdaasel.......
cwb_MDP0000829384|PACid:22650105 .......................------.........----------------.............
cwb_MDP0000145663|PACid:22632174 .......................FIEYEK.........PRNHGYQIAHGILAEV.............
cwb_MDP0000288439|PACid:22643642 .......................------.........----------------.............
cwb_MDP0000267350|PACid:22676208 .......................DFGVKG.........ADAKNIFYLREIDDADklyeaika.....
cwb_MDP0000155608|PACid:22665289 .......................VRELAG.........FKTTGWNYSQNAIICT.............
cwb_MDP0000194622|PACid:22683388 .......................KPYNPG.........YQVAYGILAEVEEHPF.............
cwb_MDP0000134271|PACid:22620865 .......................MPNFPRnkgqev...FQGKVLHSM------Dyskldqqaarel.
cwb_MDP0000312748|PACid:22644976 .......................------.........----------------.............
cwb_MDP0000197715|PACid:22640206 .......................------.........----------------.............
cwb_MDP0000220943|PACid:22675739 .......................FPRNKGqev......FQGKVLHSLDYSKLDQraarel.......
cwb_MDP0000320539|PACid:22651795 .......................TSLFEG.........----------------.............
cwb_MDP0000140206|PACid:22652348 .......................TDLFKGq........VD--------------.............
cwb_MDP0000215521|PACid:22667208 .......................FPRNKGqev......FQGKVLHSMDYSKLDQraarel.......
cwb_MDP0000203847|PACid:22681509 .......................------.........----------------.............
cwb_MDP0000201011|PACid:22661057 .......................------.........----------------.............
cwb_MDP0000204596|PACid:22635084 .......................VLEFPG.........----------------.............
cwb_MDP0000148978|PACid:22620687 .......................K-----.........----------------.............
cwb_MDP0000130369|PACid:22663416 .......................------.........----------------.............
cwb_MDP0000314606|PACid:22664349 .......................------.........----------------.............
cwb_MDP0000263146|PACid:22654671 .......................TFNTPG.........VEQYAHFLKGIEDAVRirqtvidcferas
cwb_MDP0000250583|PACid:22633065 .......................LDVVPG.........AVEFALPFSTLEDAHKvdrklrtlerkn.
cwb_MDP0000208233|PACid:22624841 .......................MEEYFGg........FFGGG---YRGSNRPE.............
cwb_MDP0000158720|PACid:22655873 .......................LRDLSG.........---------------Dlhgdtlwasiskn
cwb_MDP0000152184|PACid:22632666 .......................KSLFEG.........----------------.............
cwb_MDP0000182702|PACid:22680484 .......................K-----.........----------------.............
cwb_MDP0000261638|PACid:22646820 .......................------.........----------------.............
cwb_MDP0000130370|PACid:22654204 .......................CNACSG.........FDDSFGWTFFDLNAIYdd...........
cwb_MDP0000272119|PACid:22671033 .......................------.........----------------.............
cwb_MDP0000305861|PACid:22662391 .......................TFNTPG.........VMENCHFLKEVEDAQKirrtvidcfekas
cwb_MDP0000255696|PACid:22677008 .......................TFNTPG.........VMENCHFLKEVEDAQKirktvidcferas
cwb_MDP0000214280|PACid:22681133 .......................------.........----------------.............
cwb_MDP0000210966|PACid:22644665 .......................------.........----------------.............
cwb_MDP0000610999|PACid:22659782 .......................------.........----------------.............
cwb_MDP0000242546|PACid:22662348 .......................------.........----------------.............
cwb_MDP0000320742|PACid:22645070 .......................WEIDEGkh.......EPGAVLHTLGWPLDPK.............
cwb_MDP0000654164|PACid:22658363 .......................SLPGIT.........----------------.............
cwb_MDP0000256300|PACid:22644503 .......................------.........----------------.............
cwb_MDP0000235080|PACid:22654616 .......................XPRFTS.........VTGRQP----------.............
cwb_MDP0000284363|PACid:22634918 .......................TFNTPG.........VKENCHFLKASPEVEDaqkirmsvidcfe
cwb_MDP0000125043|PACid:22648273 .......................------.........----------------.............
cwb_MDP0000192359|PACid:22632529 .......................------.........----------------.............
cwb_MDP0000440005|PACid:22623062 .......................VPKTKT.........ARLNQF---Q-----Eenqki........
cwb_MDP0000609131|PACid:22633588 .......................------.........----------------.............
cwb_MDP0000362000|PACid:22628256 .......................TFGIQG.........VHEHAIFLREVSHAQEirrklllnlmlsd
cwb_MDP0000150210|PACid:22663655 .......................------.........----------------.............
cwb_MDP0000158790|PACid:22624362 .......................KLLQYE.........VGGPKVSVQT------.............
cwb_MDP0000427950|PACid:22623610 .......................VAKWLG.........FKQPAFTGRSAIRGLAnfksshgfdpifm
cwb_MDP0000569169|PACid:22666591 .......................------.........----------------.............
cwb_MDP0000525742|PACid:22647174 .......................------.........----------------.............
cwb_MDP0000559829|PACid:22672870 .......................------.........----------------.............
cwb_MDP0000321788|PACid:22641842 .......................------.........----------------.............
cwb_MDP0000919183|PACid:22661837 .......................------.........----------------.............
cwb_MDP0000146158|PACid:22623090 .......................------.........----------------.............
cwb_MDP0000832077|PACid:22645850 .......................------.........----------------.............
cwb_MDP0000621365|PACid:22669861 .......................------.........----------------.............
cwb_MDP0000875229|PACid:22620206 .......................------.........----------------.............
cwb_MDP0000251344|PACid:22682514 .......................RLHFTG.........TAGLIRPALHCVQRHPlsgqa........
cwb_MDP0000168919|PACid:22641114 .......................LVDVPG.........RQVPSISSGEWLTTWKqr...........
cwb_MDP0000267855|PACid:22645516 .......................------.........----------------.............
cwb_MDP0000195207|PACid:22668389 .......................------.........----------------.............
cwb_MDP0000400145|PACid:22662498 .......................------.........----------------.............
cwb_MDP0000919183|PACid:22661837 .......................TFGIKG.........VKEHAFFLREVNHAQEirkklllnlmlse
cwb_MDP0000307336|PACid:22681275 .......................------.........----------------.............
cwb_MDP0000263146|PACid:22654671 .......................-PEIVD.........----------------.............
cwb_MDP0000309730|PACid:22638555 .......................------.........----------------.............
cwb_MDP0000163903|PACid:22648802 .......................------.........----------------.............
cwb_MDP0000611628|PACid:22643604 .......................------.........----------------.............
cwb_MDP0000119779|PACid:22649695 .......................------.........----------------.............
cwb_MDP0000120904|PACid:22629470 .......................K-----.........VDIPSCFVGLILEDCQl............
cwb_MDP0000150544|PACid:22634453 .......................------.........----------------.............
cwb_MDP0000902209|PACid:22678199 .......................------.........----------------.............
cwb_MDP0000269370|PACid:22680893 .......................P-----.........----------------.............
cwb_MDP0000146158|PACid:22623090 .......................TFGIKG.........VKEHAFFLREVNHAQEirkklllnlmlse
cwb_MDP0000124051|PACid:22654473 .......................------.........----------------.............
cwb_MDP0000255696|PACid:22677008 .......................------.........----------------.............
cwb_MDP0000305861|PACid:22662391 .......................IKD---.........----------------.............
cwb_MDP0000611628|PACid:22643604 .......................TFGIKG.........VKEHAFFLREVNHAQEirkklllnlmlse
cwb_MDP0000309622|PACid:22670269 .......................------.........----------------.............
cwb_MDP0000239909|PACid:22648375 .......................V-----.........----------------.............
cwb_MDP0000126888|PACid:22675379 .......................------.........----------------.............
cwb_MDP0000869086|PACid:22644121 .......................F-----.........----------------.............
cwb_MDP0000317524|PACid:22631851 .......................LPSIKGmda......WKRKQMHSHIYRVPEP.............
cwb_MDP0000160099|PACid:22658087 .......................A-----.........----------------.............
cwb_MDP0000251205|PACid:22649529 .......................------.........----------------.............
cwb_MDP0000314335|PACid:22679828 .......................IPREDE.........FWSRGISACAICDGASpl...........
cwb_MDP0000638870|PACid:22646063 .......................------.........----------------.............
cwb_MDP0000790657|PACid:22654829 .......................TPNENN.........RRTN------------.............
cwb_MDP0000748068|PACid:22649054 .......................------.........----------------.............
cwb_MDP0000727481|PACid:22682921 .......................------.........----------------.............
cwb_MDP0000301246|PACid:22669391 .......................------.........----------------.............
cwb_MDP0000190684|PACid:22677586 .......................I-----.........----------------.............
cwb_MDP0000456223|PACid:22643829 .......................------.........----------------.............
cwb_MDP0000745172|PACid:22667211 .......................------.........----------------.............
cwb_MDP0000407932|PACid:22626437 .......................------.........----------------.............
cwb_MDP0000440896|PACid:22680420 .......................------.........----------------.............
cwb_MDP0000694227|PACid:22673619 .......................------.........----------------.............
cwb_MDP0000123987|PACid:22662898 .......................------.........KKLKDIFVSPTFQDYIagspeailplyre
cwb_MDP0000138005|PACid:22620884 .......................------.........----------------.............
cwb_MDP0000258205|PACid:22638470 .......................------.........----------------.............
cwb_MDP0000245245|PACid:22671727 .......................------.........KKLKDIFVSPTFQDYIagspeailplyre
cwb_MDP0000306704|PACid:22680179 .......................------.........----------------.............
cwb_MDP0000478654|PACid:22674637 .......................------.........----------------.............
cwb_MDP0000728219|PACid:22657389 .......................-----R.........FKGQYFHSRQYKHPDG.............
cwb_MDP0000170414|PACid:22675630 .......................------.........KKLKDIFXSPTFQDYI.............
cwb_MDP0000284363|PACid:22634918 .......................VRDFMQqigq.....ADKRV-----------.............
cwb_MDP0000219560|PACid:22625984 .......................------.........----------------.............
cwb_MDP0000235930|PACid:22635275 .......................V-----.........----------------.............
cwb_MDP0000755938|PACid:22650525 .......................L-----.........----------------.............
cwb_MDP0000138851|PACid:22674897 .......................------.........----------------.............
cwb_MDP0000261638|PACid:22646820 .......................------.........----------------.............
cwb_MDP0000317524|PACid:22631851 .......................R-----.........----------------.............
cwb_MDP0000294615|PACid:22655955 .......................------.........----------------.............
cwb_MDP0000208234|PACid:22624840 .......................------.........----------------.............
cwb_MDP0000216129|PACid:22668259 .......................------.........----------------.............
cwb_MDP0000219521|PACid:22657613 .......................L-----.........----------------.............
cwb_MDP0000248995|PACid:22642703 .......................------.........----------------.............
cwb_MDP0000256328|PACid:22629063 .......................TFGIKG.........VKEHAFFLREVNHAQE.............
cwb_MDP0000181673|PACid:22646891 .......................------.........----------------.............
cwb_MDP0000169201|PACid:22625917 .......................------.........KKLKDIFVSPTFQDYI.............
cwb_MDP0000263530|PACid:22651991 .......................------.........----------------.............
cwb_MDP0000295839|PACid:22658517 .......................VLNWLK.........----------------.............
cwb_MDP0000297466|PACid:22645872 .......................LLQLAT.........--VASGAASGKLLQYE.............
cwb_MDP0000281982|PACid:22629373 .......................------.........----------------.............
cwb_MDP0000053966|PACid:22620929 .......................------.........----------------.............
cwb_MDP0000795740|PACid:22666880 .......................------.........----------------.............
cwb_MDP0000212327|PACid:22630830 .......................------.........----------------.............
cwb_MDP0000437365|PACid:22632357 .......................------.........----------------.............
cwb_MDP0000135231|PACid:22629791 .......................------.........----------------.............
cwb_MDP0000167343|PACid:22638473 .......................Y-----.........----------------.............
cwb_MDP0000222306|PACid:22645946 .......................H-----.........----------------.............
cwb_MDP0000183517|PACid:22634175 .......................------.........----------------.............
cwb_MDP0000686821|PACid:22637777 .......................VLNWLKddncy....FNDNGMPRKRFP----.............
cwb_MDP0000430157|PACid:22655785 .......................------.........----------------.............
cwb_MDP0000373054|PACid:22683333 .......................------.........----------------.............
cwb_MDP0000295306|PACid:22673308 .......................------.........----------------.............
cwb_MDP0000233995|PACid:22662680 .......................VLNWFK.........DD--------------.............
cwb_MDP0000209681|PACid:22642739 .......................VLNWFK.........DD--------------.............
cwb_MDP0000876898|PACid:22679933 .......................------.........----------------.............
cwb_MDP0000738522|PACid:22680891 .......................------.........----------------.............
cwb_MDP0000399642|PACid:22674547 .......................------.........KKLKDIFVSPTFQDYIagspeailplyre
cwb_MDP0000215521|PACid:22667208 .......................T-----.........----------------.............
cwb_MDP0000170521|PACid:22675770 .......................------.........----------------.............
cwb_MDP0000262982|PACid:22620906 .......................VPSWLQegdf.....F---------------.............
cwb_MDP0000321186|PACid:22667177 .......................VLGIPG.........EDLSGVYAAREFVWWYnghpnsrylnpdl
cwb_MDP0000266051|PACid:22641431 .......................---LEG.........FKGEAIHSSKYENGTK.............
cwb_MDP0000837610|PACid:22643529 .......................------.........----------------.............
cwb_MDP0000582079|PACid:22634000 .......................VLN---.........----------------.............
cwb_MDP0000538071|PACid:22663035 .......................------.........----------------.............
cwb_MDP0000241703|PACid:22642424 .......................------.........----------------.............
cwb_MDP0000671114|PACid:22638724 .......................------.........----------------.............
cwb_MDP0000315388|PACid:22681954 .......................-----G.........----------------.............
cwb_MDP0000134271|PACid:22620865 .......................MPNFPRnkgqev...FQGKVLHSM------Dyskldqqaarel.
cwb_MDP0000297581|PACid:22646099 .......................VPEINGlse......FGAEDMHTCEYKSGEN.............
cwb_MDP0000911003|PACid:22677366 .......................------.........----------------.............
cwb_MDP0000576650|PACid:22634720 .......................------.........----------------.............
cwb_MDP0000149205|PACid:22670334 .......................------.........----------------.............
cwb_MDP0000315409|PACid:22681973 .......................------.........----------------.............
cwb_MDP0000320804|PACid:22671446 .......................------.........KKLKDMFVSPTFQDYIlgspksi......
cwb_MDP0000474647|PACid:22667377 .......................------.........----------------.............
cwb_MDP0000566648|PACid:22666666 .......................------.........----------------.............
cwb_MDP0000171379|PACid:22629613 .......................------.........----------------.............
cwb_MDP0000814529|PACid:22673539 .......................------.........----------------.............
cwb_MDP0000218295|PACid:22671514 .......................------.........----------------.............
cwb_MDP0000220943|PACid:22675739 .......................FPRNKGqev......FQGKVLHSLDYSKLDQraarel.......
cwb_MDP0000795437|PACid:22664825 .......................------.........----------------.............
cwb_MDP0000919706|PACid:22656631 .......................------.........----------------.............
cwb_MDP0000295675|PACid:22626457 .......................------.........----------------.............
cwb_MDP0000147542|PACid:22652542 .......................------.........----------------.............
cwb_MDP0000272126|PACid:22655119 .......................------.........----------------.............
cwb_MDP0000196881|PACid:22654963 .......................------.........----------------.............
cwb_MDP0000268346|PACid:22678394 .......................------.........----------------.............
cwb_MDP0000147542|PACid:22652542 .......................------.........----------------.............
cwb_MDP0000948298|PACid:22676144 .......................------.........--------C-------.............
cwb_MDP0000220943|PACid:22675739 .......................LP----.........----------------.............
cwb_MDP0000182589|PACid:22648509 .......................------.........----------------.............
cwb_MDP0000557870|PACid:22631128 .......................------.........----------------.............
cwb_MDP0000308870|PACid:22652882 .......................------.........----------------.............
cwb_MDP0000322449|PACid:22657441 .......................------.........LEEPIYHFGQF-----.............
cwb_MDP0000286494|PACid:22671310 .......................------.........----------------.............
cwb_MDP0000150868|PACid:22621264 .......................------.........--------C-------.............
cwb_MDP0000155608|PACid:22665289 .......................VRELAG.........FKTTGWNYSQNAI---.............
cwb_MDP0000168505|PACid:22672316 .......................------.........----------------.............
cwb_MDP0000196888|PACid:22670849 .......................------.........----------------.............
cwb_MDP0000154812|PACid:22632894 .......................------.........----------------.............
cwb_MDP0000186080|PACid:22622639 .......................------.........----------------.............
cwb_MDP0000220012|PACid:22626541 .......................------.........----------------.............
cwb_MDP0000169409|PACid:22673915 .......................------.........----------------.............
cwb_MDP0000373095|PACid:22661923 .......................------.........----------------.............
cwb_MDP0000235846|PACid:22627807 .......................------.........----------------.............
cwb_MDP0000207126|PACid:22623152 .......................--GIPK.........HDTH------------.............
cwb_MDP0000268357|PACid:22630891 .......................------.........----------------.............
cwb_MDP0000149067|PACid:22669209 .......................------.........----------------.............


                                                                 150       160                      
                                                                   |         |                      
d1xdia1                          ...............EHEA..........DVVLVATGASPRILPS......................
cwb_MDP0000813172|PACid:22649115 ...............----..........---------------Rgeggilrnsegerfmeryapta
cwb_MDP0000251581|PACid:22621152 ...............----..........---------------Rgeggilrnsegerfmeryapta
cwb_MDP0000188391|PACid:22626210 ...............----..........---------------Rgeggilrnsegerfmeryapta
cwb_MDP0000254144|PACid:22644986 ...............----..........--------DEGVEVIAgdqvfrgdmvlctvplgvlkkg
cwb_MDP0000321972|PACid:22643109 ...............----..........---------------Vellgivapnsyacgyflnlhka
cwb_MDP0000299806|PACid:22682346 ...............----..........---------------Nkvailfpynfwggdidtfghlt
cwb_MDP0000283451|PACid:22680462 ...............----..........--------------VAilfpynfwggdidtfghltedl
cwb_MDP0000296714|PACid:22644308 ...............FWDD..........SVDYFGATAEETELRGqcfmfwnvkktvgapvlialvv
cwb_MDP0000162193|PACid:22629958 .............dvFWDD..........SVDYFGATAEETDLRGqcfmfwnvkktvgapvlialvv
cwb_MDP0000769741|PACid:22637873 ...............----..........---------------Vgienkivlhfenvfwpnveflg
cwb_MDP0000295277|PACid:22625688 ...............EIPK..........KLVVVGAGYIGLEMGSvwgrlgsevtvvefgpdivpsm
cwb_MDP0000897124|PACid:22647159 ...............EIPK..........KLVVVGAGYIGLEMGSvwgrlgsevtvvefgpdivpsm
cwb_MDP0000854208|PACid:22682207 ...............----..........--------ISNMEFVQfhptaladeglpiqpskarena
cwb_MDP0000241767|PACid:22665328 ...............FWDD..........SVDYFGATAEETELRGqxfmfwnvkktvgapvxialvv
cwb_MDP0000318858|PACid:22682838 ............yisAKGK..........KVVVIGGGDTGTDCIGtsvrhgctsiinlellpepprt
cwb_MDP0000248995|PACid:22642703 ...............----..........----------------......................
cwb_MDP0000442206|PACid:22660061 ............yisAKGK..........KVVVIGGGDTGTDCIGtsvrhgctniinlellpepprk
cwb_MDP0000181673|PACid:22646891 ...............----..........----------------......................
cwb_MDP0000315409|PACid:22681973 ...............----..........----------------......................
cwb_MDP0000053966|PACid:22620929 ...............----..........----------------......................
cwb_MDP0000294615|PACid:22655955 ...............----..........----------------......................
cwb_MDP0000306147|PACid:22679041 ...............FWDD..........SVDYFGATAEETELRGqcfmfwnvkktvgapvlialvv
cwb_MDP0000180064|PACid:22628138 ...............----..........---------------Ygsiflsiptvldsslapegrhi
cwb_MDP0000261625|PACid:22630921 ...............K---..........----------------......................
cwb_MDP0000300208|PACid:22651331 ...............ELPK..........RAVVLGGGYIAVEFASiwrgmgasvdlffrkelplrgf
cwb_MDP0000247171|PACid:22623108 ...............VFPE..........GH-------------Rldynvqqyvglnrragfvplnd
cwb_MDP0000308095|PACid:22667065 ...............--NN..........VYELVGVPVVTVQLRYxgwvtelqdlersrqlkqasgl
cwb_MDP0000319421|PACid:22624123 ...............RYPD..........G----------HEFGSeftltrkddtqvgrlpmteslv
cwb_MDP0000232295|PACid:22657598 ...............----..........----------------......................
cwb_MDP0000188994|PACid:22643055 ..............kFF--..........---------------Gngirygvipcddktvhwyytwa
cwb_MDP0000159189|PACid:22672554 ..............kFF--..........---------------Gngirygvipcddktvhwyytwa
cwb_MDP0000656178|PACid:22657871 ...............FVPE..........WIAIVGSGYIGLEFSDvytalgsevtfiealdqlmpgf
cwb_MDP0000910523|PACid:22620639 ...............----..........---------------Vplndkeiywffvtylakgadla
cwb_MDP0000119941|PACid:22643547 ...............----..........---------------Gdgvkltlepasggdqtsfeadv
cwb_MDP0000231799|PACid:22673471 ...............FVPE..........WIAIVGSGYIGLEFSDvytalgsevtfiealdqlmpgf
cwb_MDP0000255025|PACid:22624807 ...............---N..........IYELVGVPVVTVQLRYdgwvtelqdlersrkskqalgl
cwb_MDP0000231632|PACid:22622264 ...............FFPE..........---------------Vtyiplsviittfkkedvkrple
cwb_MDP0000173300|PACid:22648712 ...............----..........----------------......................
cwb_MDP0000158474|PACid:22655457 ...............----..........----------------......................
cwb_MDP0000276878|PACid:22649644 ...............----..........----------------......................
cwb_MDP0000154720|PACid:22639222 ...............F---..........---------------Lpagpiallpigdnfsnivwtmk
cwb_MDP0000549646|PACid:22624756 ...............VKLT..........REIVPGMIVTGMEVAE......................
cwb_MDP0000158853|PACid:22672016 ...............----..........----------------......................
cwb_MDP0000702799|PACid:22650781 ...............----..........----------------......................
cwb_MDP0000233110|PACid:22669060 ...............----..........----------------......................
cwb_MDP0000260827|PACid:22621315 ...............----..........----------------......................
cwb_MDP0000941459|PACid:22654340 ...............----..........----------------......................
cwb_MDP0000185338|PACid:22637072 ...............----..........----------------......................
cwb_MDP0000451172|PACid:22678939 ...............----..........----------------......................
cwb_MDP0000136847|PACid:22626492 ...............----..........----------------......................
cwb_MDP0000177641|PACid:22624304 ...............----..........----------------......................
cwb_MDP0000413935|PACid:22663920 ...............----..........----------------......................
cwb_MDP0000206098|PACid:22637273 ...............VKLT..........REIVPGMIVTGMEVAE......................
cwb_MDP0000845788|PACid:22673064 ...............FKGQ..........VLAVVGGGDTATEEALyltkyarhihllvrrdqlrasr
cwb_MDP0000465595|PACid:22654474 ...............----..........----------------......................
cwb_MDP0000137211|PACid:22645789 ...............----..........----------------......................
cwb_MDP0000130099|PACid:22624356 ...............----..........----------------......................
cwb_MDP0000425135|PACid:22674685 ...............----..........----------------......................
cwb_MDP0000200780|PACid:22660656 ...............FEPK..........---------------Lnqiygkgqragflpisptkvyw
cwb_MDP0000142434|PACid:22683351 ...............YAG-..........------GHNFGNEFVQvkgdkntigrlpvhdnlvywfv
cwb_MDP0000248951|PACid:22626490 ...............----..........----------------......................
cwb_MDP0000869086|PACid:22644121 ...............FRDE..........VVVVVGTSLSGQDIS-......................
cwb_MDP0000318256|PACid:22681338 ...............IRGK..........GEVILSAGAIGSPQLLllsgvgpksyls..........
cwb_MDP0000231634|PACid:22622267 ...............----..........---------------Kedvkrplegfgvlvpskeqkng
cwb_MDP0000626995|PACid:22630905 ...............----..........----------------......................
cwb_MDP0000123832|PACid:22633934 ...............VFPE..........GH-------------Rldynvqqyvglnrragfvplnd
cwb_MDP0000236092|PACid:22632501 ...............----..........----------------......................
cwb_MDP0000199159|PACid:22674497 ...............----..........VVVVVGTSLSGQDIS-......................
cwb_MDP0000162755|PACid:22662459 ...............----..........---------------Anfksshgfdplfmxyfgxgirs
cwb_MDP0000173666|PACid:22649255 ...............FFPE..........-----------VTYVPvsviittfkkedvkrplegfgv
cwb_MDP0000262982|PACid:22620906 ...............FRGK..........KVLVVGCGNSGMEVS-......................
cwb_MDP0000184832|PACid:22636281 ...............----..........----------------......................
cwb_MDP0000598927|PACid:22655979 ..........lldisHKPR..........EKILSHFPNIAAECLK......................
cwb_MDP0000561228|PACid:22637769 ...............----..........----------------......................
cwb_MDP0000175650|PACid:22652650 ...............FLSK..........GL----GKYLLCERPGmlffifnteaigvlvahdleqg
cwb_MDP0000233802|PACid:22672706 ...............FRNK..........PLAVIGGGDSAMEEANfltkygsevhiihrrdtfrask
cwb_MDP0000321186|PACid:22667177 ...............KSSD..........TVIILGQGNVALDAAR......................
cwb_MDP0000161955|PACid:22660959 ...............----..........----------------......................
cwb_MDP0000213381|PACid:22663844 ...............----..........----------------......................
cwb_MDP0000168437|PACid:22624648 ...............----..........---------------Vdvpgqkvpsisggemsrylktk
cwb_MDP0000823251|PACid:22668430 ...............FRNK..........PLAVIGGGDSAMEEANfltkygsevhiihrrdtfrask
cwb_MDP0000191389|PACid:22631180 ...............----..........----------------......................
cwb_MDP0000199319|PACid:22658752 ...............----..........----------------......................
cwb_MDP0000857446|PACid:22649571 ...............----..........----------------......................
cwb_MDP0000266638|PACid:22658651 ...............----..........----------------......................
cwb_MDP0000208936|PACid:22641581 ...............----..........----------------......................
cwb_MDP0000202883|PACid:22663993 ...............----..........----------------......................
cwb_MDP0000288439|PACid:22643642 ...............----..........----------------......................
cwb_MDP0000295839|PACid:22658517 ...............YDGK..........NVLVVGSGNSGMEIAYdl....................
cwb_MDP0000903805|PACid:22678063 ...............IRGK..........GEVILSAGALGSPQLLllsgvxpksylsslk.......
cwb_MDP0000202123|PACid:22678734 ...............TKPE..........KIAIVGGGYIAVEFAGifngltsdvhvfirqkkvlrgf
cwb_MDP0000227773|PACid:22639029 ...............FRDE..........----------------......................
cwb_MDP0000317524|PACid:22631851 ...............FRDEarqyivnceiVVVVVGNSVSGQDI--......................
cwb_MDP0000320748|PACid:22658808 ...............----..........----------------......................
cwb_MDP0000634676|PACid:22625957 ...............----..........----------------......................
cwb_MDP0000235846|PACid:22627807 ...............FRNK..........PLAVIGGGDSAMEEANfltkfgsevhiihrrdtfrask
cwb_MDP0000251344|PACid:22682514 ...............FRNK..........PLAVIGGGDSAMEEANfltkfgsevhiihrrdtfrask
cwb_MDP0000501957|PACid:22671723 ...............----..........----------------......................
cwb_MDP0000209681|PACid:22642739 ...............YSGK..........NVLVVGSGNSGMEIAY......................
cwb_MDP0000293482|PACid:22637734 ...............FTGN..........E---------SSETLTgirkeypelgkclyfglgsgth
cwb_MDP0000233995|PACid:22662680 ...............YSGK..........NVLVVGSGNSGMEIAY......................
cwb_MDP0000257243|PACid:22657003 ...............----..........----------------......................
cwb_MDP0000160099|PACid:22658087 ...............FRDE..........----------------......................
cwb_MDP0000193196|PACid:22649572 ...............----..........----------------......................
cwb_MDP0000208234|PACid:22624840 ...............FENK..........KVLVVGAGNSGMEISL......................
cwb_MDP0000251783|PACid:22654795 ...............----..........----------------......................
cwb_MDP0000686885|PACid:22670382 sitpdedfvidflggEFGK..........D-VVVGGGFSGHGFKM......................
cwb_MDP0000138851|PACid:22674897 ...............FENK..........KVLVVGAGNSGMEISL......................
cwb_MDP0000194930|PACid:22667971 ...............----..........----------------......................
cwb_MDP0000169201|PACid:22625917 ...............VKGK..........RVTVVGFQKSALDIAMecsna.................
cwb_MDP0000399642|PACid:22674547 ...............VKGK..........RVTVVGFQKSALDIAMecsnx.................
cwb_MDP0000582079|PACid:22634000 ...............YGGK..........NVLVVGSGNSGMEIAY......................
cwb_MDP0000129765|PACid:22673448 ...............FAGNen........SETIIGIRKEYPELGKclyfglgsgthtvlyelpnrrl
cwb_MDP0000272655|PACid:22672104 ...............----..........----------------......................
cwb_MDP0000686821|PACid:22637777 ...............YGGK..........NVLVVGSGNSGMEIAY......................
cwb_MDP0000170414|PACid:22675630 ...............VKGK..........RVTVVGFQKSALDIAMecsnangiehp...........
cwb_MDP0000320804|PACid:22671446 ...............VEGK..........QVTVVGFQKFAMDIAMecsntngvanp...........
cwb_MDP0000189790|PACid:22676146 ...............PYAN..........HAHVILGDPSLVSFYPigsreirclvdvpgqqvpsiss
cwb_MDP0000847111|PACid:22682055 ...............YGGK..........NVLVVGSGNSGMEIAY......................
cwb_MDP0000289536|PACid:22677728 smtpdedfvidflggEFGK..........D-VVVGGGFSGHGFKM......................
cwb_MDP0000123987|PACid:22662898 ...............VKGK..........SVTVVGFQKSALDIAMecsnt.................
cwb_MDP0000245245|PACid:22671727 ...............VKGK..........SVTVVGFQKSALDIAMecsnt.................
cwb_MDP0000188553|PACid:22658192 ...............----..........---------------Vellgivapnsygcgyflnlhkv
cwb_MDP0000296599|PACid:22628159 ......rgkpldpevY---..........---------------Prptgevyvcgmtaeeevpddpe
cwb_MDP0000746652|PACid:22636428 ...............----..........----------------......................
cwb_MDP0000259265|PACid:22650727 ...............FKDK..........QVLVIGCGNSGMEIS-......................
cwb_MDP0000151331|PACid:22656760 ...............----..........----------------......................
cwb_MDP0000309775|PACid:22670556 ...............----..........---------------Skwanaalvvtvsakdfdvlnlr
cwb_MDP0000232736|PACid:22657363 ...............----..........---------------Vntvsyatvaggpllialvagea
cwb_MDP0000320539|PACid:22651795 ...............SSGG..........NAIVIGGGYIGMECAAslvisr................
cwb_MDP0000239909|PACid:22648375 ...............FRDQ..........VVILIGSSASAVDISR......................
cwb_MDP0000259264|PACid:22650726 ...............FKDK..........QVLVIGCGNSGMEIS-......................
cwb_MDP0000293613|PACid:22654008 ...............----..........----------------......................
cwb_MDP0000253362|PACid:22653297 ...............----..........----------------......................
cwb_MDP0000182973|PACid:22649063 ...............----..........----------------......................
cwb_MDP0000138005|PACid:22620884 ...............----..........----------------......................
cwb_MDP0000261301|PACid:22674262 ...............----..........----------------......................
cwb_MDP0000771633|PACid:22649768 ...............RARA..........HSKISGGKVIKVEAHP......................
cwb_MDP0000851102|PACid:22674240 ...............RARA..........HSKISGGKVIKVEAHP......................
cwb_MDP0000159873|PACid:22673571 ...............----..........---------------Pdfygwvfpkcdhvavgtgtvth
cwb_MDP0000140206|PACid:22652348 ...............KKNG..........KVVIIGGGYIGLEVGA......................
cwb_MDP0000261201|PACid:22657417 ...............----..........---------------Pdfygwvfpkcdhvavgtgtvth
cwb_MDP0000252244|PACid:22643267 ...............----..........---------------Pdfygwvfpkcdhvavgtgtvth
cwb_MDP0000261821|PACid:22664612 ...............KKNG..........KAVIVGGGYIGLELGAxlrinnldvkmvypepwcmprl
cwb_MDP0000124454|PACid:22663639 ...............YEPQ..........GITV-----------Pepiqtictr.............
cwb_MDP0000234830|PACid:22664319 ...............----..........----------------......................
cwb_MDP0000297861|PACid:22646554 ...............----..........----------------......................
cwb_MDP0000152184|PACid:22632666 ...............SSGG..........NAXVIGGGYIGMECAAslvinr................
cwb_MDP0000157871|PACid:22670351 ...............KKNG..........KVVIVGGGYIGLEVGAairinkfdvtmvfpepwcmprl
cwb_MDP0000250932|PACid:22662666 ...............----..........----------------......................
cwb_MDP0000219521|PACid:22657613 ...............LKDK..........KVVVVGYKKSAIDLA-......................
cwb_MDP0000239289|PACid:22649630 ...............----..........----------------......................
cwb_MDP0000258995|PACid:22632347 ...............----..........----------------......................
cwb_MDP0000167343|PACid:22638473 ...............LKDK..........EVVVVGYKKSAIDLAV......................
cwb_MDP0000222306|PACid:22645946 ...............LKDK..........EVVVVGYKKSAIDLAVecae..................
cwb_MDP0000829384|PACid:22650105 ...............----..........----------------......................
cwb_MDP0000145663|PACid:22632174 ...............----..........----------------......................
cwb_MDP0000288439|PACid:22643642 ...............----..........----------------......................
cwb_MDP0000267350|PACid:22676208 ...............KKNG..........KAVIVGGGYIGLELGAvlkinnldvkmvypepwcmprl
cwb_MDP0000155608|PACid:22665289 ...............----..........----------------......................
cwb_MDP0000194622|PACid:22683388 ...............----..........----------------......................
cwb_MDP0000134271|PACid:22620865 ...............LKGK..........KVAVIGYKKSAIDMAV......................
cwb_MDP0000312748|PACid:22644976 ...............----..........----------------......................
cwb_MDP0000197715|PACid:22640206 ...............----..........----------------......................
cwb_MDP0000220943|PACid:22675739 ...............LKGK..........KVAVIGYKKSAIDVA-......................
cwb_MDP0000320539|PACid:22651795 ...............----..........----------------......................
cwb_MDP0000140206|PACid:22652348 ...............----..........----------------......................
cwb_MDP0000215521|PACid:22667208 ...............LKGK..........KVAVIGYKKSAIDVAV......................
cwb_MDP0000203847|PACid:22681509 ...............----..........----------------......................
cwb_MDP0000201011|PACid:22661057 ...............----..........----------------......................
cwb_MDP0000204596|PACid:22635084 ...............----..........----------------......................
cwb_MDP0000148978|PACid:22620687 ...............----..........----------------......................
cwb_MDP0000130369|PACid:22663416 ...............----..........----------------......................
cwb_MDP0000314606|PACid:22664349 ...............----..........----------------......................
cwb_MDP0000263146|PACid:22654671 ........lpsaseeEKKKll........SFVCVGGGPAGVEFAAelhdfvkddlaklypsv.....
cwb_MDP0000250583|PACid:22633065 ...............FRKEsli.......RVVVVGCGYSGVELAAtvserlqdrgivqainvettic
cwb_MDP0000208233|PACid:22624841 ...............FENK..........KVLVVGAGNSGMEISLdlanhsaktsiivrspvhflsr
cwb_MDP0000158720|PACid:22655873 .......slislahmLKNC..........NFYVTGKSQYKDEFVTaggvplsevsps..........
cwb_MDP0000152184|PACid:22632666 ...............----..........----------------......................
cwb_MDP0000182702|PACid:22680484 ...............----..........---------------Aevlppetdchhfvlevgtpkth
cwb_MDP0000261638|PACid:22646820 ...............----..........----------------......................
cwb_MDP0000130370|PACid:22654204 ...............HKDS..........SVTVL----------Qadfyranellplkdeqivsrav
cwb_MDP0000272119|PACid:22671033 ...............----..........----------------......................
cwb_MDP0000305861|PACid:22662391 .........lptvsdEEKKril.......HFAVVGGGPTGVEFAAelhdfvnedl............
cwb_MDP0000255696|PACid:22677008 .........lptvsdEEKKril.......HFAVVGGGPTGVEFAAelhdyvnedlvkly........
cwb_MDP0000214280|PACid:22681133 ...............----..........----------------......................
cwb_MDP0000210966|PACid:22644665 ...............----..........----------------......................
cwb_MDP0000610999|PACid:22659782 ...............----..........----------------......................
cwb_MDP0000242546|PACid:22662348 ...............----..........----------------......................
cwb_MDP0000320742|PACid:22645070 ...............TYG-..........----------------......................
cwb_MDP0000654164|PACid:22658363 ...............IDEK..........KLVVVGARYIGLEMGSvwgr..................
cwb_MDP0000256300|PACid:22644503 ...............----..........----------------......................
cwb_MDP0000235080|PACid:22654616 ...............----..........--------PLGIEHTPsnlnlvpelavklnxipvrpcf
cwb_MDP0000284363|PACid:22634918 ...mavlpglseeerRRNL..........HFVIVGGGPTGVEFAAelhdyfqedl............
cwb_MDP0000125043|PACid:22648273 ...............----..........----------------......................
cwb_MDP0000192359|PACid:22632529 ...............----..........----------------......................
cwb_MDP0000440005|PACid:22623062 ...............RSAN..........SILIVGGGPTGVELAGeiavdfpdkkvtlvhtgtrlle
cwb_MDP0000609131|PACid:22633588 ...............----..........----------------......................
cwb_MDP0000362000|PACid:22628256 ........vpgvseeEKSRll........HCVVVGGGPTGVEFSGelsdfiqrdvqeryahvknyih
cwb_MDP0000150210|PACid:22663655 ...............----..........----------------......................
cwb_MDP0000158790|PACid:22624362 ...............----..........----------------......................
cwb_MDP0000427950|PACid:22623610 ..............kFF--..........---------------Gngirygvipcddktvhwyytwa
cwb_MDP0000569169|PACid:22666591 ...............----..........----------------......................
cwb_MDP0000525742|PACid:22647174 ...............----..........----------------......................
cwb_MDP0000559829|PACid:22672870 ...............----..........----------------......................
cwb_MDP0000321788|PACid:22641842 ...............----..........----------------......................
cwb_MDP0000919183|PACid:22661837 ...............----..........----------------......................
cwb_MDP0000146158|PACid:22623090 ...............----..........----------------......................
cwb_MDP0000832077|PACid:22645850 ...............----..........----------------......................
cwb_MDP0000621365|PACid:22669861 ...............----..........----------------......................
cwb_MDP0000875229|PACid:22620206 ...............----..........----------------......................
cwb_MDP0000251344|PACid:22682514 ...............ASGD..........RRLVTG---------Vvwdlkvsgplsa..........
cwb_MDP0000168919|PACid:22641114 ...............WHPS..........RII-------------......................
cwb_MDP0000267855|PACid:22645516 ...............----..........----------------......................
cwb_MDP0000195207|PACid:22668389 ...............----..........----------------......................
cwb_MDP0000400145|PACid:22662498 ...............----..........----------------......................
cwb_MDP0000919183|PACid:22661837 .........hpgileEERKril.......HCVVIGGGPTGVEFS-......................
cwb_MDP0000307336|PACid:22681275 ...............----..........----------------......................
cwb_MDP0000263146|PACid:22654671 ...............----..........----------------......................
cwb_MDP0000309730|PACid:22638555 ...............----..........----------------......................
cwb_MDP0000163903|PACid:22648802 ...............----..........----------------......................
cwb_MDP0000611628|PACid:22643604 ...............----..........----------------......................
cwb_MDP0000119779|PACid:22649695 ...............----..........----------------......................
cwb_MDP0000120904|PACid:22629470 ...............PYAN..........HAHVILGDPSLVSFYPigsreirclvdvpgqqvpsiss
cwb_MDP0000150544|PACid:22634453 ...............----..........----------------......................
cwb_MDP0000902209|PACid:22678199 ...............----..........----------------......................
cwb_MDP0000269370|PACid:22680893 ...............----..........----------------......................
cwb_MDP0000146158|PACid:22623090 .........hpgiseEERKrvl.......HCVVIGGGPTGVEFSGelsdfimkdvqerfshvkdyik
cwb_MDP0000124051|PACid:22654473 ...............----..........----------------......................
cwb_MDP0000255696|PACid:22677008 ...............----..........----------------......................
cwb_MDP0000305861|PACid:22662391 ...............----..........----------------......................
cwb_MDP0000611628|PACid:22643604 .........hpgiseEERKrvl.......HCVVIGGGPTGVEFSG......................
cwb_MDP0000309622|PACid:22670269 ...............----..........----------------......................
cwb_MDP0000239909|PACid:22648375 ...............----..........----------------......................
cwb_MDP0000126888|PACid:22675379 ...............----..........----------------......................
cwb_MDP0000869086|PACid:22644121 ...............----..........----------------......................
cwb_MDP0000317524|PACid:22631851 ...............FRDEarqyivnceiVVVVVGNSVSGQDISMelvdvakaiylsaksldisegl
cwb_MDP0000160099|PACid:22658087 ...............----..........----------------......................
cwb_MDP0000251205|PACid:22649529 ...............----..........----------------......................
cwb_MDP0000314335|PACid:22679828 ...............FKGQ..........VLAVVGGGDTATEEAL......................
cwb_MDP0000638870|PACid:22646063 ...............----..........----------------......................
cwb_MDP0000790657|PACid:22654829 ...............----..........----------------......................
cwb_MDP0000748068|PACid:22649054 ...............----..........----------------......................
cwb_MDP0000727481|PACid:22682921 ...............----..........----------------......................
cwb_MDP0000301246|PACid:22669391 ...............----..........----------------......................
cwb_MDP0000190684|PACid:22677586 ...............----..........----------------......................
cwb_MDP0000456223|PACid:22643829 ...............----..........----------------......................
cwb_MDP0000745172|PACid:22667211 ...............----..........----------------......................
cwb_MDP0000407932|PACid:22626437 ...............----..........----------------......................
cwb_MDP0000440896|PACid:22680420 ...............----..........----------------......................
cwb_MDP0000694227|PACid:22673619 ...............----..........----------------......................
cwb_MDP0000123987|PACid:22662898 ...............C---..........----------------......................
cwb_MDP0000138005|PACid:22620884 ...............----..........----------------......................
cwb_MDP0000258205|PACid:22638470 ...............----..........----------------......................
cwb_MDP0000245245|PACid:22671727 ...............C---..........----------------......................
cwb_MDP0000306704|PACid:22680179 ...............----..........----------------......................
cwb_MDP0000478654|PACid:22674637 ...............----..........----------------......................
cwb_MDP0000728219|PACid:22657389 ...............FEGK..........RILVIGMGNSGSDIAV......................
cwb_MDP0000170414|PACid:22675630 ...............----..........----------------......................
cwb_MDP0000284363|PACid:22634918 ...............----..........----------------......................
cwb_MDP0000219560|PACid:22625984 ...............----..........----------------......................
cwb_MDP0000235930|PACid:22635275 ...............----..........----------------......................
cwb_MDP0000755938|PACid:22650525 ...............----..........----------------......................
cwb_MDP0000138851|PACid:22674897 ...............----..........----------------......................
cwb_MDP0000261638|PACid:22646820 ...............----..........----------------......................
cwb_MDP0000317524|PACid:22631851 ...............----..........----------------......................
cwb_MDP0000294615|PACid:22655955 ...............----..........----------------......................
cwb_MDP0000208234|PACid:22624840 ...............----..........----------------......................
cwb_MDP0000216129|PACid:22668259 ...............----..........----------------......................
cwb_MDP0000219521|PACid:22657613 ...............----..........----------------......................
cwb_MDP0000248995|PACid:22642703 ...............----..........----------------......................
cwb_MDP0000256328|PACid:22629063 ...............----..........----------------......................
cwb_MDP0000181673|PACid:22646891 ...............----..........----------------......................
cwb_MDP0000169201|PACid:22625917 ...............----..........----------------......................
cwb_MDP0000263530|PACid:22651991 ...............----..........----------------......................
cwb_MDP0000295839|PACid:22658517 ...............----..........----------------......................
cwb_MDP0000297466|PACid:22645872 ...............VGGP..........KVA-------------......................
cwb_MDP0000281982|PACid:22629373 ...............----..........----------------......................
cwb_MDP0000053966|PACid:22620929 ...............----..........----------------......................
cwb_MDP0000795740|PACid:22666880 ...............----..........----------------......................
cwb_MDP0000212327|PACid:22630830 ...............----..........----------------......................
cwb_MDP0000437365|PACid:22632357 ...............----..........----------------......................
cwb_MDP0000135231|PACid:22629791 ...............----..........----------------......................
cwb_MDP0000167343|PACid:22638473 ...............----..........----------------......................
cwb_MDP0000222306|PACid:22645946 ...............----..........----------------......................
cwb_MDP0000183517|PACid:22634175 ...............----..........----------------......................
cwb_MDP0000686821|PACid:22637777 ...............----..........----------------......................
cwb_MDP0000430157|PACid:22655785 ...............----..........----------------......................
cwb_MDP0000373054|PACid:22683333 ...............----..........----------------......................
cwb_MDP0000295306|PACid:22673308 ...............----..........----------------......................
cwb_MDP0000233995|PACid:22662680 ...............----..........----------------......................
cwb_MDP0000209681|PACid:22642739 ...............----..........----------------......................
cwb_MDP0000876898|PACid:22679933 ...............----..........----------------......................
cwb_MDP0000738522|PACid:22680891 ...............----..........----------------......................
cwb_MDP0000399642|PACid:22674547 ..............cI---..........----------------......................
cwb_MDP0000215521|PACid:22667208 ...............----..........----------------......................
cwb_MDP0000170521|PACid:22675770 ...............----..........----------------......................
cwb_MDP0000262982|PACid:22620906 ...............----..........----------------......................
cwb_MDP0000321186|PACid:22667177 ...............KSSD..........TVIILGQGNVALDAARillrpttelattdiashalaal
cwb_MDP0000266051|PACid:22641431 ...............YGGK..........IVLVVGPGNSGMEIAY......................
cwb_MDP0000837610|PACid:22643529 ...............----..........----------------......................
cwb_MDP0000582079|PACid:22634000 ...............----..........----------------......................
cwb_MDP0000538071|PACid:22663035 ...............----..........----------------......................
cwb_MDP0000241703|PACid:22642424 ...............----..........----------------......................
cwb_MDP0000671114|PACid:22638724 ...............----..........----------------......................
cwb_MDP0000315388|PACid:22681954 ...............----..........----------------......................
cwb_MDP0000134271|PACid:22620865 ...............LKGK..........KVAVIGYKKSAIDMAVecaeanqgpdgqactmvirtlh
cwb_MDP0000297581|PACid:22646099 ...............FREK..........KVL-VGCGNSGMEV--......................
cwb_MDP0000911003|PACid:22677366 ...............----..........----------------......................
cwb_MDP0000576650|PACid:22634720 ...............----..........----------------......................
cwb_MDP0000149205|PACid:22670334 ...............----..........----------------......................
cwb_MDP0000315409|PACid:22681973 ...............----..........----------------......................
cwb_MDP0000320804|PACid:22671446 ...............LPPL..........QLAVIGFS--------......................
cwb_MDP0000474647|PACid:22667377 ...............----..........----------------......................
cwb_MDP0000566648|PACid:22666666 ...............----..........----------------......................
cwb_MDP0000171379|PACid:22629613 ...............----..........----------------......................
cwb_MDP0000814529|PACid:22673539 ...............----..........----------------......................
cwb_MDP0000218295|PACid:22671514 ...............----..........----------------......................
cwb_MDP0000220943|PACid:22675739 ...............LKGK..........KVAVIGYKKSAIDVAVecaeanqgdsygqpsgncqcem
cwb_MDP0000795437|PACid:22664825 ...............----..........----------------......................
cwb_MDP0000919706|PACid:22656631 ...............----..........----------------......................
cwb_MDP0000295675|PACid:22626457 ...............----..........----------------......................
cwb_MDP0000147542|PACid:22652542 ...............----..........----------------......................
cwb_MDP0000272126|PACid:22655119 ...............----..........----------------......................
cwb_MDP0000196881|PACid:22654963 ...............----..........----------------......................
cwb_MDP0000268346|PACid:22678394 ...............----..........----------------......................
cwb_MDP0000147542|PACid:22652542 ...............----..........----------------......................
cwb_MDP0000948298|PACid:22676144 ...............----..........----------------......................
cwb_MDP0000220943|PACid:22675739 ...............----..........----------------......................
cwb_MDP0000182589|PACid:22648509 ...............----..........----------------......................
cwb_MDP0000557870|PACid:22631128 ...............----..........----------------......................
cwb_MDP0000308870|PACid:22652882 ...............----..........----------------......................
cwb_MDP0000322449|PACid:22657441 ...............----..........----------------......................
cwb_MDP0000286494|PACid:22671310 ...............----..........----------------......................
cwb_MDP0000150868|PACid:22621264 ...............----..........----------------......................
cwb_MDP0000155608|PACid:22665289 ...............----..........----------------......................
cwb_MDP0000168505|PACid:22672316 ...............----..........----------------......................
cwb_MDP0000196888|PACid:22670849 ...............----..........----------------......................
cwb_MDP0000154812|PACid:22632894 ...............----..........----------------......................
cwb_MDP0000186080|PACid:22622639 ...............----..........----------------......................
cwb_MDP0000220012|PACid:22626541 ...............----..........----------------......................
cwb_MDP0000169409|PACid:22673915 ...............----..........----------------......................
cwb_MDP0000373095|PACid:22661923 ...............----..........----------------......................
cwb_MDP0000235846|PACid:22627807 ...............----..........----------------......................
cwb_MDP0000207126|PACid:22623152 ...............----..........----------------......................
cwb_MDP0000268357|PACid:22630891 ...............----..........----------------......................
cwb_MDP0000149067|PACid:22669209 ...............----..........----------------......................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 kdlasrdvvsrsmtmeiregrgvgplkdhiylhlnhlppdvlkerlpgisetaaif...........
cwb_MDP0000251581|PACid:22621152 kdlasrdvvsrsmtmeiregrgvgplkdhiylhlnhlppdvlkerlpgisetaaif...........
cwb_MDP0000188391|PACid:22626210 kdlasrdvvsrsmtmeiregrgllssgplkdhiylhlnhlppdvlkerlpgisetaaif........
cwb_MDP0000254144|PACid:22644986 sirfepelpqrklaaierlgfgllnkvamvfphvfwgeeldtfgclnehshqrgefflfygyhtvsg
cwb_MDP0000321972|PACid:22643109 tghpvlvymaagrfaydlekltddaavnfvmlqlkkmlpdatepvq.....................
cwb_MDP0000299806|PACid:22682346 edprmrgefflfysyssvsggpllvalvagdaaikfelmspvesvnrvldilrgifnpkgiavpepi
cwb_MDP0000283451|PACid:22680462 tmrgefflfysyssvsggpllvalvagdaaikfelmspvesvnrvldilkgifnpkgiavpepiqav
cwb_MDP0000296714|PACid:22644308 gkaaidgqnmsssehvnhaivvlrklfgeasvpdpvasvvtdwgkdpfs..................
cwb_MDP0000162193|PACid:22629958 gkaaidgqkmspsehvnhalavlrklfgeasvpdpvasvvtd.........................
cwb_MDP0000769741|PACid:22637873 vvadtsyccsyflnlhkatghsvlvympagqlakdiekmsdeeaanfaftqlkkilpdastpiqhlv
cwb_MDP0000295277|PACid:22625688 dseirkqfqrslekqgmkfmlktkvvgvdtsgdgvkltlepasggdqtsfeadvvlvs.........
cwb_MDP0000897124|PACid:22647159 dseirkqfqrslekqgmkfmlktkvvgvdtsgdgvkltlepasggdqtsfeadvvlvs.........
cwb_MDP0000854208|PACid:22682207 fliteavrgdgailynldmerfmplyderaelaprdvvargiddqlkkrnekyvlldishkprekil
cwb_MDP0000241767|PACid:22665328 gkaaidgqnmsssehvxhxivvlrklfgeasvpdpvaxvvtdwgkdpfs..................
cwb_MDP0000318858|PACid:22682838 rapgnpwpqwprvfrvdyghqevaakfgkdprtyevltkrfvgdengavkglevvrvkwekdetgrf
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 rapgnpwpqwprvfrvdyghqevaakfgkdprtyevltkrfvgdengalkglevvrvkwekdetgrf
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 gkaaidgqnmsssehvnhaivvlrklfgeasvpdpvasvvtdwgkdpfs..................
cwb_MDP0000180064|PACid:22628138 lhifttssiedweglsrkdyeakkelvadeiicrlenklfpglkssivfkevgtpkthrrylardkg
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ddelravvarnlegrgidlhpqtnltelvktedgikvrtdhgeeliadvvlfa..............
cwb_MDP0000247171|PACid:22623108 keiywffgtspakgtdlgdepevirqevienyakdlppiyldivqhsdlst................
cwb_MDP0000308095|PACid:22667065 dnllytpdadfscfadlaltspedyyiegxgsllqcvltpgdpymplpneeiiarvtkqvlalfpss
cwb_MDP0000319421|PACid:22624123 ywfmtrkhssqdsaaskdqklirelgvksvegfptsiiemfkncelds...................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ptsqekeleenpgqlkqymlsklgkipdkv.....................................
cwb_MDP0000159189|PACid:22672554 ptsqekeleenpgqlkqymlsklgkipdkv.....................................
cwb_MDP0000656178|PACid:22657871 dpeigklaqrvlinprkidyqtgvfaskitpakdgkpvtielidaktkepketlevdaalia.....
cwb_MDP0000910523|PACid:22620639 nepevikrevienyakdlppiyldvvrhsdlst..................................
cwb_MDP0000119941|PACid:22643547 vlvs...............................................................
cwb_MDP0000231799|PACid:22673471 dpeigklaqrvlinprkidyqtgvfaskitpakdgkpvtidlidaktkepketlevdaalia.....
cwb_MDP0000255025|PACid:22624807 dnllytpdadfscfadlaltspedyyiegqgsllqcvltpgdpymplpneeiiarvtkqvlalfpss
cwb_MDP0000231632|PACid:22622264 gfgvlvpskeqknglktlgtlfssmmfpdrapsdlhlyttfvggsrnkelakastdelkkivtsdir
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 pkeatdrklkaedefvkdvnyaldygfgphpgsstsggggifslftnanlsandc............
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 ...................................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 amqdrlvayrecfrvynnpnitlhfnteavdiisntkgqmsgilirkldsgeksvieakglfyg...
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 fvcynraslgpkitdgpflkkqvtelvxdwpsdllni..............................
cwb_MDP0000142434|PACid:22683351 shqvhggqadpskvskdpelirqftlqsileefpseivdmirkselesvshvr..............
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 lktlgnawhgpvtxstlfssmmfpdrapsglhlyttfvggsqnkelakastdelkkivtsdirhwlg
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 keiywffgtspakgtdlgdepevirqevienyakdlppiyldivqhsdlst................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 gaipcddknvywfitwspssqekeleenpgqlkqymlsk............................
cwb_MDP0000173666|PACid:22649255 lvpskeqknglktlgnawhgpvtxstlfssmmfpdrapsglhlyttfvggsqnkelakastdelkki
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 efvlqipfyppqqnledfsrqiceq..........................................
cwb_MDP0000233802|PACid:22672706 imqnralsnpkirvvwnsevveaygegkgplaglkvknvvtgevsdfkvsglffa............
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 vapqvppelyaafmaaadkgn..............................................
cwb_MDP0000823251|PACid:22668430 imqnralsnpkirvvwnsevveaygegkgplaglkvknvvtgevsdfkvsglffa............
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 deevrdfvqeqmalrgiefhaeespqaivkaadgslslktnkgtiegfshimfa.............
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 imqhralnnpkiqvvwnsvvveaygegkgplaglkvknvvtgevsdlkvsglffa............
cwb_MDP0000251344|PACid:22682514 imqhralnnpkiqvvwnsvvveaygegkgplaglkvknvvtgevsdlkvsglffa............
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 tvlyellnrrlnwiwyvhqpepdlkhnsmtmkassdmiqsmhkeaekmwlpef..............
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 nwiwyvhqpepdlkpnsmtmkassdmiqsmhkeaekmwlpefvrviretkepf..............
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 gemahylk...........................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 tghpvlvymaagrfaydlekltddaavnfvmlqlkkmmxdatepvq.....................
cwb_MDP0000296599|PACid:22628159 qivgksesiev........................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 gplagvefqrefeqraarmgggnfvvpvqtvtdfmdnklsvtsvppssyrlgvkaanlheifpihit
cwb_MDP0000232736|PACid:22657363 ahkfetmpptdavtrviqilkgxyepqgixvpepiqtictrwgsdpfslgaysxva...........
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 kgdikkfqlatrnrakdkil...............................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 kgdikkfqlatrnrakdkil...............................................
cwb_MDP0000252244|PACid:22643267 kgdikkfqlatrnrakdkil...............................................
cwb_MDP0000261821|PACid:22664612 ftsdiaafyegyyknkgvqiikgtvatgftadsngevkevhlkdgtxleadivvvg...........
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ftkeiaafyegyyanegvqmikgttavgfdvdtngevkavklkdgrvlqadivvvg...........
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ftsgiaafyegyyqnkgvkiikgtvatgftadsngevkevhlkdgtvleadivvvg...........
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 pnappgnreaaikvltsrkvelllgyvvrcirkavdaehdsekyilelqpaqrgsqsqtveadlvlw
cwb_MDP0000208233|PACid:22624841 gmvylalvllkhfplsmidsllvllsklvygnlasygierpqegpfymkgkygkypaidvgayrkik
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 rrylardkgt.........................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 sylskyikdfknvtvtnkk................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 almiafsepvssipfkgfsikssevlswahcdsskpgrstsserwvlhstmeyaqsviaqtglqkls
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 fvgpkaadkalkwlksrkvevilersvdldnisdgcktyktsegetltadchflc............
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 vtlieaneilssfddrlrhyatkqltksgvrlvrgivkdvkdkkiilndgtevpygllvws......
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ptsqekeleenpgqlkqymlsklgkipdkv.....................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 gemahylk...........................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 vtlieaneilssfdxglrqyatnhltxvgvrlmrgvvkevhpkkivlndgtdvpygllvws......
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 skviskhenlhlrpqieslqedgnvlfvdgswviadtiiyc..........................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 edssirkvylvgrwgpvqaactakelreilgikdlhvhkketdllptaadeeemknnrirkrvyell
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 wtvpsywiwglpfflffstrssqflherpnqslfralfcllsspmrmaiskfiesylkwklplvk..
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 trwagmyngdkdstldssilldlgasifplffdkvfsipprkakpelipslvlpsfiaygkfhrmvi
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 gpvlialvageaaetfectepsillhrvlsvlrgiytpkgidvpnpiqtictrwggdplsygsysh.
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 qavctrwgkddfaygsysyva..............................................
cwb_MDP0000283451|PACid:22680462 ctrwgkddfaygsysyva.................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 sr.................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 shfpniaaeclk.......................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 qfkeiegseeileadlvlla...............................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 qfneiegseeileadlvlla...............................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 t..................................................................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 qglevtwssvvk.......................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 qglevtwssvvk.......................................................
cwb_MDP0000231632|PACid:22622264 hllgaegeptsvnhyhw..................................................
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 ...................................................................
cwb_MDP0000702799|PACid:22650781 ...................................................................
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 ...................................................................
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 ...................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 ...................................................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 aegeptsvnh.........................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 vtsdirhwlgaegeptsvnh...............................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 etlqhslsvfd........................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ...................................................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 t..................................................................
cwb_MDP0000208233|PACid:22624841 sgeiqvlpaeigsirggqvelkngksypfdaiifc................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 natltkvaeelfqefqs..................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 ...................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 skaamtrpshxssdarelhfvffrkpnkflesderrdhvsgvxlektkligispgeqtaagtgqfee
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 skfiesylewklplvk...................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                 170              180                            190
                                                   |                |                              |
d1xdia1                          .........XGSVPNTSGL....GLERV..GIQL.G..R..GNYLTV...D.........R.....V
cwb_MDP0000813172|PACid:22649115 .........AGVDVTKEPI....PVLPT..VHYN.-..-..MGGIPT...N.........Y.....H
cwb_MDP0000251581|PACid:22621152 .........AGVDVTKEPI....PVLPT..VHYN.-..-..MGGIPT...N.........Y.....H
cwb_MDP0000188391|PACid:22626210 .........AGVDVTKEPI....PVLPT..VHYN.-..-..MGGIPT...N.........Y.....H
cwb_MDP0000254144|PACid:22644986 .........V---------....RV---..----.-..Q..SSGSDY...D.........L.....L
cwb_MDP0000321972|PACid:22643109 .........Y---------....LLSRW..GTDL.N..S..LGCYAL...D.........L.....V
cwb_MDP0000299806|PACid:22682346 .........VGSSGDDYDI....LAESI..----.-..-..------...-.........-.....-
cwb_MDP0000283451|PACid:22680462 .........VGSSGDDYDI....LAESI..----.-..-..------...-.........-.....-
cwb_MDP0000296714|PACid:22644308 .........YGAYSYV---....AVGAS..GEDY.D..I..LGR---...-.........-.....-
cwb_MDP0000162193|PACid:22629958 .........WGRDPFSYGAysyvAVGAS..GEDY.D..I..L-----...-.........-.....-
cwb_MDP0000769741|PACid:22637873 .........WGSDVNTLGS....YS---..---Y.D..Mv.GKPHDL...Y.........E.....K
cwb_MDP0000295277|PACid:22625688 .........AGRVPFTSGL....DLDKI..GVEM.D..K..GGRILV...N.........E.....R
cwb_MDP0000897124|PACid:22647159 .........AGRVPFTSGL....DLDKI..GVEM.D..K..GGRILV...N.........E.....R
cwb_MDP0000854208|PACid:22682207 .........YXLDITCQPI....PVVPA..AHYM.-..-..CGGVRA...G.........L.....Q
cwb_MDP0000241767|PACid:22665328 .........YGAYSYV---....AVGAX..GEDY.D..I..LGR---...-.........-.....-
cwb_MDP0000318858|PACid:22682838 .........MGFLGPEAT-....VAEKL..GLER.D..Q..RSNYKA...D.........Yg....R
cwb_MDP0000248995|PACid:22642703 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000442206|PACid:22660061 .........MGFLGPEAT-....VAEKL..GLER.D..Q..RSNYKA...D.........Yg....R
cwb_MDP0000181673|PACid:22646891 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000315409|PACid:22681973 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000053966|PACid:22620929 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000294615|PACid:22655955 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000306147|PACid:22679041 .........YGAYSYV---....AVGAS..GEDY.D..I..LGR---...-.........-.....-
cwb_MDP0000180064|PACid:22628138 .........YGPIPRNTPK....GLLGM..P---.-..-..------...-.........-.....F
cwb_MDP0000261625|PACid:22630921 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000300208|PACid:22651331 .........TGRSPNTKRL....NLAAV..GVEV.D..K..TGAIKV...D.........E.....Y
cwb_MDP0000247171|PACid:22623108 .........LSWAPLM---....FRYPW..NVVF.G..N..LG----...-.........-.....-
cwb_MDP0000308095|PACid:22667065 .........I---------....---GQ..SLYR.E..G..PGKDPF...R.........P.....D
cwb_MDP0000319421|PACid:22624123 .........I---------....-----..HLTE.Y..V..RYHAPW...D.........I.....X
cwb_MDP0000232295|PACid:22657598 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000188994|PACid:22643055 .........K--------A....VVENT..ELDX.F..V..SXPLRY...R.........HpwxilW
cwb_MDP0000159189|PACid:22672554 .........K--------A....VVENT..ELDX.F..V..SXPLRY...R.........HpwxilW
cwb_MDP0000656178|PACid:22657871 .........TGRAPFTQGL....GLENV..DVAT.-..Q..RGFIPV...D.........E.....R
cwb_MDP0000910523|PACid:22620639 .........LSWAPLM---....FRYPW..HVVF.G..N..LG----...-.........-.....-
cwb_MDP0000119941|PACid:22643547 .........AGRVPFTSGL....DLDKI..GVEM.D..K..GGRILV...N.........E.....R
cwb_MDP0000231799|PACid:22673471 .........TGRAPFTQGL....GLENV..DVAT.-..Q..RGFIPV...D.........E.....R
cwb_MDP0000255025|PACid:22624807 .........I---------....---GQ..SLYR.E..G..PGKDPF...R.........P.....D
cwb_MDP0000231632|PACid:22622264 .........S------KAF....PLYG-..---R.N..Y..DSVIEA...I.........E.....K
cwb_MDP0000173300|PACid:22648712 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000158474|PACid:22655457 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000276878|PACid:22649644 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000154720|PACid:22639222 .........F---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000549646|PACid:22624756 .........IDGSPRMG--....-----..----.-..-..------...-.........-.....-
cwb_MDP0000158853|PACid:22672016 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000702799|PACid:22650781 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000233110|PACid:22669060 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000260827|PACid:22621315 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000941459|PACid:22654340 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000185338|PACid:22637072 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000451172|PACid:22678939 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000136847|PACid:22626492 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000177641|PACid:22624304 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000413935|PACid:22663920 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000206098|PACid:22637273 .........IDGSPRMG--....-----..----.-..-..------...-.........-.....-
cwb_MDP0000845788|PACid:22673064 .........IGHSPNS---....QLLEG..QVEL.D..S..SGYVLV...E.........Eg....T
cwb_MDP0000465595|PACid:22654474 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000137211|PACid:22645789 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000130099|PACid:22624356 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000425135|PACid:22674685 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000200780|PACid:22660656 .........IDYTPDDT--....-----..----.-..I..IGTPLV...D.........R.....W
cwb_MDP0000142434|PACid:22683351 .........LRYRPPWE--....IVVQ-..----.-..-..------...-.........-.....-
cwb_MDP0000248951|PACid:22626490 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000869086|PACid:22644121 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000318256|PACid:22681338 .........S---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000231634|PACid:22622267 .........Y---H-----....WSKAC..PLYGhN..Y..DSVIEA...I.........E.....K
cwb_MDP0000626995|PACid:22630905 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000123832|PACid:22633934 .........LSWAPLM---....FRYPW..NVVF.G..N..LG----...-.........-.....-
cwb_MDP0000236092|PACid:22632501 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000199159|PACid:22674497 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000162755|PACid:22662459 .........L---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000173666|PACid:22649255 .........Y---H-----....WSKAC..PLYGhN..Y..DSVIEA...I.........E.....K
cwb_MDP0000262982|PACid:22620906 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000184832|PACid:22636281 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000598927|PACid:22655979 .........YXLDITXQPI....PVVPA..AHYM.-..-..CGGVRA...G.........L.....Q
cwb_MDP0000561228|PACid:22637769 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000175650|PACid:22652650 .........I---------....IFKLV..GREL.G..D..INVIDI...K.........P.....W
cwb_MDP0000233802|PACid:22672706 .........IGHEPATK--....-FLDG..HLDL.H..A..DGYVAT...K.........Pg....T
cwb_MDP0000321186|PACid:22667177 .........ILLRPTTE--....L----..--AT.T..D..IASHAL...A.........A.....L
cwb_MDP0000161955|PACid:22660959 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000213381|PACid:22663844 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000168437|PACid:22624648 .........IKSMPNRS--....-----..----.-..-..------...-.........-.....-
cwb_MDP0000823251|PACid:22668430 .........IGHXXXT---....KFLDG..HLDL.H..A..DGYVAT...K.........Pg....T
cwb_MDP0000191389|PACid:22631180 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000199319|PACid:22658752 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000857446|PACid:22649571 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000266638|PACid:22658651 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000208936|PACid:22641581 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000202883|PACid:22663993 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000288439|PACid:22643642 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000295839|PACid:22658517 .........TNW-------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000903805|PACid:22678063 .........I---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000202123|PACid:22678734 .........TGRRPNTKNL....GLEAV..GVKL.S..K..NGAMEV...D.........K.....F
cwb_MDP0000227773|PACid:22639029 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000317524|PACid:22631851 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000320748|PACid:22658808 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000634676|PACid:22625957 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000235846|PACid:22627807 .........IGHEPAS---....KFLDG..QLEL.H..D..DGYVAT...K.........Pg....T
cwb_MDP0000251344|PACid:22682514 .........IGHEPAS---....KFLDG..QLEL.H..D..DGYVAT...K.........Pg....T
cwb_MDP0000501957|PACid:22671723 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000209681|PACid:22642739 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000293482|PACid:22637734 .........VRVIKETKEP....FI---..----.-..-..NAIYDS...D.........P.....L
cwb_MDP0000233995|PACid:22662680 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000257243|PACid:22657003 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000160099|PACid:22658087 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000193196|PACid:22649572 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000208234|PACid:22624840 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000251783|PACid:22654795 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000686885|PACid:22670382 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000138851|PACid:22674897 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000194930|PACid:22667971 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000169201|PACid:22625917 .........N---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000399642|PACid:22674547 .........N---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000582079|PACid:22634000 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000129765|PACid:22673448 .........INXIYDSD--....-----..----.-..-..------...-.........P.....L
cwb_MDP0000272655|PACid:22672104 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000686821|PACid:22637777 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000170414|PACid:22675630 .........C---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000320804|PACid:22671446 .........C---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000189790|PACid:22676146 .........TKVAPQVXPE....LYTAF..LVAI.D..KgnIKTMPT...R.........S.....M
cwb_MDP0000847111|PACid:22682055 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000289536|PACid:22677728 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000123987|PACid:22662898 .........N---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000245245|PACid:22671727 .........N---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000188553|PACid:22658192 .........Y---------....LVSRW..GTDV.N..S..LGCYAL...DlvgkpgdiyE.....R
cwb_MDP0000296599|PACid:22628159 .........L---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000746652|PACid:22636428 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000259265|PACid:22650727 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000151331|PACid:22656760 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000309775|PACid:22670556 .........K---------....-----..--ET.R..T..SSPIQIprdN.........D.....T
cwb_MDP0000232736|PACid:22657363 .........VG--------....-----..----.-..-..ASGDDY...D.........I.....L
cwb_MDP0000320539|PACid:22651795 .........M---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000239909|PACid:22648375 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000259264|PACid:22650726 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000293613|PACid:22654008 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000253362|PACid:22653297 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000182973|PACid:22649063 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000138005|PACid:22620884 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000261301|PACid:22674262 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000771633|PACid:22649768 .........IPEHPRPT--....-----..----.-..-..------...-.........-.....-
cwb_MDP0000851102|PACid:22674240 .........IPEHPRPT--....-----..----.-..-..------...-.........-.....-
cwb_MDP0000159873|PACid:22673571 .........G---------....----G..KILR.V..E..AHPIPE...H.........P.....R
cwb_MDP0000140206|PACid:22652348 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000261201|PACid:22657417 .........G---------....----G..KILR.V..E..AHPIPE...H.........P.....R
cwb_MDP0000252244|PACid:22643267 .........G---------....----G..KILR.V..E..AHPIPE...H.........P.....R
cwb_MDP0000261821|PACid:22664612 .........VXGRPLTT--....LFK-G..QVE-.E..E..KGGIKT...D.........A.....F
cwb_MDP0000124454|PACid:22663639 .........WGSDPFS---....LGAYS..NVAV.G..-..ASGDDY...D.........I.....L
cwb_MDP0000234830|PACid:22664319 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000297861|PACid:22646554 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000152184|PACid:22632666 .........M---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000157871|PACid:22670351 .........VGAKPLID--....LFKGX..VGE-.-..E..KGGIQT...D.........G.....M
cwb_MDP0000250932|PACid:22662666 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000219521|PACid:22657613 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000239289|PACid:22649630 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000258995|PACid:22632347 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000167343|PACid:22638473 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000222306|PACid:22645946 .........A---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000829384|PACid:22650105 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000145663|PACid:22632174 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000288439|PACid:22643642 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000267350|PACid:22676208 .........VGGRPLTT--....LFK-G..QVEE.-..E..KGGIKT...D.........A.....F
cwb_MDP0000155608|PACid:22665289 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000194622|PACid:22683388 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000134271|PACid:22620865 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000312748|PACid:22644976 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000197715|PACid:22640206 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000220943|PACid:22675739 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000320539|PACid:22651795 .........----------....-----..QLTL.-..E..KGGIKV...N.........G.....R
cwb_MDP0000140206|PACid:22652348 .........----------....-----..----.E..E..NDGIRT...D.........G.....M
cwb_MDP0000215521|PACid:22667208 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000203847|PACid:22681509 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000201011|PACid:22661057 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000204596|PACid:22635084 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000148978|PACid:22620687 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000130369|PACid:22663416 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000314606|PACid:22664349 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000263146|PACid:22654671 .........TGYVK-----....-----..----.-..-..------...-.........-.....-
cwb_MDP0000250583|PACid:22633065 .........VGNKSLLPKL....EPEDRphELPL.N..A..RGQAET...D.........E.....N
cwb_MDP0000208233|PACid:22624841 .........TGFKRSTN-L....WLKGD..DYLL.K..E..DGIPRP...S.........I.....P
cwb_MDP0000158720|PACid:22655873 .........L---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000152184|PACid:22632666 .........----------....-----..QLTL.-..E..KGGIKV...N.........G.....K
cwb_MDP0000182702|PACid:22680484 .........YGPIPRNTPK....GLLGM..PF--.-..-..------...-.........-.....-
cwb_MDP0000261638|PACid:22646820 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000130370|PACid:22654204 .........IGRFPKSLPH....FFPGS..YKDM.-..-..------...-.........M.....R
cwb_MDP0000272119|PACid:22671033 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000305861|PACid:22662391 .........VKLYPGV---....-----..----.-..-..------...-.........-.....-
cwb_MDP0000255696|PACid:22677008 .........P---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000214280|PACid:22681133 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000210966|PACid:22644665 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000610999|PACid:22659782 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000242546|PACid:22662348 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000320742|PACid:22645070 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000654164|PACid:22658363 .........L---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000256300|PACid:22644503 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000235080|PACid:22654616 .........MGLNIPHA--....FFKKA..HRWG.SafP..AASVAG...D.........E.....K
cwb_MDP0000284363|PACid:22634918 .........VKLYPMV---....-----..----.-..-..------...-.........-.....-
cwb_MDP0000125043|PACid:22648273 .........----------....LLSRW..GTDL.N..S..LGCYAL...D.........L.....V
cwb_MDP0000192359|PACid:22632529 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000440005|PACid:22623062 .........TGKRVGSA--....WLKETvlKNCL.D..V..NGRLIV...D.........A.....N
cwb_MDP0000609131|PACid:22633588 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000362000|PACid:22628256 .........TGVGPSP---....LVNSL..PLTK.S..P..GGRIGV...D.........E.....W
cwb_MDP0000150210|PACid:22663655 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000158790|PACid:22624362 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000427950|PACid:22623610 .........K--------A....VVENT..ELDA.F..V..SSPLRY...R.........H.....P
cwb_MDP0000569169|PACid:22666591 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000525742|PACid:22647174 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000559829|PACid:22672870 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000321788|PACid:22641842 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000919183|PACid:22661837 .........-------E--....FVKKL..NLPK.S..P..GGRIGV...D.........G.....W
cwb_MDP0000146158|PACid:22623090 .........-------E--....FVKKL..XLPK.S..P..GGRIGV...D.........G.....W
cwb_MDP0000832077|PACid:22645850 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000621365|PACid:22669861 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000875229|PACid:22620206 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000251344|PACid:22682514 .........VGHDPATE--....-FLGG..QLKL.D..V..DGWVCC...D.........E.....-
cwb_MDP0000168919|PACid:22641114 .........--FQVPPE--....LYTAFlvAIDK.G..N..RKAMPT...R.........S.....M
cwb_MDP0000267855|PACid:22645516 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000195207|PACid:22668389 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000400145|PACid:22662498 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000919183|PACid:22661837 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000307336|PACid:22681275 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000263146|PACid:22654671 .........----------....FMKQI..GQTN.-..-..RRVLAT...D.........E.....W
cwb_MDP0000309730|PACid:22638555 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000163903|PACid:22648802 .........----------....WLRESilQNDL.D..M..QGRLMV...D.........R.....N
cwb_MDP0000611628|PACid:22643604 .........------E---....FVKKL..XLPK.S..P..GGRIGV...D.........G.....W
cwb_MDP0000119779|PACid:22649695 .........----------....WLRESilQNDL.D..M..QGRLMV...D.........R.....N
cwb_MDP0000120904|PACid:22629470 .........TKVAPQVXPE....LYTAF..LVAI.D..KgnIKTMPT...R.........S.....M
cwb_MDP0000150544|PACid:22634453 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000902209|PACid:22678199 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000269370|PACid:22680893 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000146158|PACid:22623090 .........TGVGPSE---....FVKKL..XLPK.S..P..GGRIGV...D.........G.....W
cwb_MDP0000124051|PACid:22654473 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000255696|PACid:22677008 .........----PFIKD-....FMAQV..GQAN.-..-..RRALAT...D.........E.....W
cwb_MDP0000305861|PACid:22662391 .........----------....FMTQ-..-VGQ.G..N..RRALAT...D.........E.....W
cwb_MDP0000611628|PACid:22643604 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000309622|PACid:22670269 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000239909|PACid:22648375 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000126888|PACid:22675379 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000869086|PACid:22644121 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000317524|PACid:22631851 .........T---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000160099|PACid:22658087 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000251205|PACid:22649529 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000314335|PACid:22679828 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000638870|PACid:22646063 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000790657|PACid:22654829 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000748068|PACid:22649054 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000727481|PACid:22682921 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000301246|PACid:22669391 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000190684|PACid:22677586 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000456223|PACid:22643829 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000745172|PACid:22667211 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000407932|PACid:22626437 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000440896|PACid:22680420 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000694227|PACid:22673619 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000123987|PACid:22662898 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000138005|PACid:22620884 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000258205|PACid:22638470 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000245245|PACid:22671727 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000306704|PACid:22680179 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000478654|PACid:22674637 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000728219|PACid:22657389 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000170414|PACid:22675630 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000284363|PACid:22634918 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000219560|PACid:22625984 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000235930|PACid:22635275 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000755938|PACid:22650525 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000138851|PACid:22674897 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000261638|PACid:22646820 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000317524|PACid:22631851 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000294615|PACid:22655955 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000208234|PACid:22624840 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000216129|PACid:22668259 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000219521|PACid:22657613 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000248995|PACid:22642703 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000256328|PACid:22629063 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000181673|PACid:22646891 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000169201|PACid:22625917 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000263530|PACid:22651991 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000295839|PACid:22658517 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000297466|PACid:22645872 .........----------....VQTAY..GIEV.E..E..WSWIPV...G.........G.....S
cwb_MDP0000281982|PACid:22629373 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000053966|PACid:22620929 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000795740|PACid:22666880 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000212327|PACid:22630830 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000437365|PACid:22632357 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000135231|PACid:22629791 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000167343|PACid:22638473 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000222306|PACid:22645946 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000183517|PACid:22634175 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000686821|PACid:22637777 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000430157|PACid:22655785 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000373054|PACid:22683333 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000295306|PACid:22673308 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000233995|PACid:22662680 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000209681|PACid:22642739 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000876898|PACid:22679933 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000738522|PACid:22680891 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000399642|PACid:22674547 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000215521|PACid:22667208 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000170521|PACid:22675770 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000262982|PACid:22620906 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000321186|PACid:22667177 lgcgxvlksI---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000266051|PACid:22641431 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000837610|PACid:22643529 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000582079|PACid:22634000 .........----------....WLQDD..NHYF.N..E..NGMPQK...S.........Fpn...H
cwb_MDP0000538071|PACid:22663035 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000241703|PACid:22642424 .........----------....-----..----.-..-..------...-.........-.....L
cwb_MDP0000671114|PACid:22638724 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000315388|PACid:22681954 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000134271|PACid:22620865 .........Y---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000297581|PACid:22646099 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000911003|PACid:22677366 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000576650|PACid:22634720 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000149205|PACid:22670334 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000315409|PACid:22681973 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000320804|PACid:22671446 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000474647|PACid:22667377 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000566648|PACid:22666666 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000171379|PACid:22629613 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000814529|PACid:22673539 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000218295|PACid:22671514 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000220943|PACid:22675739 .........Y---------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000795437|PACid:22664825 .........----------....-----..----.-..E..------...-.........-.....-
cwb_MDP0000919706|PACid:22656631 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000295675|PACid:22626457 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000147542|PACid:22652542 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000272126|PACid:22655119 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000196881|PACid:22654963 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000268346|PACid:22678394 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000147542|PACid:22652542 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000948298|PACid:22676144 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000220943|PACid:22675739 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000182589|PACid:22648509 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000557870|PACid:22631128 .........----------....WLKDY..KYLL.N..D..DGKPKG...N.........Y.....P
cwb_MDP0000308870|PACid:22652882 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000322449|PACid:22657441 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000286494|PACid:22671310 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000150868|PACid:22621264 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000155608|PACid:22665289 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000168505|PACid:22672316 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000196888|PACid:22670849 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000154812|PACid:22632894 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000186080|PACid:22622639 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000220012|PACid:22626541 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000169409|PACid:22673915 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000373095|PACid:22661923 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000235846|PACid:22627807 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000207126|PACid:22623152 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000268357|PACid:22630891 .........----------....-----..----.-..-..------...-.........-.....-
cwb_MDP0000149067|PACid:22669209 .........----------....-----..----.-..-..------...-.........-.....-


                                                             200                           210      
                                                               |                             |      
d1xdia1                          .........SRT..........L..ATGIYAAGDCT..........GLL..........PLASVAAM
cwb_MDP0000813172|PACid:22649115 .........GEVvtikgddpdvT..IPGLMAAGEAAcasvh.....GAN..........RLGANSLL
cwb_MDP0000251581|PACid:22621152 .........GEVvtikgddpdvT..IPGLMAAGEAAcasvh.....GAN..........RLGANSLL
cwb_MDP0000188391|PACid:22626210 .........GEVltikgddpd.Si.IPGLMAAGETAcasvh.....GAN..........RLGANSLL
cwb_MDP0000254144|PACid:22644986 .........AES..........V..GNRLFFAGEATtr........QHP..........ATMHGAFL
cwb_MDP0000321972|PACid:22643109 gkpgdiyerLRA..........P..LGNLFFGGEAVsm........DHQ..........GSVHGAYS
cwb_MDP0000299806|PACid:22682346 .........---..........G..DGRVFFAGEATnk........QYP..........ATMHGAFL
cwb_MDP0000283451|PACid:22680462 .........---..........G..DGRVFFAGEATnk........QYP..........ATMHGAFL
cwb_MDP0000296714|PACid:22644308 .........--P..........V..ENCLFFAGEATck........EHP..........DTVGGAMM
cwb_MDP0000162193|PACid:22629958 .........GRP..........V..ENCLFFAGEATck........EHP..........DTVGGAMM
cwb_MDP0000769741|PACid:22637873 .........LRV..........P..VDTLFFAGEATsv........DFP..........GSVHGAFA
cwb_MDP0000295277|PACid:22625688 .........FST..........N..VSGVYAIGDVI..........PGP..........MLAH----
cwb_MDP0000897124|PACid:22647159 .........FST..........N..VSGVYAIGDVI..........PGP..........MLAH----
cwb_MDP0000854208|PACid:22682207 .........GET..........N..VQGLYVAGEVActglh.....GAN..........RLASNSLL
cwb_MDP0000241767|PACid:22665328 .........--P..........V..ENCLFFAGEATck........EHP..........DTVGGAMM
cwb_MDP0000318858|PACid:22682838 .........FST..........N..VDGVFAAGDCR..........RGQ..........SLVVWAIS
cwb_MDP0000248995|PACid:22642703 .........---..........-..-----------..........---..........--------
cwb_MDP0000442206|PACid:22660061 .........FST..........N..VDGVFAAGDCR..........RGQ..........SLVVWAIS
cwb_MDP0000181673|PACid:22646891 .........---..........-..-----------..........---..........--------
cwb_MDP0000315409|PACid:22681973 .........---..........-..-----------..........---..........--------
cwb_MDP0000053966|PACid:22620929 .........---..........-..-----------..........---..........--------
cwb_MDP0000294615|PACid:22655955 .........---..........-..-----------..........---..........--------
cwb_MDP0000306147|PACid:22679041 .........--P..........V..ENCLFFAGEATck........EHP..........DTVGGAMM
cwb_MDP0000180064|PACid:22628138 .........NTT..........A..IDGLYCVGDSC..........FPG..........QGVIAVSF
cwb_MDP0000261625|PACid:22630921 .........---..........-..-----------..........---..........--------
cwb_MDP0000300208|PACid:22651331 .........SRT..........N..VPSIWAVGDVT..........NR-..........--------
cwb_MDP0000247171|PACid:22623108 .........---..........-..KQNITVAGDAM..........HPMtpdlg.....QGGCLALE
cwb_MDP0000308095|PACid:22667065 .........QKT..........P..VKNFFLAGSYTkq........DYI..........DSMEGATL
cwb_MDP0000319421|PACid:22624123 .........RXP..........Sr.AGTVSLAGDAM..........HTMgpfla.....QGGSAALE
cwb_MDP0000232295|PACid:22657598 .........---..........-..-----------..........---..........--------
cwb_MDP0000188994|PACid:22643055 .........GNI..........S..KGNVCVAGDAL..........HPMtpdig.....QGGCAALE
cwb_MDP0000159189|PACid:22672554 .........GNI..........S..KGNVCVAGDAL..........HPMtpdig.....QGGCAALE
cwb_MDP0000656178|PACid:22657871 .........MRVidang.....Kl.VPHLFCIGDAN..........GKM..........MLAHAASA
cwb_MDP0000910523|PACid:22620639 .........---..........-..KQNITVAGDAM..........HPMtpdlg.....QGGCLALE
cwb_MDP0000119941|PACid:22643547 .........FXT..........N..VSGVYAIGDVI..........PGP..........MLAH----
cwb_MDP0000231799|PACid:22673471 .........MRVidang.....Kl.VPHLFCIGDAN..........GKM..........MLAHAASA
cwb_MDP0000255025|PACid:22624807 .........QKT..........P..VKNFFLAGSYTkq........DYI..........DSMEGATL
cwb_MDP0000231632|PACid:22622264 .........MEK..........N..LPGFFYAGNHR..........GGL..........S-VGKAIA
cwb_MDP0000173300|PACid:22648712 .........---..........-..-----------..........---..........--------
cwb_MDP0000158474|PACid:22655457 .........---..........-..-----------..........---..........--------
cwb_MDP0000276878|PACid:22649644 .........---..........-..-----------..........---..........--------
cwb_MDP0000154720|PACid:22639222 .........---..........-..-----------..........---..........--------
cwb_MDP0000549646|PACid:22624756 .........---..........-..-----------..........---..........--------
cwb_MDP0000158853|PACid:22672016 .........---..........-..-----------..........---..........--------
cwb_MDP0000702799|PACid:22650781 .........---..........-..-----------..........---..........--------
cwb_MDP0000233110|PACid:22669060 .........---..........-..-----------..........---..........--------
cwb_MDP0000260827|PACid:22621315 .........---..........-..-----------..........---..........--------
cwb_MDP0000941459|PACid:22654340 .........---..........-..-----------..........---..........--------
cwb_MDP0000185338|PACid:22637072 .........---..........-..-----------..........---..........--------
cwb_MDP0000451172|PACid:22678939 .........---..........-..-----------..........---..........--------
cwb_MDP0000136847|PACid:22626492 .........---..........-..-----------..........---..........--------
cwb_MDP0000177641|PACid:22624304 .........---..........-..-----------..........---..........--------
cwb_MDP0000413935|PACid:22663920 .........---..........-..-----------..........---..........--------
cwb_MDP0000206098|PACid:22637273 .........---..........-..-----------..........---..........--------
cwb_MDP0000845788|PACid:22673064 .........AKT..........S..VEGVFAAGDVQd.........HEW..........RQAVTAAG
cwb_MDP0000465595|PACid:22654474 .........---..........-..-----------..........---..........--------
cwb_MDP0000137211|PACid:22645789 .........---..........-..-----------..........---..........--------
cwb_MDP0000130099|PACid:22624356 .........---..........-..-----------..........---..........--------
cwb_MDP0000425135|PACid:22674685 .........---..........-..-----------..........---..........--------
cwb_MDP0000200780|PACid:22660656 .........LWPgisppa....S..AGRVVLVGDAW..........HPMtpnlg.....QGACCALE
cwb_MDP0000142434|PACid:22683351 .........-NF..........R..KGSVTVAGDAM..........HVMgpfig.....QGGSAGIE
cwb_MDP0000248951|PACid:22626490 .........---..........-..-----------..........---..........--------
cwb_MDP0000869086|PACid:22644121 .........---..........-..-----------..........---..........--------
cwb_MDP0000318256|PACid:22681338 .........---..........-..-----------..........---..........--------
cwb_MDP0000231634|PACid:22622267 .........MEK..........N..LPGFFYAGNHR..........GGL..........S-VDNAIA
cwb_MDP0000626995|PACid:22630905 .........---..........-..-----------..........---..........--------
cwb_MDP0000123832|PACid:22633934 .........---..........-..KQNITVAGDAM..........HPMtpdlg.....QGGCLALE
cwb_MDP0000236092|PACid:22632501 .........---..........-..-----------..........---..........--------
cwb_MDP0000199159|PACid:22674497 .........---..........-..-----------..........---..........--------
cwb_MDP0000162755|PACid:22662459 .........---..........-..-----------..........---..........--------
cwb_MDP0000173666|PACid:22649255 .........MEK..........N..LPGFFYAGNHR..........GGL..........S-VDNAIA
cwb_MDP0000262982|PACid:22620906 .........---..........-..-----------..........---..........--------
cwb_MDP0000184832|PACid:22636281 .........---..........-..-----------..........---..........--------
cwb_MDP0000598927|PACid:22655979 .........GET..........N..VQGLXVAGEVActglh.....GAN..........RLASNSLL
cwb_MDP0000561228|PACid:22637769 .........---..........-..-----------..........---..........--------
cwb_MDP0000175650|PACid:22652650 .........VMHaevaekfl..Sc.GNRIILAGDAAh.........RFP..........PAGGFGMN
cwb_MDP0000233802|PACid:22672706 .........TQT..........S..VKGVFAAGDVQd.........KKY..........RQAITAAG
cwb_MDP0000321186|PACid:22667177 .........EDS..........S..IRKVYLVG---..........---..........--------
cwb_MDP0000161955|PACid:22660959 .........---..........-..-----------..........---..........--------
cwb_MDP0000213381|PACid:22663844 .........---..........-..-----------..........---..........--------
cwb_MDP0000168437|PACid:22624648 .........M-Paapr......P..TPGVLLMGDAV..........---..........--------
cwb_MDP0000823251|PACid:22668430 .........TQT..........S..VKGVFAAGDVQd.........KKY..........RQAITAAG
cwb_MDP0000191389|PACid:22631180 .........---..........-..-----------..........---..........--------
cwb_MDP0000199319|PACid:22658752 .........---..........-..-----------..........---..........--------
cwb_MDP0000857446|PACid:22649571 .........---..........-..-----------..........---..........--------
cwb_MDP0000266638|PACid:22658651 .........---..........-..-----------..........---..........--------
cwb_MDP0000208936|PACid:22641581 .........---..........-..-----------..........---..........--------
cwb_MDP0000202883|PACid:22663993 .........---..........-..-----------..........---..........--------
cwb_MDP0000288439|PACid:22643642 .........---..........-..-----------..........---..........--------
cwb_MDP0000295839|PACid:22658517 .........---..........-..-----------..........---..........--------
cwb_MDP0000903805|PACid:22678063 .........---..........-..-----------..........---..........--------
cwb_MDP0000202123|PACid:22678734 .........SRT..........A..VPSIWAVGDVT..........DRV..........NLTPIALM
cwb_MDP0000227773|PACid:22639029 .........---..........-..-----------..........---..........--------
cwb_MDP0000317524|PACid:22631851 .........---..........-..-----------..........---..........--------
cwb_MDP0000320748|PACid:22658808 .........---..........-..-----------..........---..........--------
cwb_MDP0000634676|PACid:22625957 .........---..........-..-----------..........---..........--------
cwb_MDP0000235846|PACid:22627807 .........TQT..........S..VKGVFAAGDVQd.........KKY..........RQAITAAG
cwb_MDP0000251344|PACid:22682514 .........TQT..........S..VKGVFAAGDVQd.........KKY..........RQAITAAG
cwb_MDP0000501957|PACid:22671723 .........---..........-..-----------..........---..........--------
cwb_MDP0000209681|PACid:22642739 .........---..........-..-----------..........---..........--------
cwb_MDP0000293482|PACid:22637734 .........EQI..........X..WDKVVLVGDAAhpttp.....HAL..........RSTNMSVL
cwb_MDP0000233995|PACid:22662680 .........---..........-..-----------..........---..........--------
cwb_MDP0000257243|PACid:22657003 .........---..........-..-----------..........---..........--------
cwb_MDP0000160099|PACid:22658087 .........---..........-..-----------..........---..........--------
cwb_MDP0000193196|PACid:22649572 .........---..........-..-----------..........---..........--------
cwb_MDP0000208234|PACid:22624840 .........---..........-..-----------..........---..........--------
cwb_MDP0000251783|PACid:22654795 .........---..........-..-----------..........---..........--------
cwb_MDP0000686885|PACid:22670382 .........---..........-..-----------..........---..........--------
cwb_MDP0000138851|PACid:22674897 .........---..........-..-----------..........---..........--------
cwb_MDP0000194930|PACid:22667971 .........---..........-..-----------..........---..........--------
cwb_MDP0000169201|PACid:22625917 .........---..........-..-----------..........---..........--------
cwb_MDP0000399642|PACid:22674547 .........---..........-..-----------..........---..........--------
cwb_MDP0000582079|PACid:22634000 .........---..........-..-----------..........---..........--------
cwb_MDP0000129765|PACid:22673448 .........EKI..........Y..WDXVVLVGDAAhpttp.....HAL..........RSTNMSVL
cwb_MDP0000272655|PACid:22672104 .........---..........-..-----------..........---..........--------
cwb_MDP0000686821|PACid:22637777 .........---..........-..-----------..........---..........--------
cwb_MDP0000170414|PACid:22675630 .........---..........-..-----------..........---..........--------
cwb_MDP0000320804|PACid:22671446 .........---..........-..-----------..........---..........--------
cwb_MDP0000189790|PACid:22676146 .........PAT..........AshTPGALLMGDAV..........NMRhpitg.....GGMVVALS
cwb_MDP0000847111|PACid:22682055 .........---..........-..-----------..........---..........--------
cwb_MDP0000289536|PACid:22677728 .........---..........-..-----------..........---..........--------
cwb_MDP0000123987|PACid:22662898 .........---..........-..-----------..........---..........--------
cwb_MDP0000245245|PACid:22671727 .........---..........-..-----------..........---..........--------
cwb_MDP0000188553|PACid:22658192 .........LRA..........P..LGNLFFGGEAVsm........DHQ..........GSVHGAYS
cwb_MDP0000296599|PACid:22628159 .........---..........-..-----------..........---..........--------
cwb_MDP0000746652|PACid:22636428 .........---..........-..-----------..........---..........--------
cwb_MDP0000259265|PACid:22650727 .........---..........-..-----------..........---..........--------
cwb_MDP0000151331|PACid:22656760 .........---..........-..-----------..........---..........--------
cwb_MDP0000309775|PACid:22670556 .........YES..........Ts.LKGLYPVGEGA..........GYA..........GGIVSAAV
cwb_MDP0000232736|PACid:22657363 .........AES..........Vg.DGRLFFAGEATnr........RYP..........ATMHDAFX
cwb_MDP0000320539|PACid:22651795 .........---..........-..-----------..........---..........--------
cwb_MDP0000239909|PACid:22648375 .........---..........-..-----------..........---..........--------
cwb_MDP0000259264|PACid:22650726 .........---..........-..-----------..........---..........--------
cwb_MDP0000293613|PACid:22654008 .........---..........-..-----------..........---..........--------
cwb_MDP0000253362|PACid:22653297 .........---..........-..-----------..........---..........--------
cwb_MDP0000182973|PACid:22649063 .........---..........-..-----------..........---..........--------
cwb_MDP0000138005|PACid:22620884 .........---..........-..-----------..........---..........--------
cwb_MDP0000261301|PACid:22674262 .........---..........-..-----------..........---..........--------
cwb_MDP0000771633|PACid:22649768 .........--R..........V..RGRVALVGDAA..........GYVtkcsg.....EGIYFAAK
cwb_MDP0000851102|PACid:22674240 .........--R..........V..RGRVALVGDAA..........GYVtkcsg.....EGIYFAAK
cwb_MDP0000159873|PACid:22673571 .........PRR..........L..AGRVALVGDAA..........GYVtkcsg.....EGIYFAAK
cwb_MDP0000140206|PACid:22652348 .........---..........-..-----------..........---..........--------
cwb_MDP0000261201|PACid:22657417 .........PRR..........L..AGRVALVGDAA..........GYVtkcsg.....EGIYFAAK
cwb_MDP0000252244|PACid:22643267 .........PRR..........L..AGRVALVGDAA..........GYVtkcsg.....EGIYFAAK
cwb_MDP0000261821|PACid:22664612 .........FKT..........S..VPNVYAVGDVA..........TFPlklyneirrvEHVDHARK
cwb_MDP0000124454|PACid:22663639 .........AES..........Vg.DGRLFFAGEATnr........RYP..........ATMHDAFX
cwb_MDP0000234830|PACid:22664319 .........---..........-..-----------..........---..........--------
cwb_MDP0000297861|PACid:22646554 .........---..........-..-----------..........---..........--------
cwb_MDP0000152184|PACid:22632666 .........---..........-..-----------..........---..........--------
cwb_MDP0000157871|PACid:22670351 .........FET..........D..VPDVYAVGDVAtfhmklyddmRRV..........EHVDHARK
cwb_MDP0000250932|PACid:22662666 .........---..........-..-----------..........---..........--------
cwb_MDP0000219521|PACid:22657613 .........---..........-..-----------..........---..........--------
cwb_MDP0000239289|PACid:22649630 .........---..........-..-----------..........---..........--------
cwb_MDP0000258995|PACid:22632347 .........---..........-..-----------..........---..........--------
cwb_MDP0000167343|PACid:22638473 .........---..........-..-----------..........---..........--------
cwb_MDP0000222306|PACid:22645946 .........---..........-..-----------..........---..........--------
cwb_MDP0000829384|PACid:22650105 .........---..........-..-----------..........---..........--------
cwb_MDP0000145663|PACid:22632174 .........---..........-..-----------..........---..........--------
cwb_MDP0000288439|PACid:22643642 .........---..........-..-----------..........---..........--------
cwb_MDP0000267350|PACid:22676208 .........FKT..........S..VPDVYAVGDVA..........TFPlklyneirrvEHVDHARK
cwb_MDP0000155608|PACid:22665289 .........---..........-..-----------..........---..........--------
cwb_MDP0000194622|PACid:22683388 .........---..........-..-----------..........---..........--------
cwb_MDP0000134271|PACid:22620865 .........---..........-..-----------..........---..........--------
cwb_MDP0000312748|PACid:22644976 .........---..........-..-----------..........---..........--------
cwb_MDP0000197715|PACid:22640206 .........---..........-..-----------..........---..........--------
cwb_MDP0000220943|PACid:22675739 .........---..........-..-----------..........---..........--------
cwb_MDP0000320539|PACid:22651795 .........MQS..........S..NSSVYAVGDVA..........TFPvkvfgesrrlEHVDSARK
cwb_MDP0000140206|PACid:22652348 .........FET..........D..VPYVYAVGDVA..........TFPmklyndmrrvEHVDHARK
cwb_MDP0000215521|PACid:22667208 .........---..........-..-----------..........---..........--------
cwb_MDP0000203847|PACid:22681509 .........---..........-..-----------..........---..........--------
cwb_MDP0000201011|PACid:22661057 .........---..........-..-----------..........---..........--------
cwb_MDP0000204596|PACid:22635084 .........---..........-..-----------..........---..........--------
cwb_MDP0000148978|PACid:22620687 .........---..........-..-----------..........---..........--------
cwb_MDP0000130369|PACid:22663416 .........---..........-..-----------..........---..........--------
cwb_MDP0000314606|PACid:22664349 .........---..........-..-----------..........---..........--------
cwb_MDP0000263146|PACid:22654671 .........---..........-..-----------..........---..........--------
cwb_MDP0000250583|PACid:22633065 .........LRV..........Kg.HPRIFAVGDSCalresn....GRLlp........ATAQVAFQ
cwb_MDP0000208233|PACid:22624841 .........NHW..........Kg.KNGLYCVG---..........---..........--------
cwb_MDP0000158720|PACid:22655873 .........---..........-..-----------..........---..........--------
cwb_MDP0000152184|PACid:22632666 .........MQS..........S..NSSVYAVGDVA..........TFPvkvfgesrrlEHVDSARK
cwb_MDP0000182702|PACid:22680484 .........NTT..........A..MDGLYCVGDSC..........FPG..........QGVIAVSF
cwb_MDP0000261638|PACid:22646820 .........---..........-..-----------..........---..........--------
cwb_MDP0000130370|PACid:22654204 .........GAT..........S..FQNLFMAGDWI..........---..........--------
cwb_MDP0000272119|PACid:22671033 .........---..........-..-----------..........---..........--------
cwb_MDP0000305861|PACid:22662391 .........---..........-..-----------..........---..........--------
cwb_MDP0000255696|PACid:22677008 .........---..........-..-----------..........---..........--------
cwb_MDP0000214280|PACid:22681133 .........---..........-..-----------..........---..........--------
cwb_MDP0000210966|PACid:22644665 .........---..........-..-----------..........---..........--------
cwb_MDP0000610999|PACid:22659782 .........---..........-..-----------..........---..........--------
cwb_MDP0000242546|PACid:22662348 .........---..........-..-----------..........---..........--------
cwb_MDP0000320742|PACid:22645070 .........---..........-..-----------..........---..........--------
cwb_MDP0000654164|PACid:22658363 .........---..........-..-----------..........---..........--------
cwb_MDP0000256300|PACid:22644503 .........---..........-..-----------..........---..........--------
cwb_MDP0000235080|PACid:22654616 .........CLW..........Dk.NKRLAICGDFC..........-VS..........PNVEGAIA
cwb_MDP0000284363|PACid:22634918 .........---..........-..-----------..........---..........--------
cwb_MDP0000125043|PACid:22648273 gkpgdiyerLRA..........P..LGNLFFGGEAVsm........DHQ..........GSVHGAYS
cwb_MDP0000192359|PACid:22632529 .........---..........-..-----------..........---..........--------
cwb_MDP0000440005|PACid:22623062 .........LRV..........Kg.RKNTFAVGDIT..........NIAei........KQGYLAQK
cwb_MDP0000609131|PACid:22633588 .........---..........-..-----------..........---..........--------
cwb_MDP0000362000|PACid:22628256 .........LRV..........Pd.VQDVYSIGDCS..........GFVestgkptlp.ALAQVAER
cwb_MDP0000150210|PACid:22663655 .........---..........-..-----------..........---..........--------
cwb_MDP0000158790|PACid:22624362 .........---..........-..-----------..........---..........--------
cwb_MDP0000427950|PACid:22623610 .........WEIlwxni.....S..KGNVCVAGDAL..........HPMtpdig.....QGGCAALE
cwb_MDP0000569169|PACid:22666591 .........---..........-..-----------..........---..........--------
cwb_MDP0000525742|PACid:22647174 .........---..........-..-----------..........---..........--------
cwb_MDP0000559829|PACid:22672870 .........---..........-..-----------..........---..........--------
cwb_MDP0000321788|PACid:22641842 .........---..........-..-----------..........---..........--------
cwb_MDP0000919183|PACid:22661837 .........MRV..........Ps.VEDVFALGDCA..........GFLehtgrpvlp.ALAQVAER
cwb_MDP0000146158|PACid:22623090 .........MRV..........Ps.VEDVFALGDCA..........GFLeetgrpvlp.ALAQVAER
cwb_MDP0000832077|PACid:22645850 .........---..........-..-----------..........---..........--------
cwb_MDP0000621365|PACid:22669861 .........---..........-..-----------..........---..........--------
cwb_MDP0000875229|PACid:22620206 .........---..........-..-----------..........---..........--------
cwb_MDP0000251344|PACid:22682514 .........---..........-..-----------..........---..........--------
cwb_MDP0000168919|PACid:22641114 .........PAT..........AyhTPGALLMGDAVnm........RHPitg.......GGMVVA--
cwb_MDP0000267855|PACid:22645516 .........---..........-..-----------..........---..........--------
cwb_MDP0000195207|PACid:22668389 .........---..........-..-----------..........---..........--------
cwb_MDP0000400145|PACid:22662498 .........---..........-..-----------..........---..........--------
cwb_MDP0000919183|PACid:22661837 .........---..........-..-----------..........---..........--------
cwb_MDP0000307336|PACid:22681275 .........---..........-..-----------..........---..........--------
cwb_MDP0000263146|PACid:22654671 .........LRV..........Eg.CDGVYALGDCA..........TV-..........--------
cwb_MDP0000309730|PACid:22638555 .........---..........-..-----------..........---..........--------
cwb_MDP0000163903|PACid:22648802 .........MRV..........Rg.HKNIFAVGDIT..........D--..........--------
cwb_MDP0000611628|PACid:22643604 .........MRV..........Ps.VEDVFALGDCA..........GFLeetgrpvlp.ALAQVAER
cwb_MDP0000119779|PACid:22649695 .........MRV..........Rg.HKNIFAVGDIT..........---..........--------
cwb_MDP0000120904|PACid:22629470 .........PAT..........AshTPGALLMGDAV..........NMRhpitg.....GGMVVALS
cwb_MDP0000150544|PACid:22634453 .........---..........-..-----------..........---..........--------
cwb_MDP0000902209|PACid:22678199 .........---..........-..-----------..........---..........--------
cwb_MDP0000269370|PACid:22680893 .........---..........-..-----------..........---..........--------
cwb_MDP0000146158|PACid:22623090 .........MRV..........Ps.VEDVFALGDCA..........GFLeetgrpvlp.ALAQVAER
cwb_MDP0000124051|PACid:22654473 .........---..........-..-----------..........---..........--------
cwb_MDP0000255696|PACid:22677008 .........LRV..........Eg.CDKVYAIGDCA..........T--..........--------
cwb_MDP0000305861|PACid:22662391 .........LRV..........Eg.CDKVYAIGDCA..........T--..........--------
cwb_MDP0000611628|PACid:22643604 .........---..........-..-----------..........---..........--------
cwb_MDP0000309622|PACid:22670269 .........---..........-..-----------..........---..........--------
cwb_MDP0000239909|PACid:22648375 .........---..........-..-----------..........---..........--------
cwb_MDP0000126888|PACid:22675379 .........---..........-..-----------..........---..........--------
cwb_MDP0000869086|PACid:22644121 .........---..........-..-----------..........---..........--------
cwb_MDP0000317524|PACid:22631851 .........---..........-..-----------..........---..........--------
cwb_MDP0000160099|PACid:22658087 .........---..........-..-----------..........---..........--------
cwb_MDP0000251205|PACid:22649529 .........---..........Y..WDXVVLVGDAAhpttp.....HAL..........RSTNMSVL
cwb_MDP0000314335|PACid:22679828 .........---..........-..-----------..........---..........--------
cwb_MDP0000638870|PACid:22646063 .........---..........-..-----------..........---..........--------
cwb_MDP0000790657|PACid:22654829 .........---..........-..-----------..........---..........--------
cwb_MDP0000748068|PACid:22649054 .........---..........-..-----------..........---..........--------
cwb_MDP0000727481|PACid:22682921 .........---..........-..-----------..........---..........--------
cwb_MDP0000301246|PACid:22669391 .........---..........-..FPGGALIGCSA..........GFLnvpki.....KGTHTAMK
cwb_MDP0000190684|PACid:22677586 .........---..........-..-----------..........---..........--------
cwb_MDP0000456223|PACid:22643829 .........---..........-..-----------..........---..........--------
cwb_MDP0000745172|PACid:22667211 .........---..........-..-----------..........---..........--------
cwb_MDP0000407932|PACid:22626437 .........---..........-..-----------..........---..........--------
cwb_MDP0000440896|PACid:22680420 .........---..........-..-----------..........---..........--------
cwb_MDP0000694227|PACid:22673619 .........---..........-..-----------..........---..........--------
cwb_MDP0000123987|PACid:22662898 .........---..........-..-----------..........---..........--------
cwb_MDP0000138005|PACid:22620884 .........---..........-..-----------..........---..........--------
cwb_MDP0000258205|PACid:22638470 .........---..........-..-----------..........---..........--------
cwb_MDP0000245245|PACid:22671727 .........---..........-..-----------..........---..........--------
cwb_MDP0000306704|PACid:22680179 .........---..........-..-----------..........---..........--------
cwb_MDP0000478654|PACid:22674637 .........---..........-..-----------..........---..........--------
cwb_MDP0000728219|PACid:22657389 .........---..........-..-----------..........---..........--------
cwb_MDP0000170414|PACid:22675630 .........---..........-..-----------..........---..........--------
cwb_MDP0000284363|PACid:22634918 .........---..........-..-----------..........---..........--------
cwb_MDP0000219560|PACid:22625984 .........---..........-..-----------..........---..........--------
cwb_MDP0000235930|PACid:22635275 .........---..........-..-----------..........---..........--------
cwb_MDP0000755938|PACid:22650525 .........---..........-..-----------..........---..........--------
cwb_MDP0000138851|PACid:22674897 .........---..........-..-----------..........---..........--------
cwb_MDP0000261638|PACid:22646820 .........---..........-..-----------..........---..........--------
cwb_MDP0000317524|PACid:22631851 .........---..........-..-----------..........---..........--------
cwb_MDP0000294615|PACid:22655955 .........---..........-..-----------..........---..........--------
cwb_MDP0000208234|PACid:22624840 .........---..........-..-----------..........---..........--------
cwb_MDP0000216129|PACid:22668259 .........---..........Vg.DGRLFFAGEATnr........RYP..........ATMHDAFX
cwb_MDP0000219521|PACid:22657613 .........---..........-..-----------..........---..........--------
cwb_MDP0000248995|PACid:22642703 .........---..........-..-----------..........---..........--------
cwb_MDP0000256328|PACid:22629063 .........---..........-..-----------..........---..........--------
cwb_MDP0000181673|PACid:22646891 .........---..........-..-----------..........---..........--------
cwb_MDP0000169201|PACid:22625917 .........---..........-..-----------..........---..........--------
cwb_MDP0000263530|PACid:22651991 .........---..........-..-----------..........---..........--------
cwb_MDP0000295839|PACid:22658517 .........---..........-..-----------..........---..........--------
cwb_MDP0000297466|PACid:22645872 .........LP-..........-..-----------..........---..........--------
cwb_MDP0000281982|PACid:22629373 .........---..........-..-----------..........---..........--------
cwb_MDP0000053966|PACid:22620929 .........---..........-..-----------..........---..........--------
cwb_MDP0000795740|PACid:22666880 .........---..........-..-----------..........---..........--------
cwb_MDP0000212327|PACid:22630830 .........---..........-..-----------..........---..........--------
cwb_MDP0000437365|PACid:22632357 .........---..........-..-----------..........---..........--------
cwb_MDP0000135231|PACid:22629791 .........---..........-..-----------..........---..........--------
cwb_MDP0000167343|PACid:22638473 .........---..........-..-----------..........---..........--------
cwb_MDP0000222306|PACid:22645946 .........---..........-..-----------..........---..........--------
cwb_MDP0000183517|PACid:22634175 .........---..........-..-----------..........---..........--------
cwb_MDP0000686821|PACid:22637777 .........---..........-..-----------..........---..........--------
cwb_MDP0000430157|PACid:22655785 .........---..........-..----R------..........---..........--------
cwb_MDP0000373054|PACid:22683333 .........---..........-..-----------..........---..........--------
cwb_MDP0000295306|PACid:22673308 .........---..........-..-----------..........---..........--------
cwb_MDP0000233995|PACid:22662680 .........---..........-..-----------..........---..........--------
cwb_MDP0000209681|PACid:22642739 .........---..........-..-----------..........---..........--------
cwb_MDP0000876898|PACid:22679933 .........---..........-..-----------..........---..........--M-----
cwb_MDP0000738522|PACid:22680891 .........---..........-..-----------..........---..........--------
cwb_MDP0000399642|PACid:22674547 .........---..........-..-----------..........---..........--------
cwb_MDP0000215521|PACid:22667208 .........---..........-..-----------..........---..........--------
cwb_MDP0000170521|PACid:22675770 .........---..........-..-----------..........---..........--------
cwb_MDP0000262982|PACid:22620906 .........---..........-..-----------..........---..........--------
cwb_MDP0000321186|PACid:22667177 .........---..........-..-----------..........---..........--------
cwb_MDP0000266051|PACid:22641431 .........---..........-..-----------..........---..........--------
cwb_MDP0000837610|PACid:22643529 .........---..........-..-PGAILLGDAL..........NMRhpltg.....GG------
cwb_MDP0000582079|PACid:22634000 .........WKS..........E..KKGLYSAG---..........---..........--------
cwb_MDP0000538071|PACid:22663035 .........---..........-..-----------..........---..........--------
cwb_MDP0000241703|PACid:22642424 .........QRS..........P..LEGFYLAGDYTkq........KYL..........ASMEGAVL
cwb_MDP0000671114|PACid:22638724 .........---..........-..-----------..........---..........--------
cwb_MDP0000315388|PACid:22681954 .........---..........-..-----------..........---..........--------
cwb_MDP0000134271|PACid:22620865 .........---..........-..-----------..........---..........--------
cwb_MDP0000297581|PACid:22646099 .........---..........-..-----------..........---..........--------
cwb_MDP0000911003|PACid:22677366 .........---..........-..-----------..........---..........--------
cwb_MDP0000576650|PACid:22634720 .........---..........-..-----------..........---..........--------
cwb_MDP0000149205|PACid:22670334 .........---..........-..-----------..........---..........--------
cwb_MDP0000315409|PACid:22681973 .........---..........-..-----------..........---..........--------
cwb_MDP0000320804|PACid:22671446 .........---..........-..-----------..........---..........--------
cwb_MDP0000474647|PACid:22667377 .........---..........-..-----------..........---..........--------
cwb_MDP0000566648|PACid:22666666 .........---..........-..-----------..........---..........--------
cwb_MDP0000171379|PACid:22629613 .........---..........-..-----------..........---..........--------
cwb_MDP0000814529|PACid:22673539 .........---..........-..-----------..........---..........--------
cwb_MDP0000218295|PACid:22671514 .........---..........-..-----------..........---..........--------
cwb_MDP0000220943|PACid:22675739 .........---..........-..-----------..........---..........--------
cwb_MDP0000795437|PACid:22664825 .........---..........-..-----------..........---..........--------
cwb_MDP0000919706|PACid:22656631 .........---..........-..-----------..........---..........--------
cwb_MDP0000295675|PACid:22626457 .........---..........-..-----------..........---..........--------
cwb_MDP0000147542|PACid:22652542 .........---..........-..-----------..........---..........--------
cwb_MDP0000272126|PACid:22655119 .........---..........-..-----------..........---..........--------
cwb_MDP0000196881|PACid:22654963 .........---..........-..-----------..........---..........--------
cwb_MDP0000268346|PACid:22678394 .........---..........-..-----------..........---..........--------
cwb_MDP0000147542|PACid:22652542 .........---..........-..-----------..........---..........--------
cwb_MDP0000948298|PACid:22676144 .........---..........-..-----------..........---..........--------
cwb_MDP0000220943|PACid:22675739 .........---..........-..-----------..........---..........--------
cwb_MDP0000182589|PACid:22648509 .........---..........-..-----------..........---..........--------
cwb_MDP0000557870|PACid:22631128 .........NHW..........Kg.EKGVYCVGLAG..........NG-..........--------
cwb_MDP0000308870|PACid:22652882 .........---..........-..-----------..........---..........--------
cwb_MDP0000322449|PACid:22657441 .........---..........-..-----------..........---..........--------
cwb_MDP0000286494|PACid:22671310 .........---..........-..-----------..........---..........--------
cwb_MDP0000150868|PACid:22621264 .........---..........-..-----------..........---..........--------
cwb_MDP0000155608|PACid:22665289 .........---..........-..-----------..........---..........--------
cwb_MDP0000168505|PACid:22672316 .........---..........-..-----------..........---..........--------
cwb_MDP0000196888|PACid:22670849 .........---..........-..-----------..........---..........--------
cwb_MDP0000154812|PACid:22632894 .........---..........-..-----------..........---..........--------
cwb_MDP0000186080|PACid:22622639 .........---..........-..-----------..........---..........--------
cwb_MDP0000220012|PACid:22626541 .........---..........-..-----------..........---..........--------
cwb_MDP0000169409|PACid:22673915 .........---..........-..-----------..........---..........--------
cwb_MDP0000373095|PACid:22661923 .........-ST..........S..IPQLYCCGDSTf.........PGI..........G-VPAVAA
cwb_MDP0000235846|PACid:22627807 .........---..........-..-----------..........---..........--------
cwb_MDP0000207126|PACid:22623152 .........---..........-..-----------..........---..........--------
cwb_MDP0000268357|PACid:22630891 .........---..........-..-----------..........---..........--------
cwb_MDP0000149067|PACid:22669209 .........---..........-..-----------..........---..........--------


                                      220       230                                                 
                                        |         |                                                 
d1xdia1                          Q....GRIAMYHALGEGV----spir.........................................
cwb_MDP0000813172|PACid:22649115 DivvfGRACANRV---------aeihkpgek....................................
cwb_MDP0000251581|PACid:22621152 D....-----------------ivvfgra......................................
cwb_MDP0000188391|PACid:22626210 DivvfGRACANR----------vaeihkpgek...................................
cwb_MDP0000254144|PACid:22644986 S....GLREASCI---------yr...........................................
cwb_MDP0000321972|PACid:22643109 A....GVMAAENCQ--------qhl..........................................
cwb_MDP0000299806|PACid:22682346 S....GMREAANIL--------r............................................
cwb_MDP0000283451|PACid:22680462 S....GMREAANIL--------r............................................
cwb_MDP0000296714|PACid:22644308 S....GLREAVRII--------dil..........................................
cwb_MDP0000162193|PACid:22629958 S....GLREAVRII--------dil..........................................
cwb_MDP0000769741|PACid:22637873 T....GAMAAE-----------d............................................
cwb_MDP0000295277|PACid:22625688 -....-----------------.............................................
cwb_MDP0000897124|PACid:22647159 -....-----------------.............................................
cwb_MDP0000854208|PACid:22682207 E....ALVFARRAVQ-------psikhmkcss...................................
cwb_MDP0000241767|PACid:22665328 S....GLREAVRII--------dil..........................................
cwb_MDP0000318858|PACid:22682838 E....GRQAAAQVDK-------yl...........................................
cwb_MDP0000248995|PACid:22642703 -....-----------------lpnkvrkvgkvaraiaimshpipntneshsvqvilpqkqlgrrsd
cwb_MDP0000442206|PACid:22660061 E....GRQVAAQVDK-------yl...........................................
cwb_MDP0000181673|PACid:22646891 -....-----------------lpnkvrkvgkvaraiaimshpipntneshsvqvilpqkqlgrrsd
cwb_MDP0000315409|PACid:22681973 -....-----------------psylp........................................
cwb_MDP0000053966|PACid:22620929 -....-----------------ylpdkvkkvgkvaraicimshpipntqdshsvqvilpqkqlgrks
cwb_MDP0000294615|PACid:22655955 -....-----------------ylpdkvkkvgkvaraicimshpipntqdshsvqvilpqkqlgrks
cwb_MDP0000306147|PACid:22679041 S....GLREAVRII--------dil..........................................
cwb_MDP0000180064|PACid:22628138 S....GVMCAHRVAA-------d............................................
cwb_MDP0000261625|PACid:22630921 -....-----------------fpykfwpcgpgqefflyaherrgyytfwqhmenaypgsnmlvvtl
cwb_MDP0000300208|PACid:22651331 -....-----------------vn...........................................
cwb_MDP0000247171|PACid:22623108 D....AVVLGRYI---------gtsfvqngrlvpkeidsaigkyveerrwrvalltagsylsgwvqh
cwb_MDP0000308095|PACid:22667065 S....GRQASAYIC--------d............................................
cwb_MDP0000319421|PACid:22624123 D....AVVLARCLAQK------trvdlrgrgtklmveealdqyvkerktrvlxlslqtyligkmfht
cwb_MDP0000232295|PACid:22657598 -....-----------------niqlvldleavgkgmkdnpgialladptpknfppeppkvvgiadd
cwb_MDP0000188994|PACid:22643055 D....GVVLARCLG--------eallkssrhetkdkageegkeeyerietglkkyaterrwrsfdli
cwb_MDP0000159189|PACid:22672554 D....GVVLARCL---------gxallkssrhetkdkageegkeeyerietglkkyaterrwrsfdl
cwb_MDP0000656178|PACid:22657871 Q....GISVVEQV---------tg...........................................
cwb_MDP0000910523|PACid:22620639 D....AVVLGRYI---------gtsfvqngqivpkemvsaigkyveerrwrvalliagsylsgwiqq
cwb_MDP0000119941|PACid:22643547 -....-----------------.............................................
cwb_MDP0000231799|PACid:22673471 Q....GISVVEQV---------tg...........................................
cwb_MDP0000255025|PACid:22624807 S....GRQASAYIC--------d............................................
cwb_MDP0000231632|PACid:22622264 S....GCKAAELVIA-------yl...........................................
cwb_MDP0000173300|PACid:22648712 -....-----------------sglknknigrnlhlhpvlmawgyfpdsnsefkgknyeggiitsvy
cwb_MDP0000158474|PACid:22655457 -....-----------------gspqmlllsgigpkadlqklkipvvldnkfvgkgmadnpmnavfv
cwb_MDP0000276878|PACid:22649644 -....-----------------hxpdavrilgdqatsdelrvlgafqyvysdiflhrdkxlmprnpa
cwb_MDP0000154720|PACid:22639222 -....-----------------kvppkvlklvsermvfplslmhannyaskhvvligdaahtvhpla
cwb_MDP0000549646|PACid:22624756 -....-----------------ptfgammisgqkaa...............................
cwb_MDP0000158853|PACid:22672016 -....-----------------lvlepdvvdrisslfknlmdyaqgkkvfdespeivcngefeygkl
cwb_MDP0000702799|PACid:22650781 -....-----------------lvlepdvvdrisslfknlmdyaqgkkvfdespeivcngefeygkl
cwb_MDP0000233110|PACid:22669060 -....-----------------ssglknrnigrnlhlhpvllswgyfpqhesefxxkkyeggiitsi
cwb_MDP0000260827|PACid:22621315 -....-----------------anhghviladpspilfykisstevrclvdvpgqkvpsisngemak
cwb_MDP0000941459|PACid:22654340 -....-----------------tywvskknrdeqvsxytnwsxxllqeaifamheniqrtytsagdl
cwb_MDP0000185338|PACid:22637072 -....-----------------ydnprngisivppiplehsliqvvgitesgayieaasnvipfapp
cwb_MDP0000451172|PACid:22678939 -....-----------------pqaygviyrdahgirhyaylkmnskkneiilsagaigspqllmls
cwb_MDP0000136847|PACid:22626492 -....-----------------drgrrhgavellnkghpknlrvaihaaveriifsskasglsakgi
cwb_MDP0000177641|PACid:22624304 -....-----------------pqilllsgigpqkhlnkfnipvavnlksvgkgmtdnpciallaei
cwb_MDP0000413935|PACid:22663920 -....-----------------cnlphanhghviladpspilfyqisstevrclvdvpgqkvpsisn
cwb_MDP0000206098|PACid:22637273 -....-----------------ptfgammisgqkaa...............................
cwb_MDP0000845788|PACid:22673064 S....GCIAALSVER-------yl...........................................
cwb_MDP0000465595|PACid:22654474 -....-----------------aggirfiksngnssetyeahlnqtenscsrgdvilaaaalgspqi
cwb_MDP0000137211|PACid:22645789 -....-----------------ngftldsvegtkisgalfdnrgrrygavellnkghpknlrvaiha
cwb_MDP0000130099|PACid:22624356 -....-----------------ykpnafawqtitqqafleagvlpdngfsldhvlgtritgstfdnn
cwb_MDP0000425135|PACid:22674685 -....-----------------pylsswgipvahhlpyvgqylydnprngisivppfplehsliqvv
cwb_MDP0000200780|PACid:22660656 D....AVILARKLAGA------iesgpasvedalssygserwprifpltvranlvgsllqwedpvvc
cwb_MDP0000142434|PACid:22683351 D....AIVIARSLA--------palaknyykkwsgrngmmvevgeafdkyvkerrmrlvmlstqtyl
cwb_MDP0000248951|PACid:22626490 -....-----------------drgrrhgavellnkghpknlrvaihaaveriifsskasglsakgi
cwb_MDP0000869086|PACid:22644121 -....-----------------melvdvaka....................................
cwb_MDP0000318256|PACid:22681338 -....-----------------rkipvvhpqpyvgqfmrdnprnyitilppfqveastaqvvgitsd
cwb_MDP0000231634|PACid:22622267 S....GCKAAELVIA-------yl...........................................
cwb_MDP0000626995|PACid:22630905 -....-----------------alvsmnhdtqscmdpnvmeakvvvsscghdgpm............
cwb_MDP0000123832|PACid:22633934 D....AVVLGRYI---------gtsfvqngrlvpkeidsaigkyveerrwrvalltagsylsgwvqh
cwb_MDP0000236092|PACid:22632501 -....-----------------alvsmnhdtqscmdpnvmeakvvvsscghdgpmg...........
cwb_MDP0000199159|PACid:22674497 -....-----------------melvdvakai...................................
cwb_MDP0000162755|PACid:22662459 -....-----------------gkipdkvkavventeldafvsvplryrhpwdilwgniskgnvcva
cwb_MDP0000173666|PACid:22649255 S....GCKAAELVIA-------yl...........................................
cwb_MDP0000262982|PACid:22620906 -....-----------------ldlcnhnafpsmvvrssvh..........................
cwb_MDP0000184832|PACid:22636281 -....-----------------sgigpxkhlnkfdipvavnlksvgkgmqdnpsialvpxvadakpk
cwb_MDP0000598927|PACid:22655979 E....ALVFARRA---------v............................................
cwb_MDP0000561228|PACid:22637769 -....-----------------pengfsldhvpetritgstfdnsgtrhaadellnrgdldnlrvav
cwb_MDP0000175650|PACid:22652650 T....GIQDSHNLAWK------iasvvegtaptsilnsyeterrpiavfntelsienfkaamavp..
cwb_MDP0000233802|PACid:22672706 S....G----------------.............................................
cwb_MDP0000321186|PACid:22667177 -....-----------------rwgpvqaactakelreilgikdlhvhkketdllptaadeeemknn
cwb_MDP0000161955|PACid:22660959 -....-----------------anhghvilgdpspilfypisgtevrclvdvpgtkvpsvangemak
cwb_MDP0000213381|PACid:22663844 -....-----------------encelphanhghvimgdpspilfypisstevrclvdvpgtkvpsv
cwb_MDP0000168437|PACid:22624648 -....-----------------nmrhpltgggmtvalsdivvlrnllrplhnlndapalckylesfy
cwb_MDP0000823251|PACid:22668430 S....G----------------.............................................
cwb_MDP0000191389|PACid:22631180 -....-----------------lphanhghvilgdpspilfypisstevrclvdvpgtkvpsvange
cwb_MDP0000199319|PACid:22658752 -....-----------------lencelphanhghvixgdpspilfypisxtevrclvdvpgtkvps
cwb_MDP0000857446|PACid:22649571 -....-----------------encelphanhghvilgdpspilfypisstevrclvdvpgtkvpsv
cwb_MDP0000266638|PACid:22658651 -....-----------------encelphanhghvixgdpspilfypisxtevphqllkaflaavdk
cwb_MDP0000208936|PACid:22641581 -....-----------------sglknrnigrnlhlhpvllawgyfpehepefkgksyeggiitslh
cwb_MDP0000202883|PACid:22663993 -....-----------------vglilencelphanhghvilgdpspilfypisstevrclvdvagt
cwb_MDP0000288439|PACid:22643642 -....-----------------pqilllsgigpqkhlnkfnipvavnlksvgkgmtdnpciallaei
cwb_MDP0000295839|PACid:22658517 -....-----------------gantsivvrspvh................................
cwb_MDP0000903805|PACid:22678063 -....-----------------pvvhpqpyigqxmrdnprnyvtilppfqielsttqvvgissdyyi
cwb_MDP0000202123|PACid:22678734 E....GGAIAKTLFL-------neptmpdyravpsavfsqppigqvglseeqaveqygd........
cwb_MDP0000227773|PACid:22639029 -....-----------------arqyivvvvvanslsgqdisidlvavakaiylsar..........
cwb_MDP0000317524|PACid:22631851 -....-----------------smelvdva.....................................
cwb_MDP0000320748|PACid:22658808 -....-----------------ilencelphanhghvilgdpspilfypisstevrclvdvpgtkxp
cwb_MDP0000634676|PACid:22625957 -....-----------------lencelphanhghvilgdpspilfypisstevrclvdvpgtkvps
cwb_MDP0000235846|PACid:22627807 S....-----------------a............................................
cwb_MDP0000251344|PACid:22682514 S....-----------------a............................................
cwb_MDP0000501957|PACid:22671723 -....-----------------encelphanhghvxlgdpspilfyxisstevrclvdvpgtkvpsv
cwb_MDP0000209681|PACid:22642739 -....-----------------dlsnsgantsivvrspv............................
cwb_MDP0000293482|PACid:22637734 D....AAXLGQCLKKW------gaedlqsaleeyqsirlpvvskqvlharrmgrikqglv.......
cwb_MDP0000233995|PACid:22662680 -....-----------------dlsnsgantsivvrspv............................
cwb_MDP0000257243|PACid:22657003 -....-----------------vafrpnvthwqsvvkdamleagvrpdngltldhilgskvsatlfd
cwb_MDP0000160099|PACid:22658087 -....-----------------arqyivvvvvanslsgqdisidlvavakai...............
cwb_MDP0000193196|PACid:22649572 -....-----------------encelphanhghvxlgdpspilfypisstevrclvdvpgtkvpsv
cwb_MDP0000208234|PACid:22624840 -....-----------------dlanhgaktsiivrspvhflsr.......................
cwb_MDP0000251783|PACid:22654795 -....-----------------aigspqllllsgvgsksyfsslkipvvhpqpyvgqfmrdnprnyi
cwb_MDP0000686885|PACid:22670382 -....-----------------spvvgriladlaltgeaegvelkqfriarfq..............
cwb_MDP0000138851|PACid:22674897 -....-----------------dlanhgaktsiivrspvh...........................
cwb_MDP0000194930|PACid:22667971 -....-----------------atpyktfkelvpdnalpdsfvraikysdyssgttkinlavdklpq
cwb_MDP0000169201|PACid:22625917 -....-----------------giehpctviyktehwtlpdylpw......................
cwb_MDP0000399642|PACid:22674547 -....-----------------giehpctviyktehwtlpdylpw......................
cwb_MDP0000582079|PACid:22634000 -....-----------------dlsnsgantsivirspv............................
cwb_MDP0000129765|PACid:22673448 D....AAVLGQCLKKW------gaedlqfalexyqsirlpvvrkqvlharrmgrikqg.........
cwb_MDP0000272655|PACid:22672104 -....-----------------veriifsskasglsakgiiysdsngrshralirgkgevilsagei
cwb_MDP0000686821|PACid:22637777 -....-----------------dlsnsgantsivvrspvh...........................
cwb_MDP0000170414|PACid:22675630 -....-----------------tviyktehwtlpdylpwgvpl........................
cwb_MDP0000320804|PACid:22671446 -....-----------------tvlyktehwnlpdylpwgfpiaylyf...................
cwb_MDP0000189790|PACid:22676146 -....-----------------dvvvlrnllrplrnlndvpalfkylesfytlrkvs..........
cwb_MDP0000847111|PACid:22682055 -....-----------------dlsnsgantsivirspv............................
cwb_MDP0000289536|PACid:22677728 -....-----------------spvvgriladlaltgeaqgvelkhfriarfq..............
cwb_MDP0000123987|PACid:22662898 -....-----------------giehpctviyktehwtvpdy.........................
cwb_MDP0000245245|PACid:22671727 -....-----------------giehpctviyktehwtvpdyl........................
cwb_MDP0000188553|PACid:22658192 A....GVMAAENC---------qr...........................................
cwb_MDP0000296599|PACid:22628159 -....-----------------krvagtvsshlrggqaqvkaeqacflpctddgvpvigevpgvkgc
cwb_MDP0000746652|PACid:22636428 -....-----------------anhghvilgdpspilfypisgtevrclvdvpgtkvpsvangemak
cwb_MDP0000259265|PACid:22650727 -....-----------------ndladngahaslvirs.............................
cwb_MDP0000151331|PACid:22656760 -....-----------------atgviyrdsngrshralvhdkgeiilssgtiaspqllllsgigpk
cwb_MDP0000309775|PACid:22670556 D....GMYAGFAVA--------k............................................
cwb_MDP0000232736|PACid:22657363 S....GLREAANMAHY------.............................................
cwb_MDP0000320539|PACid:22651795 -....-----------------nvtmvfpeehcmarlftpkiasfy.....................
cwb_MDP0000239909|PACid:22648375 -....-----------------eiagvakevhiasrsvad...........................
cwb_MDP0000259264|PACid:22650726 -....-----------------ndladngahaslvirsq............................
cwb_MDP0000293613|PACid:22654008 -....-----------------pfcdslrkmadqdakpmicpssgvhivlpdyyspegmglivp...
cwb_MDP0000253362|PACid:22653297 -....-----------------pfcdslrkmadqdakpmicpssgvhivlpdyyspegmglivpk..
cwb_MDP0000182973|PACid:22649063 -....-----------------sgtktlenwnrkfplqpemilipklvvnsaglsapalakrfdglr
cwb_MDP0000138005|PACid:22620884 -....-----------------kmvvevgdtfkkilkgtekvriensddmsvcqaisvvmdrhpels
cwb_MDP0000261301|PACid:22674262 -....-----------------fklvqqhlaasagddggsesskiseedlespfadflkrmrlppki
cwb_MDP0000771633|PACid:22649768 S....GRLCGEAIVKA------seggerminegdlkreylkewdgkyittfrfldllqkvfygsdaa
cwb_MDP0000851102|PACid:22674240 S....GRLCGEAIVKA------seggerminegdlkreylkewdgkyittfrfldllqkvfygsdaa
cwb_MDP0000159873|PACid:22673571 S....GRMCAEAIVEG------sengkrmvneadlrtylekwdktywptykvldvlqkvfyrsnpar
cwb_MDP0000140206|PACid:22652348 -....-----------------amrinkfdvtmvsrdpwcmprlftkeiaaf...............
cwb_MDP0000261201|PACid:22657417 S....GRMCAEAIVEG------sengkrmvneadlrtylekwdktywptykvldvlqkvfyrsnpar
cwb_MDP0000252244|PACid:22643267 S....GRMCAEAIVEG------sengkrmvneadlrtylekwdktywptykvldvlqkvfyrsnpar
cwb_MDP0000261821|PACid:22664612 S....AEQAVK-----------ai...........................................
cwb_MDP0000124454|PACid:22663639 S....GLREAANMAHY------.............................................
cwb_MDP0000234830|PACid:22664319 -....-----------------pfcdslrkmtdqdakpmicpssgvhivlpdyyspegmgliv....
cwb_MDP0000297861|PACid:22646554 -....-----------------lgdpspilfyqisstevrclvdvpgqrvppiangalanrlknvva
cwb_MDP0000152184|PACid:22632666 -....-----------------nvtmvfpeehcmarlftpkiasfy.....................
cwb_MDP0000157871|PACid:22670351 S....AEHAVRA----------i............................................
cwb_MDP0000250932|PACid:22662666 -....-----------------gkiwvgrtsmpagragesaslgltenlqrlgfetdxlktgtparv
cwb_MDP0000219521|PACid:22657613 -....-----------------vecaeanqg....................................
cwb_MDP0000239289|PACid:22649630 -....-----------------pnstevrclvdvpgqrvppiangamanylktavapqvppelhdaf
cwb_MDP0000258995|PACid:22632347 -....-----------------lgirpsppppgreesveefvrrnlgdevferliepfcsgvyagdp
cwb_MDP0000167343|PACid:22638473 -....-----------------ecaeanqgpegkpctmvvrtlhwivphywi...............
cwb_MDP0000222306|PACid:22645946 -....-----------------nqgpegkpctmvvrtlhwivphywiw...................
cwb_MDP0000829384|PACid:22650105 -....-----------------vpgallyplyghgeilqgftrraavkgciqvlrmpltallmdkqt
cwb_MDP0000145663|PACid:22632174 -....-----------------eehpfdldkmllmdwrdshlgnepylrtsnsrfptflyampfdsn
cwb_MDP0000288439|PACid:22643642 -....-----------------illlsgigpxkhlnkfdipvavnlksvgkgmqdnpsialvpxvad
cwb_MDP0000267350|PACid:22676208 S....AEQAVK-----------ai...........................................
cwb_MDP0000155608|PACid:22665289 -....-----------------vehsvenrfawqrflpagpiallpigdnfsnivwtmnpneatdrk
cwb_MDP0000194622|PACid:22683388 -....-----------------dvdkmlfmdwrdshlnnnielkerngriptflyampfssnrifle
cwb_MDP0000134271|PACid:22620865 -....-----------------ecaeanqg.....................................
cwb_MDP0000312748|PACid:22644976 -....-----------------rpsiikyetqlekfcefmdplldsappeslqcesscsvsdrfknk
cwb_MDP0000197715|PACid:22640206 -....-----------------sglknknigrnlhlhpvlmawgyfpdlnlefkgknyedgiitsvh
cwb_MDP0000220943|PACid:22675739 -....-----------------vecaea.......................................
cwb_MDP0000320539|PACid:22651795 S....ARHAVTAIME-------q............................................
cwb_MDP0000140206|PACid:22652348 S....AEHAVRAI---------r............................................
cwb_MDP0000215521|PACid:22667208 -....-----------------ecaeanqgpdgeactmvirtphw......................
cwb_MDP0000203847|PACid:22681509 -....-----------------nsgriyrspsh..................................
cwb_MDP0000201011|PACid:22661057 -....-----------------nngkiyr......................................
cwb_MDP0000204596|PACid:22635084 -....-----------------vfwddsvdyfgataeetelrgqrfmfwnvkktvgapvfialvvgk
cwb_MDP0000148978|PACid:22620687 -....-----------------lllpenwkempyfkk..............................
cwb_MDP0000130369|PACid:22663416 -....-----------------lqkiie.......................................
cwb_MDP0000314606|PACid:22664349 -....-----------------cdslrkmadqdakpmicpssgvhivlpdyyspegmglivpkt...
cwb_MDP0000263146|PACid:22654671 -....-----------------itvieasdhilnmfd..............................
cwb_MDP0000250583|PACid:22633065 Q....ADFAGWNL---------w............................................
cwb_MDP0000208233|PACid:22624841 -....-----------------lsrrglygskedaqnian...........................
cwb_MDP0000158720|PACid:22655873 -....-----------------spspflpffftfigsvilclafvkislntmeskiqsrlffageth
cwb_MDP0000152184|PACid:22632666 S....ARHAVTAIME-------r............................................
cwb_MDP0000182702|PACid:22680484 S....GVMCAHRVAA-------d............................................
cwb_MDP0000261638|PACid:22646820 -....-----------------fvynkgkkrrarkffiyvqdydendpkshegmdlnkvtarelilk
cwb_MDP0000130370|PACid:22654204 -....-----------------itrhgsw......................................
cwb_MDP0000272119|PACid:22671033 -....-----------------pqllysnmeiatyapeilakhqperftidlggprvffcadkaidl
cwb_MDP0000305861|PACid:22662391 -....-----------------kdlvritileagdhilnmfd.........................
cwb_MDP0000255696|PACid:22677008 -....-----------------gvkelvkitlleagdhilnmfd.......................
cwb_MDP0000214280|PACid:22681133 -....-----------------stlskkstxlsatgviyrdsngrshralvhdkgeiilssgtiasp
cwb_MDP0000210966|PACid:22644665 -....-----------------fr...........................................
cwb_MDP0000610999|PACid:22659782 -....-----------------ysdietvtyapqalaqhnpkrfyidlsgpkvlfladkatdllwrs
cwb_MDP0000242546|PACid:22662348 -....-----------------ysdietvtyapqalaqhnpkrfyidlsgpkvlfladkatdllwrs
cwb_MDP0000320742|PACid:22645070 -....-----------------gsflyhmkdrqi.................................
cwb_MDP0000654164|PACid:22658363 -....-----------------gfevtvvefgpdivpsmdseickqfqc..................
cwb_MDP0000256300|PACid:22644503 -....-----------------nglnldhikgtkiggstfdnngkrhgavellnkgdlnklrvavqa
cwb_MDP0000235080|PACid:22654616 S....GIAAA------------sklte........................................
cwb_MDP0000284363|PACid:22634918 -....-----------------kdlvkitviqsgdhilnmfdd........................
cwb_MDP0000125043|PACid:22648273 A....GVMAAENCQ--------qhl..........................................
cwb_MDP0000192359|PACid:22632529 -....-----------------qilllsgigpqkhlnkfnipvavnlksvgkgmtdnpciallaeia
cwb_MDP0000440005|PACid:22623062 Q....ALVAAKNI---------.............................................
cwb_MDP0000609131|PACid:22633588 -....-----------------spldelslkfnppisipkrelq.......................
cwb_MDP0000362000|PACid:22628256 Q....GKYLANL----------ln...........................................
cwb_MDP0000150210|PACid:22663655 -....-----------------rpsiikelelprhglkllkgshssftpcldgrylllgpnkdhnhs
cwb_MDP0000158790|PACid:22624362 -....-----------------aygievevesnpydpevmvfmdyrdymkqxvrsseaeyptflyvm
cwb_MDP0000427950|PACid:22623610 D....GVVLARCL---------gxallkssrhetkdkageegkeeyerietglkkyaterrwrsfdl
cwb_MDP0000569169|PACid:22666591 -....-----------------yywmglkmydlvaglrllhvsryysaqesvelfptlarkgnnksl
cwb_MDP0000525742|PACid:22647174 -....-----------------tvesserklqmc.................................
cwb_MDP0000559829|PACid:22672870 -....-----------------geemrtyapltiienlscfvglilencelphanhghvilgdpspi
cwb_MDP0000321788|PACid:22641842 -....-----------------nt...........................................
cwb_MDP0000919183|PACid:22661837 E....GKFL-------------ve...........................................
cwb_MDP0000146158|PACid:22623090 E....GKYLV------------ex...........................................
cwb_MDP0000832077|PACid:22645850 -....-----------------ryvgg........................................
cwb_MDP0000621365|PACid:22669861 -....-----------------dgiptvrgrilggtsiinagvyaranisffsqsgvewdmd.....
cwb_MDP0000875229|PACid:22620206 -....-----------------tqglglen.....................................
cwb_MDP0000251344|PACid:22682514 -....-----------------a............................................
cwb_MDP0000168919|PACid:22641114 -....-----------------lsdvvalrnllrplrnlndvpalfkylesfytlrkqpaaftxntl
cwb_MDP0000267855|PACid:22645516 -....-----------------adcwseslnllsaaeaavasaaqtsdgptpivrrrgilrpalslk
cwb_MDP0000195207|PACid:22668389 -....-----------------wqgavgelevggnfvplpssspscfngmvvlvkarminverpcwi
cwb_MDP0000400145|PACid:22662498 -....-----------------ysnietanyapeilanqfskflidlggprvlfcadkaidliaksg
cwb_MDP0000919183|PACid:22661837 -....-----------------gelsdfim.....................................
cwb_MDP0000307336|PACid:22681275 -....-----------------srdglvwdegant................................
cwb_MDP0000263146|PACid:22654671 -....-----------------n............................................
cwb_MDP0000309730|PACid:22638555 -....-----------------adcwseslnllsaaeaavasaaqxsdgptpivrrrgilrpalslk
cwb_MDP0000163903|PACid:22648802 -....-----------------vke..........................................
cwb_MDP0000611628|PACid:22643604 E....GKYLV------------ex...........................................
cwb_MDP0000119779|PACid:22649695 -....-----------------xvke.........................................
cwb_MDP0000120904|PACid:22629470 D....-----------------vvvlrnllrplrnlndvpalfkylesfytlrkvs...........
cwb_MDP0000150544|PACid:22634453 -....-----------------slxr.........................................
cwb_MDP0000902209|PACid:22678199 -....-----------------adcwseslnllsaaeaavasaaqtsdgptpivrrrgilrpalslk
cwb_MDP0000269370|PACid:22680893 -....-----------------skipgpxshgsltlnsssdvrxxpnvrfnyfldptdlahcvsamk
cwb_MDP0000146158|PACid:22623090 E....GKYLV------------ex...........................................
cwb_MDP0000124051|PACid:22654473 -....-----------------itpllsaavssaifhkkeavargirfiksdgsssqtyeaylnprk
cwb_MDP0000255696|PACid:22677008 -....-----------------in...........................................
cwb_MDP0000305861|PACid:22662391 -....-----------------in...........................................
cwb_MDP0000611628|PACid:22643604 -....-----------------elsdfimkdvqerfshvkdyikvtlie..................
cwb_MDP0000309622|PACid:22670269 -....-----------------fiqrmrdkassl.................................
cwb_MDP0000239909|PACid:22648375 -....-----------------gplykhvlppasapslsfvgipwkvvpfplfefqskwiagllsnr
cwb_MDP0000126888|PACid:22675379 -....-----------------dalggeigkisdrstdgwgsfaffflsgkafwsynvvkgpfpngc
cwb_MDP0000869086|PACid:22644121 -....-----------------igiprkiigfpffesqakwiaqllsgkttlpsrddmmqsikefyh
cwb_MDP0000317524|PACid:22631851 -....-----------------gysytfpfldtkgivtiddnrvgplyvhtfp..............
cwb_MDP0000160099|PACid:22658087 -....-----------------kwiaqllsgkttlpsrddmmqsikefyhsrevagipkhdthgigd
cwb_MDP0000251205|PACid:22649529 D....AAVLGQCLKKW------gaedlqfalexyqsirlpvvrkqvlharrmgrikqgl........
cwb_MDP0000314335|PACid:22679828 -....-----------------ylkkyarhihllvrrdqlrasr.......................
cwb_MDP0000638870|PACid:22646063 -....-----------------ngrfiqkmrervatl..............................
cwb_MDP0000790657|PACid:22654829 -....-----------------fvlilqienlscfvglilencelphanhghvilgdpspilfypis
cwb_MDP0000748068|PACid:22649054 -....-----------------avrymdsledaafkgghmelrtrnpndnpavtfnyfkepqdlerc
cwb_MDP0000727481|PACid:22682921 -....-----------------avrymdsledaafxggfilekvmgpistghmelrtrnpndnpavt
cwb_MDP0000301246|PACid:22669391 S....GMLAAEATFS-------llhegsrmekywdalrnswiweelyrarnfrpafeyglipglals
cwb_MDP0000190684|PACid:22677586 -....-----------------igfpffesqakwtaqllsgkttlpsrddmmqsikefyhsrdvagi
cwb_MDP0000456223|PACid:22643829 -....-----------------lnlvqvpf.....................................
cwb_MDP0000745172|PACid:22667211 -....-----------------lsamd........................................
cwb_MDP0000407932|PACid:22626437 -....-----------------pagragesaslgltenlqrlgfetdrlktgtparvdcrtvdfsgl
cwb_MDP0000440896|PACid:22680420 -....-----------------myskitgkaldls................................
cwb_MDP0000694227|PACid:22673619 -....-----------------igvlqsdliafnpplpeskrveaqsdeetlkeamgaltdmfgpni
cwb_MDP0000123987|PACid:22662898 -....-----------------ihgripqlavigfsesvsnlytsemrcrwvaellagtftlpsike
cwb_MDP0000138005|PACid:22620884 -....-----------------hgilkanliefepqlpewkvaais.....................
cwb_MDP0000258205|PACid:22638470 -....-----------------fie..........................................
cwb_MDP0000245245|PACid:22671727 -....-----------------ihgripqlavigfsesvsnlytsemrcrwvaellagtftlpsike
cwb_MDP0000306704|PACid:22680179 -....-----------------lpnkvrnvvkvakaiaimshpipn.....................
cwb_MDP0000478654|PACid:22674637 -....-----------------lhprnlhavnytkllnlxvnspsssdessssafgiwdghqfvfkt
cwb_MDP0000728219|PACid:22657389 -....-----------------elsknaaqv....................................
cwb_MDP0000170414|PACid:22675630 -....-----------------agspeailplyrecihgripqlavigfseslsnlctsemrcrwva
cwb_MDP0000284363|PACid:22634918 -....-----------------lvtdewlrvkgcedediftifkaadkdn.................
cwb_MDP0000219560|PACid:22625984 -....-----------------vtvslgvlkasicqdsgmfnpplprfnteaiprlgfg........
cwb_MDP0000235930|PACid:22635275 -....-----------------pkt..........................................
cwb_MDP0000755938|PACid:22650525 -....-----------------leypsgiiplyrgtihplipnmafvgylesvsnlhsselrsiwla
cwb_MDP0000138851|PACid:22674897 -....-----------------tnlwikgddyllkddgipkps........................
cwb_MDP0000261638|PACid:22646820 -....-----------------myskitgkaldls................................
cwb_MDP0000317524|PACid:22631851 -....-----------------vgplyvhtfppslapslsfmgiatklwkxxfcksknkdmndkrys
cwb_MDP0000294615|PACid:22655955 -....-----------------myskitgkaldls................................
cwb_MDP0000208234|PACid:22624840 -....-----------------nlwlkgddyllkedgipkpsfpnhwkgknglycv...........
cwb_MDP0000216129|PACid:22668259 S....GLREAANMAHY------.............................................
cwb_MDP0000219521|PACid:22657613 -....-----------------leypsgiiplyrgtihplipnmafvgylesvsnlhsselrsiwla
cwb_MDP0000248995|PACid:22642703 -....-----------------lnmytlitgkvldls..............................
cwb_MDP0000256328|PACid:22629063 -....-----------------irkkll.......................................
cwb_MDP0000181673|PACid:22646891 -....-----------------lnmytlitgkvldls..............................
cwb_MDP0000169201|PACid:22625917 -....-----------------agspeailplyrecihgripqlavigfseslsnlxtsemrcrwva
cwb_MDP0000263530|PACid:22651991 -....-----------------nayntkvlglvheweskglvacwkekfgffdhisnkfvdpeevqm
cwb_MDP0000295839|PACid:22658517 -....-----------------dgdqlfndngmpkhsfpnhwkaekglysagfsrrgl.........
cwb_MDP0000297466|PACid:22645872 -....-----------------nteqknlafgaaacivhpa..........................
cwb_MDP0000281982|PACid:22629373 -....-----------------lpnkvrkvgkvarviaimshpipn.....................
cwb_MDP0000053966|PACid:22620929 -....-----------------amyskitgk....................................
cwb_MDP0000795740|PACid:22666880 -....-----------------mrdllkeseivldvpvkprkghllvlenfnsfhlnhglmevgyvd
cwb_MDP0000212327|PACid:22630830 -....-----------------hslcnp.......................................
cwb_MDP0000437365|PACid:22632357 -....-----------------r............................................
cwb_MDP0000135231|PACid:22629791 -....-----------------dlglrsqklweelaeslieqg........................
cwb_MDP0000167343|PACid:22638473 -....-----------------rgtihplipnmafvgylesvsnlhsselrsiwlarlldxkfklps
cwb_MDP0000222306|PACid:22645946 -....-----------------plipnmafvgylesvsnlhsselrsiwlarllddkfklpsvqkml
cwb_MDP0000183517|PACid:22634175 -....-----------------sqppvelwrkflyctslcgsilgqsticnpkicxqiifkligrel
cwb_MDP0000686821|PACid:22637777 -....-----------------dhwksenglysagfssrgllgiahdah..................
cwb_MDP0000430157|PACid:22655785 -....-----------------vvdgstfyrtpgtnpqatvmmlgrhmgqrilhd............
cwb_MDP0000373054|PACid:22683333 -....-----------------rnlcsp.......................................
cwb_MDP0000295306|PACid:22673308 -....-----------------vlnmytlitgka.................................
cwb_MDP0000233995|PACid:22662680 -....-----------------ndyfddngmprksfpnhwksekglysagfsrrgl...........
cwb_MDP0000209681|PACid:22642739 -....-----------------ndyfddngmprksfpnhwksekglysagfsrrglf..........
cwb_MDP0000876898|PACid:22679933 -....-----------------tvalsdivllrdllrpvtnfndapalceylesfytlrkpvsstin
cwb_MDP0000738522|PACid:22680891 -....-----------------qsvireafleaggydpdngfsldhikgtrvtgstfdnygtrhgad
cwb_MDP0000399642|PACid:22674547 -....-----------------hgripqlavigfseslsnlytsemrcrwvaellgrtftlpsikem
cwb_MDP0000215521|PACid:22667208 -....-----------------mplyrgtihplipnmafvgfvesvsnlqtaelrckwlgrlvdnkf
cwb_MDP0000170521|PACid:22675770 -....-----------------thdispykfgyedwlaaqcgcpvfeewrkqmfvaaiqnlikrqet
cwb_MDP0000262982|PACid:22620906 -....-----------------skngfpkqpfphgwkgnaglyavgftrrglsgasndamriaqdig
cwb_MDP0000321186|PACid:22667177 -....-----------------gyksvpvdglpfdhrkgvvpnvrgrvlsdtsgdptllekglyvcg
cwb_MDP0000266051|PACid:22641431 -....-----------------dlsnsgaytsivvqspkvpmkf.......................
cwb_MDP0000837610|PACid:22643529 -....-----------------mtvalsdivllrdllrslsdlndapalceylesfytlrkpvssti
cwb_MDP0000582079|PACid:22634000 -....-----------------fsrrglfgiayda................................
cwb_MDP0000538071|PACid:22663035 -....-----------------dgstfnyspgtnpqatvmmlgrymgktilder.............
cwb_MDP0000241703|PACid:22642424 S....GKLCAQAIVQ-------dy...........................................
cwb_MDP0000671114|PACid:22638724 -....-----------------ggqlfsamdsd..................................
cwb_MDP0000315388|PACid:22681954 -....-----------------igpesylsslkipvisphpyirqfmydnprnlinilppfplersp
cwb_MDP0000134271|PACid:22620865 -....-----------------glkpdhpfledyascqmailpenffaeadkgkilfkkspkwxfws
cwb_MDP0000297581|PACid:22646099 -....-----------------.............................................
cwb_MDP0000911003|PACid:22677366 -....-----------------rsgrkpdgvcvvvgscargftnnstsdviyssslarkvgsseaql
cwb_MDP0000576650|PACid:22634720 -....-----------------tiekddy......................................
cwb_MDP0000149205|PACid:22670334 -....-----------------tiekddypgaetaa...............................
cwb_MDP0000315409|PACid:22681973 -....-----------------yskitgkaldx..................................
cwb_MDP0000320804|PACid:22671446 -....-----------------esisnlytsemrcrwlaellggtfklpxikemekdvekwdayakr
cwb_MDP0000474647|PACid:22667377 -....-----------------tvekdsyagqrhgcvwrg...........................
cwb_MDP0000566648|PACid:22666666 -....-----------------tvwkdgy......................................
cwb_MDP0000171379|PACid:22629613 -....-----------------cilsgllsvdglkvnild...........................
cwb_MDP0000814529|PACid:22673539 -....-----------------tvekdsyagqrhgcvwrg...........................
cwb_MDP0000218295|PACid:22671514 -....-----------------itvw.........................................
cwb_MDP0000220943|PACid:22675739 -....-----------------glkpdhpfledyascqmailpenffaeadkgkilfkrsskwwfws
cwb_MDP0000795437|PACid:22664825 -....-----------------wdgfakryagkyyrrscngtvhiwyndqlckdmewnpkrkkglfa
cwb_MDP0000919706|PACid:22656631 -....-----------------s............................................
cwb_MDP0000295675|PACid:22626457 -....-----------------tvekdsyagqrhgcvwrg...........................
cwb_MDP0000147542|PACid:22652542 -....-----------------tvekdgy......................................
cwb_MDP0000272126|PACid:22655119 -....-----------------ggsvlnarfykrasthyirevgwnqgmvdqsyewvekvvafepei
cwb_MDP0000196881|PACid:22654963 -....-----------------ive..........................................
cwb_MDP0000268346|PACid:22678394 -....-----------------it...........................................
cwb_MDP0000147542|PACid:22652542 -....-----------------kyaaerfatkgsafvihggsegiyssspaqsasdsvngdsfirfe
cwb_MDP0000948298|PACid:22676144 -....-----------------kylesfytlrkpvastintlagalyrvfcaspdparmemrqacfd
cwb_MDP0000220943|PACid:22675739 -....-----------------epfrslmvdstgtmplyresvsnlhtaelxckwlgrlvdnkfklp
cwb_MDP0000182589|PACid:22648509 -....-----------------i............................................
cwb_MDP0000557870|PACid:22631128 -....-----------------lpgiftdstavaedihn............................
cwb_MDP0000308870|PACid:22652882 -....-----------------svspsggaxlggqlvsamd..........................
cwb_MDP0000322449|PACid:22657441 -....-----------------fqkpvecltlayylpqnagdiackyiqdpqllsfidaevmcdrhy
cwb_MDP0000286494|PACid:22671310 -....-----------------itiekdgy.....................................
cwb_MDP0000150868|PACid:22621264 -....-----------------dylesfytlrkpvsstintlagalykvfcaspdparqemreacfd
cwb_MDP0000155608|PACid:22665289 -....-----------------ictvehsvenrfawqrflpagpiallpigdnfsnivwtmnp....
cwb_MDP0000168505|PACid:22672316 -....-----------------fvke.........................................
cwb_MDP0000196888|PACid:22670849 -....-----------------k............................................
cwb_MDP0000154812|PACid:22632894 -....-----------------iiekdgy......................................
cwb_MDP0000186080|PACid:22622639 -....-----------------iiekdgy......................................
cwb_MDP0000220012|PACid:22626541 -....-----------------k............................................
cwb_MDP0000169409|PACid:22673915 -....-----------------ggsvlnarfykrasthyirevgwnqgmvdqsyewvekvvafepei
cwb_MDP0000373095|PACid:22661923 S....GAIVAN-----------slv..........................................
cwb_MDP0000235846|PACid:22627807 -....-----------------ipsnnshdqlpnavspfrhhdllgngqqsrllgdpfqdqktarpc
cwb_MDP0000207126|PACid:22623152 -....-----------------gigdfeycdrygdhsgfphleewrkel..................
cwb_MDP0000268357|PACid:22630891 -....-----------------fvk..........................................
cwb_MDP0000149067|PACid:22669209 -....-----------------vlkta........................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 mylfccsyshnvapkgkfiafvst...........................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 mylfccsyshnvapkgkfiafvst...........................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 dmylfccsyshnvapkgkyiafvl...........................................
cwb_MDP0000294615|PACid:22655955 dmylfccsyshnvapkgkyiafvl...........................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 tngeskrveaqsdketlneamaalkdmfgpdipeatdilvprwwnnrfqrgsysnypmisdnqfvhd
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 lgpgwvrkflrdaifyrfi................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ssqfvkli...........................................................
cwb_MDP0000232295|PACid:22657598 fkiiieagilpvssnatimpiaaklafpesegklelnstdprenpsvtfnylakekdlaqclklaql
cwb_MDP0000188994|PACid:22643055 stalvvgffqesdgkimnflrdkylxpil......................................
cwb_MDP0000159189|PACid:22672554 istalvvgffqesdgkimnflrdkylapila....................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 pgsggvmkflretifyr..................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 kvvsxdskvkaiietpalgpgtfsalspwvsgediknrmlkfsrtahlisiirdkgsgvvtkggrvs
cwb_MDP0000158474|PACid:22655457 psskpekqtlietvgitkmgvyiegssgfsqskdsiqchhgimsaeigqlstippkqrtpeaiqayi
cwb_MDP0000276878|PACid:22649644 awsawnflgsngnkvcltywlnvlqnidetglpflvtlnpehtpkhtllkwstshpvpsvaaskasl
cwb_MDP0000154720|PACid:22639222 gqgvnlgfgdafalsriisegiavgrdiaevsllkkyeaerksanvtmmaildgfqkaysvdfgpln
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 geeasricasnggvgklsvgsflrrgldaywvltknrdeqvngngnwsrkllqeaifamhentqrty
cwb_MDP0000702799|PACid:22650781 geeasricasnggvgklsvgsflrrgldaywvltknrdeqvngngnwsrkllqeaifamhentqrty
cwb_MDP0000233110|PACid:22669060 hkvvsetanaraixetavlgpasfatlspwisrldmkdkmekyartanlfalvrdxssgvvkregrv
cwb_MDP0000260827|PACid:22621315 ylktxvapqippqiydsfvaavdkgtirtmpnrsmpaapyptpgallmgdafnmrhpltgggmtval
cwb_MDP0000941459|PACid:22654340 ltldynaeseyrmfpgeeixiakgylsivqslasvlppgliqlgkkvrkiqwqpdnrknkgyesdtr
cwb_MDP0000185338|PACid:22637072 arsvfirtpsaplyltvatlmektigptsagslrlastdvnvnpivrfnyfsnpvdvhrcvngtrki
cwb_MDP0000451172|PACid:22678939 gvgpafhlrahgikvvadqpmvgqgmadnpmnlllipspqpvevslvqvvgitkfesyiegasgltl
cwb_MDP0000136847|PACid:22626492 iytdsngrshqalirgkgevilsagaigspqllllsgvgpksylsslkipvvhpqpyvgqfmrdnpr
cwb_MDP0000177641|PACid:22624304 adakpknfppdspkvtviaddfklviqalilpxsfnatimpivgklafpesegelelnstdprknps
cwb_MDP0000413935|PACid:22663920 gemakylktvvapqippqiydsfiaavdkgsirtmpnrsmpaapyptpgallmgdafnmrhpltggg
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 llssaigphqhlknfnielvvdldvlclahilmkppkvvgiaddfkiiieagispvssnatvmpiaa
cwb_MDP0000137211|PACid:22645789 tveriifsskasdpsakgiiyndsngrshwasirgkgevilsagaigspqllllsgvgpksyltslk
cwb_MDP0000130099|PACid:22624356 gtrhaadellnkgdldnlrvavhanvekilisstfesnlsargvifkdsngishrsyvrnqgevils
cwb_MDP0000425135|PACid:22674685 gite...............................................................
cwb_MDP0000200780|PACid:22660656 ffrnnvi............................................................
cwb_MDP0000142434|PACid:22683351 lgllqqdsgsmlkfvclilm...............................................
cwb_MDP0000248951|PACid:22626490 iytdsygrshqalirgkgevilsagaigspqllllsgvgpksylsslkipvvhpqpyvgqfmrdnpr
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 yyietfsglpfsrqafslfpsptipmtinssfghivvkfpgplsygsldlqssydvkvapnvkfnyf
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 lgpgwvrkflrdaif....................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 gdalhpmtpdigqggcaaledegkeeyerietglkkyaterrwrsfdlistalvvgffqesdgkimn
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 nfppdspkviaiaddfklivgsmilpisfnatimlisgklafpesegqlelnstdprknpsvtfnyl
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 hanvekivfsssesrlsatgviykdsngishrayvrdqgevilsagtmgtpqllllsgvgpesylss
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 rirkrvyellskaamtrpshxssdarelhfvffrkpnkflesderrdhvsgvxlektkligispgeq
cwb_MDP0000161955|PACid:22660959 ylknvvapqvppqllrsflaavekgnirtmqnksmpatpqptpgaillgdafnmrhpltgggmtval
cwb_MDP0000213381|PACid:22663844 angemawylktvvapqvphqllkaflaavdkgiirtmqnksmpaapqptpgaillgdafnmrhpltg
cwb_MDP0000168437|PACid:22624648 tlrkpvastintlagalyrvfcaspdparmemrqacfdylsl.........................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 makylktvvapqvppqllksflaavkkgnirtmqnksmpatpvptpgaillgdafnmrhpltgggmt
cwb_MDP0000199319|PACid:22658752 vangemawylktvvapqvphqllkaflaavdkgiirtmqnksmpaapqptpgaillgdafnmrhplt
cwb_MDP0000857446|PACid:22649571 angemahylktvvapqvphqllkaflaavdkgiirtmqnksmpaapqptpgaillgdafnmrhpltg
cwb_MDP0000266638|PACid:22658651 giirtmqnksmpaapqptpgaillgdafnmrhpltgggmtvalsdivllrdllrplsdfndapalcd
cwb_MDP0000208936|PACid:22641581 kvvsgtanvrtiietaavgpatfstlfpwtsrldmkdtmekyartanlfalvrdrgsgavkregrih
cwb_MDP0000202883|PACid:22663993 kvpsvangemakylktvvapqsflaavxkgnirtmqnksmpatpvptpgaillgdafnmrhpltggg
cwb_MDP0000288439|PACid:22643642 adakpknfppdspkvtviaddfklviqalilpxsfnatimpivgklafpesegelelnstdprknps
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 etnsglpystqifslfpsptipntinssfgqisvkspgpfsygslklqssydvkvapnvkfnyfaqe
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 svangemaqylktvvaxqaflaavdxgiirtmqnksmpaapqptpgaillgdafnmrhpltgggmtv
cwb_MDP0000634676|PACid:22625957 vangemaqylktvvapqvphqllkaflaavdkgiirtmqnksmpaapqptpgaillgdafnmrhplt
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 angemaqylktavapqvphqllkaflaavdkgiirtmqnksmpaapqptpgaillgdafnmrhpltg
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 drgkrhgavehlnkahpknlrvailatveriifsskasglsakgiiysdsngrshralirgkgevil
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 angemaqylktavapqvphqllkaflaavdkgiirtmqnksmpaapqptpgaillgdafnmrhpltg
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 tilppfqlepstaqiagitsdyyietfsglpfstpafslfpnptipmtinstfghivvkhpaplsyg
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 fksckmghpdagpqhvgsihigsesmeefqlawqdavnglpsnrpviemtipsvldktisppgkhvi
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 gspqllllsgvgpksylssrkipvvhpqpyvgqfmrdnprnyittlapfqvepstaqfvgitsdyyi
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 yvatghncwgilngpatgaavaelvldgkasivdlspfsparfc.......................
cwb_MDP0000746652|PACid:22636428 ylknvvapqvppqllkaflaavekgnirtmqnksmaahpqptpgaillgdafnmrhpltgggmtval
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 sylsslkipvvldlpdvg.................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 tehippsrlargcyftlsntticpfrhliyplpedgglgvhvtldlngqvkfgpdvewidgvddvss
cwb_MDP0000138005|PACid:22620884 ltdltpntsrqkglahevlqwyicrmeawfaadadvislknwdqayklrvlvvkehvlsgghglmvq
cwb_MDP0000261301|PACid:22674262 ksiilyaisladddqdslevcktvlktregmqrldlyqksvxrfpnvpgallyplyghgemsqgfsr
cwb_MDP0000771633|PACid:22649768 realvelc...........................................................
cwb_MDP0000851102|PACid:22674240 realvelc...........................................................
cwb_MDP0000159873|PACid:22673571 eafvemcadeyvqkmtfdsylykrvvpgnpw....................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 eafvemcadeyvqkmtfdsylykrvvpgnpw....................................
cwb_MDP0000252244|PACid:22643267 eafvemcadeyvqkmtfdsylykrvv.........................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 pqvppelhdafiaaidkgnirtmpnrsmpasphptpgalllgdafnmrhpltgggmtvalsdivvlr
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 drrtvdfsglepqhgdeevgwfsfdldvhiereqmccyltrttksthqlikdnlh............
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 vaaidkgnirtmpnrsmpanpqptpgalllgdafnmrhpltgggmtvalsdivvlkdllkplrnlhd
cwb_MDP0000258995|PACid:22632347 sklsmkaafgkvwqleqnggsiiggaikaiqgrnrapktprdpfskgvfrnqrakqldllgrdlvaa
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 gqykgvrlasgeeifshqllldptltvp.......................................
cwb_MDP0000145663|PACid:22632174 lvfleetslvsrpvlsymeikkrmvarlrhlgirvkrvieeekclipmggplpripqrvmaiggtsg
cwb_MDP0000288439|PACid:22643642 akpknfppd..........................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 lkaedeflkdvnyaldygfgphpksstsgggsifswfktdtnlsandcfkvppkvlklasertvfpl
cwb_MDP0000194622|PACid:22683388 etslvarpglpmkdiqermaarlkhlgikvksieedehcvipmggplpvlpqrvvgiggtagmvhps
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 mhnsmfwarclrqaaalgqkdfvefmdlllspaskvlnnwfeaevlkatlatdavigttgsvhtpgs
cwb_MDP0000197715|PACid:22640206 kvvsadskakaiietptlglgtfsalcpwefgediknrmlkfsrtvhlisiirdwgsrvvtkggrdf
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 aaidgqnmsssehvthgivvlrklfgeasvpdpvaavvtdwatckehpdtvgdammsglreavriid
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 gvllivlksnvcfqvlnvdgitggfnfqnawsggyiagtsid.........................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 yglddntvdfighalalhrddnylaepamafvkrm................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ilksgvyhqvksidanfildgkgqlwnvpdsrgaifkdkslslieknklmkffklvwqhlaasdggd
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 gvspflcfkgiemksiyddigelwnvpdsrvaifkdkrlslmeknklmrffklvwqhleaasdeqgs
cwb_MDP0000242546|PACid:22662348 gvxpflcfkgiemksiyddigelwnvpdsrvaifkdkrlslmeknklmrffklvwqhleaaxdeqgs
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 tvekilfsskassssaigimysdsngrshcayvrrkweavlsagaigspqllqlsgigpesylsslk
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 dakpknfp...........................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 eiskfskrdadayprygnqlgnfcefmdplldsappeslqcesscsvsdrfknkmhnsmfwarclrq
cwb_MDP0000158790|PACid:22624362 pmsptrlffeetclaskeampfdllkkkllsrlqtmgiritktyeeewswipvggslpnteqknlaf
cwb_MDP0000427950|PACid:22623610 istalvvgffqesdgkimnflrdkylapila....................................
cwb_MDP0000569169|PACid:22666591 kgtvvyydgqmndarlnvglactaavagaafhy..................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 lfypisstevrclvdvpgtkvpsvangemaqylktivapqvprqllxaflatvdkgiirtmqnksml
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 agaaxkvlsaspdparkelrqacfdyfx.......................................
cwb_MDP0000267855|PACid:22645516 nlvllkdnaqsclascrietldndaaqnlvpgisppldasfympeavnihpqrylqalflacqnlvk
cwb_MDP0000195207|PACid:22668389 sklepfngmwhlsengkpygkfdaiviahngkcanrllassglplvygqmkrlelssiwallaafed
cwb_MDP0000400145|PACid:22662498 vgsylsfksidvsficdengrlsnvpdsrsaifkdkslslieknqlmrffklvqqhl..........
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 nlvllkdnaqsclascrietldndaaqnlvpgisppldasfympeavnihpqrylqalflacqnlvk
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 nlvllkdnaqsclascrietldndaaqnlvpgisppldasfympeavnihpqrylqalflacqnlvk
cwb_MDP0000269370|PACid:22680893 ntxdllmtdalkpykaqdlpgmegfnflgqplpknqtddasfetfcrdtvasywhyhggclvgkvvd
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 nsrsstgdvilaagalgspqillssgigp......................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ialpskeemmedvkafyslleasgtpkrythnlggcqfeyddwiaaqcgcpvseewrkqmysevskn
cwb_MDP0000126888|PACid:22675379 ylqkrvlnasrgxavralraq..............................................
cwb_MDP0000869086|PACid:22644121 srdvagipkhnthdiaefeycdkygdhigfphleewrkelclsalrnaetdletyrdswddhe....
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 feycdrygdhsgfphleewrke.............................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 stevrclvdvpgtkvpsvangemaqylktivapqvprqllraflatvdkgiirtmqnksmlaaprpt
cwb_MDP0000748068|PACid:22649054 vqgietiekiieskafskfryegmsiaallnatasspvnllpkhanasrsldqfckdtvmtiwhyhg
cwb_MDP0000727481|PACid:22682921 fnyfkepqdlercvqgietiekixeskafskfryegmsiaallnatasspvnllpkhanasrsldqf
cwb_MDP0000301246|PACid:22669391 alehyimkgrspwtlkhgkpdheatnvaqfhspiqypkpdgvl........................
cwb_MDP0000190684|PACid:22677586 pkhnthdiaefeycdrygdhigfphleewrkelclsalrnadtdletyrdswdd.............
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 epqrgdeevgwfsfdldvhiereqmccyltrttksthqlikdnlh......................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 peatdilvprwwnnrfqrgsysnypivsndhfvhdiknpvgrifftgehtsekfsgyvhgghlage.
cwb_MDP0000123987|PACid:22662898 mekdvnkwdgfakryagxyyrrscngtlhiwyndqlckdmgwnpkrkkglfaelfepygpldy....
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 mekdvnkwdgfakryagxyyrrscngtlhiwyndqlckdmgwnpkrkkglfaelfepygpldy....
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ellggtftlpsikemekdvnewdgfakryagkyyrrscngtvhiwyndqlckdmgwnpkrkkglfae
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 rlldnkfklpsvqkmleqtskeveiskkttrfyrrhcistfsinhsdeiceemgwtswrkntwlaea
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 hdprkagspvgvlgrpvlvcfeiigfpffesqakwiaqllsgxttlpsrddmmhsikefyhsreiag
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 rlldnkfklpsvqkmleqtskeveiskkttrfyrrhcistfsinhsdeiceemgwtswrkntwlaea
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ellggtftlpsikemekdvnewdgfakryagkyyrrscngtvhiwyndqlckdmgwnpkrkkglfae
cwb_MDP0000263530|PACid:22651991 gk.................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 hqtanplpsistsellnqdeqslsvsmtatmdtmgniilgssrqfagfcteleesiiiriweragef
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 vqkmleqtskeveiskkttrfyrrhcistfsinhsdeiceemgwtswrkntwlaeafspygsqdy..
cwb_MDP0000222306|PACid:22645946 eqtskeveiskkttrfyrrhcistfsinhsdexceemgwtswrkntwlaeafspygsqdy.......
cwb_MDP0000183517|PACid:22634175 gxinvidikpwvmhaevaekflscgnriilagnaahrfppaggfdln....................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 tlagalykvfcaspdparq................................................
cwb_MDP0000738522|PACid:22680891 ellnkgnpnnlrvavhatvekiifssn........................................
cwb_MDP0000399642|PACid:22674547 ekdvnewdgfakryagkyyrrscngtvhiwyndqlckdmewnpkrkkglfaelfepygpldy.....
cwb_MDP0000215521|PACid:22667208 klptvqkmleqigreievmkkttrfykrhcistfninhsdeiceemgwkswrksnwlseafspynsr
cwb_MDP0000170521|PACid:22675770 yrnewddhhl.........................................................
cwb_MDP0000262982|PACid:22620906 nvwkg..............................................................
cwb_MDP0000321186|PACid:22667177 wlkrgpt............................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ntlagalykgas.......................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 lkivgitsdfy........................................................
cwb_MDP0000134271|PACid:22620865 ggiefedntkleadvvllatgyegkqklqsilpepfrslmvdssgtmplyrgtihplipnmafvgfi
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 fweafpagsgptdrttymftylapqpqspkieelleeywklmpeyqevslddleiqrvlygifptyr
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 yassqyyrrscigalhlwyndqlckxmgwnpkrkkglfaelfepygpmdya................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ggiefedntklqadvvilatgyegkqklq......................................
cwb_MDP0000795437|PACid:22664825 elfepygpldy........................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 lqwesaf............................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 kvtfrrsresanlsswpvhaivfevedretiggsayggqravccsgdlaklgvcaqgeiihrqsten
cwb_MDP0000948298|PACid:22676144 yls................................................................
cwb_MDP0000220943|PACid:22675739 tvqkmleqigretevmkkttrfykrhcistfsinhsddiceemgwkswrksnwlseafspynsrdy.
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 gginypiggvggiakslakg...............................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ylsl...............................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 lqwesaf............................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 rlrrrhhwrrrqtpslhwlrggcgtrrwvivknvvtgavwdlkvsglflavgh..............
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 iknpvgrlfftgehtsekfsgyvhgghlagietgkallee...........................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 lervvrsesiafflgierkpkdklmstedelrklctknvitffhyhggctmgsvvdkdyrvygvkgl
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 yefsaldkenikgglrqalriliaagaievgthrsdglrlkckgidkeeleefldmvtadegpqslv
cwb_MDP0000158474|PACid:22655457 rskknlpheafrggfilekiasplskgdlslvntnvddnpsvtfnyfshpydlqrcvdgirmatkvv
cwb_MDP0000276878|PACid:22649644 elpriqgkrgiwfcgayxgygfhedglkagmdaahgll.............................
cwb_MDP0000154720|PACid:22639222 viraaafngaqyfpplkrs................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 tsagdlltldynaeseyrmfpgeeitiakgylsivqslasvlppgliqlgkkvteiqwqpenhthsg
cwb_MDP0000702799|PACid:22650781 tsagdlltldynaeseyrmfpgeeitiakgylsivqslasvlppgliqlgkkvteiqwqpenhthsg
cwb_MDP0000233110|PACid:22669060 hytldqldkenllaglrqalriliaagavevgtyrndgqrikckgvkeedleefldtvvtsagpsar
cwb_MDP0000260827|PACid:22621315 sdivvlrnllkplgnlndpstlskylesfytlrkpvastintlagalykvfssspdqarkemrqacf
cwb_MDP0000941459|PACid:22654340 pvklhfsdgsvlladhvivtvslgvlkasirqdsgmfnpplprfkteaisrlgfgvvnklflqlgsi
cwb_MDP0000185338|PACid:22637072 gdilktrsmedfkfqgwfgnkdfrfvgpalpvdqsnfelmadfcrrtvstiwhyhggcmigkvvdgd
cwb_MDP0000451172|PACid:22678939 piplahrlsnhfkhflsqpehhpfraspkimawaadtvngivnktlragvilekimgplstghlalx
cwb_MDP0000136847|PACid:22626492 xyvtilppselepstaqiagitsdyyi........................................
cwb_MDP0000177641|PACid:22624304 vtfnylakekdmaecvklgrllekivrsksiayflgiegkrrnxsmstddelrklcknnvrtfyhyh
cwb_MDP0000413935|PACid:22663920 mtvalsdivvlrnllrplgnlndpstlskylesfytlrkpvastintlagalykvfssspdqarkem
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 klafpvsegtlelistdprenpsvtfnylanekdlaecvklsqllervvrsesvafflgieckrkde
cwb_MDP0000137211|PACid:22645789 ipvvhpqpyvgkfmrdnprsniiilppspivptysqiagftsdfdiesisgtpyssqaysifpnpti
cwb_MDP0000130099|PACid:22624356 agtmgtpqllllsgvgpesylsslgipvvidhpyvghflydnprnfinilppnpveasivtalgirn
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 nyvtilppselepstaqiagitsdyyi........................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 aqeadlsrcvsavrkmgdllktnslkpykaqdlpglegfnffglplpvnqsddasfetfcrdtvatf
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 flrdkylapila.......................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 atekdmaecvklgrlleqivrsksiayflgvegkrrnesmstddelrklcknnvrtfyhyhggctmg
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 lgipvvldhpyvgqflydnprnfinilppnpiepsivtvlgirddfwqcsiscgpltapp.......
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 taagtgqfeelgcgxvlksigy.............................................
cwb_MDP0000161955|PACid:22660959 sdivllrdllrpltdlndapalceylesfytlrkpvsstintlagalykvfcaspdparqemreacf
cwb_MDP0000213381|PACid:22663844 ggmtvalsdivllrdllrplsdfndapavcaylesfytlrkpvsstintlagalykvfcaspdparq
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 valsdivllrdllrpltdlsdasalceylesfytlrkpvsstintlagalykvfcaspdparqemre
cwb_MDP0000199319|PACid:22658752 gggmtvalsdivllrdllrplsdxndapaxcxylesfytlrkpvsstintlagalykvfcaspdpar
cwb_MDP0000857446|PACid:22649571 ggmtvalsdivllrdllrplsdfndapalcdylesfytlrkpvsstintlagalykvfcaspdparq
cwb_MDP0000266638|PACid:22658651 ylesfytlrkpvsstintlagalykvfcaspdparqemreacfdylsl...................
cwb_MDP0000208936|PACid:22641581 ytldqldkenlqvglrqtlriliaagavevgtyrndgqrikckgveeedlevfldtvvaaagpsare
cwb_MDP0000202883|PACid:22663993 mtvalsdivllrdllrpltdlsdapalceylesfytlrkpvsstintlagalykvfcsspdparqem
cwb_MDP0000288439|PACid:22643642 vtfnylakekdmaecvklgrllekivrsksiayflgiegkrrnxsmstddelrklcknnvrtfyhyh
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 adlsrcvsavrkmgdllktnslkpykardlpgldgfnlfgpplpmnqsddaslktfcrdtvatfwhy
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 alsdivllrdllrplsdfndapalcxylesfytlrkpvsstintlagalykvfctspdparqemrea
cwb_MDP0000634676|PACid:22625957 gggmtvalsdivllrdllrplsdfndapalcdylesfytlrkpvsstintlagalykvfcaspdlar
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ggmtvalsdivllrdllrplsdfndapalcdylesfytlrkpvsstintlagalykvfcaspnparq
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 saxaigsxqllllsgvgpksylssrkipvvhpqpyvgqfmrdnprnyitilppfqveastvqvvgit
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ggmtvalsdivllrdllrplsdfndapalcdylesfytlrkpvsstintlagalykvfcaspnparq
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 slklqsssdvkvgpnvkfnyfaqkpdlsrcvsavrkigdllktnslkpfktqdlpgeegfnffgpsl
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 nlft...............................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 etfsglpfstqafslfpsptipmtinssfghiifkfpgplsygslklqssydvkvapnvvdedlrvm
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 sdivllrdllrpltdlndapalceylesfytlrkpvsstintlagalykvfcaspdparqemreacf
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 flnkfdysvctnrkelfypeirkyypnlkdgslepgyagirpklsgprqspvdfqiqgedvhgitgl
cwb_MDP0000138005|PACid:22620884 gydpiikalakdidvrlnhsi..............................................
cwb_MDP0000261301|PACid:22674262 caavkgciqvlrmpvtallmdkengqykgvrlasgeeklshllvldptltvrl..............
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 dllkplhdlhdaaslctylesfytlrkpvastintlagalykvfsaspdeartemrqacfdylsl..
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 aaslctylesfytlrkpvastintlagalykvfstspdeartemrqacfdyl...............
cwb_MDP0000258995|PACid:22632347 adalskfyyppvaavsisypkeairtdclidgelkgfgqlhprsqglktlgtiyssslfpnrappgr
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 vvhpstgymvartmalapvlaeaiaeclgstrmirgqplyhrawnglwpierrctrdfysfgmetll
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 slmhandyvskhvvligdaahtvhplagkgliwglethllyqesfvlllkkyeaerksanvtmmail
cwb_MDP0000194622|PACid:22683388 tgymvartlaaapivanaivrylgsdrtlsgnevsaeiwkdlwpiqrrrqreffcfgmaillkldlk
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 gyvllhhvmgetdgergiwsyveggmgsvslaianaakeagahivtcaevfmslkelglvhvsvlxl
cwb_MDP0000197715|PACid:22640206 fdmvtaderpqslvenwttyssahqmrscrmgikakegvvdenge......................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 il.................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 egsqnsesskileedlespfvdflkrmqlphkiksiilygiamvdydqdnlefcksilktregierl
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 egnsesrkisdedlespfvdflnrmelphriksiilyaiamvdydqddleacksilktrdgierlai
cwb_MDP0000242546|PACid:22662348 egnsesrkisdedlespfvdflnrmelphxiksiilyaiamvdydqdnleacksilktrdgierlav
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ipvvsphpyigqfmydnpcnlinilppipl.....................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 aaalgqkdfvefxdlllspaskvlnnwfesdvlkatlamdsvigttgsvhtpgsgyvllhhvmg...
cwb_MDP0000158790|PACid:22624362 gaaacmvhpatgysvarslseapkyasviatilkpdhnkairsrqisnenismlawntlwpqerkrq
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 aaprptpgaillgdafnmrhpltgggmtvalsdivllmdllrpltdfndapllcey...........
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 elcasgsgvkelhlhkssihklldlegeyqavivclgakadmlpelcgrlplrtcrgvvahlqlpdd
cwb_MDP0000195207|PACid:22668389 plqxpfegafvkgvdsxswmannttklqgsqskgphcwtflstaxygkrnkvpqeniptataekvka
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 elcasgsgvkelhlhkssihklldlegeyqavivclgakadmlpelcgrlplrtcrgvvahlqlpdd
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 elrasgtgvkelhlhkssvhklvdledsmfqigcltfhaasvisegeyqavivclgakadmlpelcg
cwb_MDP0000269370|PACid:22680893 csfrlngiyglrvadatlfpaapashpqxfylmlgryvglqilker.....................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 kcarpetyrdeweddh...................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 pgaillgdafnmrhpltgggmtvalsdivllmdllrpltdfndapl.....................
cwb_MDP0000748068|PACid:22649054 gcqvgrvvdhdykvlgvdalrvidgstfnyspgtnpqatvmmlgrymgktilder............
cwb_MDP0000727481|PACid:22682921 ckdxvmtiwhyhggcqvgrvvdhdykvlgvdalrvidgstfnyspgtnpqatvmmlgrymgktilde
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 lfepygpldy.........................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 fspygsqdy..........................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ipkhntheigdfeycdrygdhigfprleewrkkiclstirnaetdletykdswddhe..........
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 fspygsqdy..........................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 lfepygpldy.........................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 fpklkxklfsdiskgrevrvglrpympdgkpvigpmpglanvflatgheggglslalgtaemltdmv
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 dyq................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 e..................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 dsplpaafnrvlqvfgdasgiqspvsfggfgsltrhlnrlsngiyeamsdnlldsynlsllnpympn
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 pgwpqvfgvsfeeheevatlpsksipitktgmynlyfihcdlsikdvvvegktiwknptgylpgrma
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 rvvdgstffespgtnpmatllmlgryqgmkvl...................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 enwtiyssahqmgscrmgxnakegavdengesweaeslfvcdgsvlpsavgvnpmitiqstayclsk
cwb_MDP0000158474|PACid:22655457 qsehftnytkcdrqtaekvldmsvkanvnlipkhtndtksleqfckdtvitiwhyhggchvgtvvsp
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 yesdtrpvklhfsdgsvllaxhviitvslgvlkasirqdsgmfnpplprfkteaisrlgfgvvnklf
cwb_MDP0000702799|PACid:22650781 yesdtrpvklhfsdgsvllaxhviitvslgvlkasirqdsgmfnpplprfkteaisrlgfgvvnklf
cwb_MDP0000233110|PACid:22669060 eelwtiyssahqmgscrmgateeeggvdengesweakglfvcdasllptavgvnpmitiestaycis
cwb_MDP0000260827|PACid:22621315 dylsl..............................................................
cwb_MDP0000941459|PACid:22654340 happksqdfskfpflqmvfhradselrnkkipwwmrktaslcplyhdssvllswfageearaleals
cwb_MDP0000185338|PACid:22637072 frvigtdalrvvdgstfgispgtnpqatlmmlgryvglrimkd........................
cwb_MDP0000451172|PACid:22678939 ntxpdanpfvtfnyfkepedlrkciegmrtiidvvnseayskfryknmpvealinlmltlpvngrrk
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ggctmgsvvdknyrvfgixglrvidgstflespgtnpmatllmlgryqgikilqe............
cwb_MDP0000413935|PACid:22663920 rqacfdyls..........................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 lmstedelrklckknvrtfyhyhggctmgsvvdkdyrvygvkglrvvdgstffespgtnpmatllml
cwb_MDP0000137211|PACid:22645789 pvtinssfgffmvkvrgpilshgslklqssydakvapnvkfnyfakegdlsqcvsamgkmrdllktn
cwb_MDP0000130099|PACid:22624356 nfwqcsisggpltvppys.................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 whyhggclvgqvvdedlrvmgikalrvvdgsvfnlspgtnpqatimmlgryxgvqmle.........
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 svvdknyrvfgidglrvidgstflespgtnpmatllmlgryqgikilqe..................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 dylslg.............................................................
cwb_MDP0000213381|PACid:22663844 emreacfdylsl.......................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 acfdylsl...........................................................
cwb_MDP0000199319|PACid:22658752 qemreacfdylsl......................................................
cwb_MDP0000857446|PACid:22649571 emreacfdylsl.......................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 elwttyssahqmgscrmgateeeggvdengesweakglfvcdgsllptavgvnpmitiestaycisk
cwb_MDP0000202883|PACid:22663993 reacfdylsl.........................................................
cwb_MDP0000288439|PACid:22643642 ggctmgsvvdknyrvfgixglrvidgstflespgtnpmatllmlgryqgikilqe............
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 hggcvvgkvvdedlrvmgikalrvvdgsvfnlspgtnpqatlmmlgryvgvqmlee...........
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 cfdylsl............................................................
cwb_MDP0000634676|PACid:22625957 qemreacfdylsl......................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 emreacfdylsl.......................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 sdyyietfsglpfsrqafslfpsptipmtinssfghimvkfpgplsygslelqssydvkvapnvkfn
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 emreacfdylsl.......................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 pmnqsdvasfetfcrntvatfwhyhggclvgrvvdgdlrvmgikalrvvdgsvfkslspgtnpqatl
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 gikalrvvdgsvfnlspgtnpqatlmmlgryvgvqmlee............................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 dylslg.............................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 vnlfgiespgltssmgiaehvatrf..........................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 vlllnyiggatnpgilsetesklveavdqdlrkvllnhnakeplvlgvkvwpqaipqflvghfdvld
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 kldlngsrsffdaffdldpyywqgflssrlslrelall.............................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 dgfqkaysvdfgplnvlrpaafngaqyipplkrs.................................
cwb_MDP0000194622|PACid:22683388 gtrrffnaffdleprywhgflssrlflpdlvffgl................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 fasivclxdfvdyvfnlvlqvqqllindsgtadgvlltdgsqvhssivlsnatpyktfkelvpdnal
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 alyqksrltnapeamiypkyghgdlsyafcrraavkgcvyaervpvsvlmdkhseqykgvrlstgqd
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 fyksrltnapeamiypmyghgnlsgvisrraavkgcvclqclsiseksamqaqrvpvavltdkdsgq
cwb_MDP0000242546|PACid:22662348 fyksrltnapeamiypmyghgnlsgvisrraavkgcvclqclsmseksamqaqrvpvavlmdkdsgq
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 rsfflfglalilqqdiegiriffhtffrlptwmwqgflgstlssadlilfalymfvlap........
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 igkeypslgpsilsdawlavqgprslymgstwewksrnsspdvsaeesgexlkellpkaravypvlk
cwb_MDP0000195207|PACid:22668389 gmlsgvedalglpkgslqspfytriqlwgaalptntpgvpcifdplgragicgdwllgsnvesaals
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 igrkpq.............................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 rlplrtcrgvvahlqlp..................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 r..................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 lgnsekvnsapf.......................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 lssswlfqramsak.....................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 pfmnfygfmsfafvilgigwfsqyarfwrevfplqncitlvitlgmlemalwyfeya..........
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 riads..............................................................
cwb_MDP0000158474|PACid:22655457 ehkvlgvdrvrvvdgstfsespgtnpqatvmmmgryfgvkivr........................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 lqlgsnhpplkshdfskfpflqmvfhradselrnkkipwwmrktaslcplyhnsnvllswfagkeal
cwb_MDP0000702799|PACid:22650781 lqlgsnhpplkshdfskfpflqmvfhradselrnkkipwwmrktaslcplyhnsnvllswfagkeal
cwb_MDP0000233110|PACid:22669060 kkiaqsld...........................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 deeiingvsqtvssflsqnshshelcngngnpeensevkfskvlksqwgsdplflgsysyvavgssg
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 hanatfsleqfcidtvmtiwhyhggcqvgrvvdkgyrvlgidslrvvdgstfyrspgtnpqatvmml
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 grylgmnilqer.......................................................
cwb_MDP0000137211|PACid:22645789 alkpfktrdlpglegfnlfkpslpmnqsddasfcrdtvathwhyhggcsagkvvdgdlrvtgikalr
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 riaqslekq..........................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 yfaqeadlshcvsavrkigdllktnslkpykaqdlpgvegfnlfgpplpvnqsddasfetfcrdtva
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 mmlgryvglrmlee.....................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 aakaglsdtgtqglflggnyvtgvalgrcvegaydvaaeva..........................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 ppdfvraikysdysxgttkinlavdalpqfkscnlghpdagpqhvgtihigsesmeeinsacqdavn
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 lfshhlvldptfkfplppassppdlsaslkddkgkvargicittssmkpdisncflvy.........
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ykgvrlasgqnlysdqlvmdptfkvp.........................................
cwb_MDP0000242546|PACid:22662348 ykgvrlasgqnlysdqlvmdptfkvpsl.......................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 dwkfagaraglramppltphgslpllgcvddiigenrssnywlfgglgsrgllyhgwlgklmaqavl
cwb_MDP0000195207|PACid:22668389 gialanhia..........................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                    
                                                                                                    
d1xdia1                          ...................................................................
cwb_MDP0000813172|PACid:22649115 ...................................................................
cwb_MDP0000251581|PACid:22621152 ...................................................................
cwb_MDP0000188391|PACid:22626210 ...................................................................
cwb_MDP0000254144|PACid:22644986 ...................................................................
cwb_MDP0000321972|PACid:22643109 ...................................................................
cwb_MDP0000299806|PACid:22682346 ...................................................................
cwb_MDP0000283451|PACid:22680462 ...................................................................
cwb_MDP0000296714|PACid:22644308 ...................................................................
cwb_MDP0000162193|PACid:22629958 ...................................................................
cwb_MDP0000769741|PACid:22637873 ...................................................................
cwb_MDP0000295277|PACid:22625688 ...................................................................
cwb_MDP0000897124|PACid:22647159 ...................................................................
cwb_MDP0000854208|PACid:22682207 ...................................................................
cwb_MDP0000241767|PACid:22665328 ...................................................................
cwb_MDP0000318858|PACid:22682838 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000442206|PACid:22660061 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000306147|PACid:22679041 ...................................................................
cwb_MDP0000180064|PACid:22628138 ...................................................................
cwb_MDP0000261625|PACid:22630921 ...................................................................
cwb_MDP0000300208|PACid:22651331 ...................................................................
cwb_MDP0000247171|PACid:22623108 ...................................................................
cwb_MDP0000308095|PACid:22667065 ...................................................................
cwb_MDP0000319421|PACid:22624123 ...................................................................
cwb_MDP0000232295|PACid:22657598 ...................................................................
cwb_MDP0000188994|PACid:22643055 ...................................................................
cwb_MDP0000159189|PACid:22672554 ...................................................................
cwb_MDP0000656178|PACid:22657871 ...................................................................
cwb_MDP0000910523|PACid:22620639 ...................................................................
cwb_MDP0000119941|PACid:22643547 ...................................................................
cwb_MDP0000231799|PACid:22673471 ...................................................................
cwb_MDP0000255025|PACid:22624807 ...................................................................
cwb_MDP0000231632|PACid:22622264 ...................................................................
cwb_MDP0000173300|PACid:22648712 ...................................................................
cwb_MDP0000158474|PACid:22655457 ...................................................................
cwb_MDP0000276878|PACid:22649644 ...................................................................
cwb_MDP0000154720|PACid:22639222 ...................................................................
cwb_MDP0000549646|PACid:22624756 ...................................................................
cwb_MDP0000158853|PACid:22672016 alealsgeeiingvsqtvssflshtshshescngngnpegnsvqfskvlksqwasdplflgsysyva
cwb_MDP0000702799|PACid:22650781 alealsgeeiingvsqtvssflshtshshescngngnpegnsvqfskvlksqwasdplflgsysyva
cwb_MDP0000233110|PACid:22669060 ...................................................................
cwb_MDP0000260827|PACid:22621315 ...................................................................
cwb_MDP0000941459|PACid:22654340 edldsmaeplpsddsgsaassspplqilfageathrthystthgaycsglreanrllqhy.......
cwb_MDP0000185338|PACid:22637072 ...................................................................
cwb_MDP0000451172|PACid:22678939 gr.................................................................
cwb_MDP0000136847|PACid:22626492 ...................................................................
cwb_MDP0000177641|PACid:22624304 ...................................................................
cwb_MDP0000413935|PACid:22663920 ...................................................................
cwb_MDP0000206098|PACid:22637273 ...................................................................
cwb_MDP0000845788|PACid:22673064 ...................................................................
cwb_MDP0000465595|PACid:22654474 ...................................................................
cwb_MDP0000137211|PACid:22645789 vvdgsifnsspgtnpqatlmmlgryvglrileer.................................
cwb_MDP0000130099|PACid:22624356 ...................................................................
cwb_MDP0000425135|PACid:22674685 ...................................................................
cwb_MDP0000200780|PACid:22660656 ...................................................................
cwb_MDP0000142434|PACid:22683351 ...................................................................
cwb_MDP0000248951|PACid:22626490 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000318256|PACid:22681338 ...................................................................
cwb_MDP0000231634|PACid:22622267 ...................................................................
cwb_MDP0000626995|PACid:22630905 ...................................................................
cwb_MDP0000123832|PACid:22633934 ...................................................................
cwb_MDP0000236092|PACid:22632501 ...................................................................
cwb_MDP0000199159|PACid:22674497 ...................................................................
cwb_MDP0000162755|PACid:22662459 ...................................................................
cwb_MDP0000173666|PACid:22649255 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000184832|PACid:22636281 ...................................................................
cwb_MDP0000598927|PACid:22655979 ...................................................................
cwb_MDP0000561228|PACid:22637769 ...................................................................
cwb_MDP0000175650|PACid:22652650 ...................................................................
cwb_MDP0000233802|PACid:22672706 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000161955|PACid:22660959 ...................................................................
cwb_MDP0000213381|PACid:22663844 ...................................................................
cwb_MDP0000168437|PACid:22624648 ...................................................................
cwb_MDP0000823251|PACid:22668430 ...................................................................
cwb_MDP0000191389|PACid:22631180 ...................................................................
cwb_MDP0000199319|PACid:22658752 ...................................................................
cwb_MDP0000857446|PACid:22649571 ...................................................................
cwb_MDP0000266638|PACid:22658651 ...................................................................
cwb_MDP0000208936|PACid:22641581 ...................................................................
cwb_MDP0000202883|PACid:22663993 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000903805|PACid:22678063 ...................................................................
cwb_MDP0000202123|PACid:22678734 ...................................................................
cwb_MDP0000227773|PACid:22639029 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000320748|PACid:22658808 ...................................................................
cwb_MDP0000634676|PACid:22625957 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000501957|PACid:22671723 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000293482|PACid:22637734 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000257243|PACid:22657003 tfwhyhggclvgkvvdedlrvmgikalrvvdgsvfnvlspgtnpqatlmmlgryfgvqmlee.....
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000193196|PACid:22649572 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000251783|PACid:22654795 ...................................................................
cwb_MDP0000686885|PACid:22670382 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000194930|PACid:22667971 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000129765|PACid:22673448 ...................................................................
cwb_MDP0000272655|PACid:22672104 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000189790|PACid:22676146 ...................................................................
cwb_MDP0000847111|PACid:22682055 ...................................................................
cwb_MDP0000289536|PACid:22677728 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000188553|PACid:22658192 ...................................................................
cwb_MDP0000296599|PACid:22628159 ...................................................................
cwb_MDP0000746652|PACid:22636428 ...................................................................
cwb_MDP0000259265|PACid:22650727 ...................................................................
cwb_MDP0000151331|PACid:22656760 ...................................................................
cwb_MDP0000309775|PACid:22670556 ...................................................................
cwb_MDP0000232736|PACid:22657363 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000259264|PACid:22650726 ...................................................................
cwb_MDP0000293613|PACid:22654008 ...................................................................
cwb_MDP0000253362|PACid:22653297 ...................................................................
cwb_MDP0000182973|PACid:22649063 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000261301|PACid:22674262 ...................................................................
cwb_MDP0000771633|PACid:22649768 ...................................................................
cwb_MDP0000851102|PACid:22674240 ...................................................................
cwb_MDP0000159873|PACid:22673571 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000261201|PACid:22657417 ...................................................................
cwb_MDP0000252244|PACid:22643267 ...................................................................
cwb_MDP0000261821|PACid:22664612 ...................................................................
cwb_MDP0000124454|PACid:22663639 ...................................................................
cwb_MDP0000234830|PACid:22664319 ...................................................................
cwb_MDP0000297861|PACid:22646554 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000157871|PACid:22670351 ...................................................................
cwb_MDP0000250932|PACid:22662666 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000239289|PACid:22649630 ...................................................................
cwb_MDP0000258995|PACid:22632347 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000829384|PACid:22650105 ...................................................................
cwb_MDP0000145663|PACid:22632174 ...................................................................
cwb_MDP0000288439|PACid:22643642 ...................................................................
cwb_MDP0000267350|PACid:22676208 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000194622|PACid:22683388 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000312748|PACid:22644976 glpsnrpviemtipsvldktisppgkhvinl....................................
cwb_MDP0000197715|PACid:22640206 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000320539|PACid:22651795 ...................................................................
cwb_MDP0000140206|PACid:22652348 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000203847|PACid:22681509 ...................................................................
cwb_MDP0000201011|PACid:22661057 ...................................................................
cwb_MDP0000204596|PACid:22635084 ...................................................................
cwb_MDP0000148978|PACid:22620687 ...................................................................
cwb_MDP0000130369|PACid:22663416 ...................................................................
cwb_MDP0000314606|PACid:22664349 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000250583|PACid:22633065 ...................................................................
cwb_MDP0000208233|PACid:22624841 ...................................................................
cwb_MDP0000158720|PACid:22655873 ...................................................................
cwb_MDP0000152184|PACid:22632666 ...................................................................
cwb_MDP0000182702|PACid:22680484 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000130370|PACid:22654204 ...................................................................
cwb_MDP0000272119|PACid:22671033 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000214280|PACid:22681133 ...................................................................
cwb_MDP0000210966|PACid:22644665 ...................................................................
cwb_MDP0000610999|PACid:22659782 ...................................................................
cwb_MDP0000242546|PACid:22662348 ...................................................................
cwb_MDP0000320742|PACid:22645070 ...................................................................
cwb_MDP0000654164|PACid:22658363 ...................................................................
cwb_MDP0000256300|PACid:22644503 ...................................................................
cwb_MDP0000235080|PACid:22654616 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000125043|PACid:22648273 ...................................................................
cwb_MDP0000192359|PACid:22632529 ...................................................................
cwb_MDP0000440005|PACid:22623062 ...................................................................
cwb_MDP0000609131|PACid:22633588 ...................................................................
cwb_MDP0000362000|PACid:22628256 ...................................................................
cwb_MDP0000150210|PACid:22663655 ...................................................................
cwb_MDP0000158790|PACid:22624362 ...................................................................
cwb_MDP0000427950|PACid:22623610 ...................................................................
cwb_MDP0000569169|PACid:22666591 ...................................................................
cwb_MDP0000525742|PACid:22647174 ...................................................................
cwb_MDP0000559829|PACid:22672870 ...................................................................
cwb_MDP0000321788|PACid:22641842 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000832077|PACid:22645850 ...................................................................
cwb_MDP0000621365|PACid:22669861 ...................................................................
cwb_MDP0000875229|PACid:22620206 ...................................................................
cwb_MDP0000251344|PACid:22682514 ...................................................................
cwb_MDP0000168919|PACid:22641114 ...................................................................
cwb_MDP0000267855|PACid:22645516 scn................................................................
cwb_MDP0000195207|PACid:22668389 ...................................................................
cwb_MDP0000400145|PACid:22662498 ...................................................................
cwb_MDP0000919183|PACid:22661837 ...................................................................
cwb_MDP0000307336|PACid:22681275 ...................................................................
cwb_MDP0000263146|PACid:22654671 ...................................................................
cwb_MDP0000309730|PACid:22638555 ...................................................................
cwb_MDP0000163903|PACid:22648802 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000119779|PACid:22649695 ...................................................................
cwb_MDP0000120904|PACid:22629470 ...................................................................
cwb_MDP0000150544|PACid:22634453 ...................................................................
cwb_MDP0000902209|PACid:22678199 ...................................................................
cwb_MDP0000269370|PACid:22680893 ...................................................................
cwb_MDP0000146158|PACid:22623090 ...................................................................
cwb_MDP0000124051|PACid:22654473 ...................................................................
cwb_MDP0000255696|PACid:22677008 ...................................................................
cwb_MDP0000305861|PACid:22662391 ...................................................................
cwb_MDP0000611628|PACid:22643604 ...................................................................
cwb_MDP0000309622|PACid:22670269 ...................................................................
cwb_MDP0000239909|PACid:22648375 ...................................................................
cwb_MDP0000126888|PACid:22675379 ...................................................................
cwb_MDP0000869086|PACid:22644121 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000160099|PACid:22658087 ...................................................................
cwb_MDP0000251205|PACid:22649529 ...................................................................
cwb_MDP0000314335|PACid:22679828 ...................................................................
cwb_MDP0000638870|PACid:22646063 ...................................................................
cwb_MDP0000790657|PACid:22654829 ...................................................................
cwb_MDP0000748068|PACid:22649054 ...................................................................
cwb_MDP0000727481|PACid:22682921 ...................................................................
cwb_MDP0000301246|PACid:22669391 ...................................................................
cwb_MDP0000190684|PACid:22677586 ...................................................................
cwb_MDP0000456223|PACid:22643829 ...................................................................
cwb_MDP0000745172|PACid:22667211 ...................................................................
cwb_MDP0000407932|PACid:22626437 ...................................................................
cwb_MDP0000440896|PACid:22680420 ...................................................................
cwb_MDP0000694227|PACid:22673619 ...................................................................
cwb_MDP0000123987|PACid:22662898 ...................................................................
cwb_MDP0000138005|PACid:22620884 ...................................................................
cwb_MDP0000258205|PACid:22638470 ...................................................................
cwb_MDP0000245245|PACid:22671727 ...................................................................
cwb_MDP0000306704|PACid:22680179 ...................................................................
cwb_MDP0000478654|PACid:22674637 ...................................................................
cwb_MDP0000728219|PACid:22657389 ...................................................................
cwb_MDP0000170414|PACid:22675630 ...................................................................
cwb_MDP0000284363|PACid:22634918 ...................................................................
cwb_MDP0000219560|PACid:22625984 ...................................................................
cwb_MDP0000235930|PACid:22635275 ...................................................................
cwb_MDP0000755938|PACid:22650525 ...................................................................
cwb_MDP0000138851|PACid:22674897 ...................................................................
cwb_MDP0000261638|PACid:22646820 ...................................................................
cwb_MDP0000317524|PACid:22631851 ...................................................................
cwb_MDP0000294615|PACid:22655955 ...................................................................
cwb_MDP0000208234|PACid:22624840 ...................................................................
cwb_MDP0000216129|PACid:22668259 ...................................................................
cwb_MDP0000219521|PACid:22657613 ...................................................................
cwb_MDP0000248995|PACid:22642703 ...................................................................
cwb_MDP0000256328|PACid:22629063 ...................................................................
cwb_MDP0000181673|PACid:22646891 ...................................................................
cwb_MDP0000169201|PACid:22625917 ...................................................................
cwb_MDP0000263530|PACid:22651991 ...................................................................
cwb_MDP0000295839|PACid:22658517 ...................................................................
cwb_MDP0000297466|PACid:22645872 ...................................................................
cwb_MDP0000281982|PACid:22629373 ...................................................................
cwb_MDP0000053966|PACid:22620929 ...................................................................
cwb_MDP0000795740|PACid:22666880 ...................................................................
cwb_MDP0000212327|PACid:22630830 ...................................................................
cwb_MDP0000437365|PACid:22632357 ...................................................................
cwb_MDP0000135231|PACid:22629791 ...................................................................
cwb_MDP0000167343|PACid:22638473 ...................................................................
cwb_MDP0000222306|PACid:22645946 ...................................................................
cwb_MDP0000183517|PACid:22634175 ...................................................................
cwb_MDP0000686821|PACid:22637777 ...................................................................
cwb_MDP0000430157|PACid:22655785 ...................................................................
cwb_MDP0000373054|PACid:22683333 ...................................................................
cwb_MDP0000295306|PACid:22673308 ...................................................................
cwb_MDP0000233995|PACid:22662680 ...................................................................
cwb_MDP0000209681|PACid:22642739 ...................................................................
cwb_MDP0000876898|PACid:22679933 ...................................................................
cwb_MDP0000738522|PACid:22680891 ...................................................................
cwb_MDP0000399642|PACid:22674547 ...................................................................
cwb_MDP0000215521|PACid:22667208 ...................................................................
cwb_MDP0000170521|PACid:22675770 ...................................................................
cwb_MDP0000262982|PACid:22620906 ...................................................................
cwb_MDP0000321186|PACid:22667177 ...................................................................
cwb_MDP0000266051|PACid:22641431 ...................................................................
cwb_MDP0000837610|PACid:22643529 ...................................................................
cwb_MDP0000582079|PACid:22634000 ...................................................................
cwb_MDP0000538071|PACid:22663035 ...................................................................
cwb_MDP0000241703|PACid:22642424 ...................................................................
cwb_MDP0000671114|PACid:22638724 ...................................................................
cwb_MDP0000315388|PACid:22681954 ...................................................................
cwb_MDP0000134271|PACid:22620865 ...................................................................
cwb_MDP0000297581|PACid:22646099 ...................................................................
cwb_MDP0000911003|PACid:22677366 ...................................................................
cwb_MDP0000576650|PACid:22634720 ...................................................................
cwb_MDP0000149205|PACid:22670334 ...................................................................
cwb_MDP0000315409|PACid:22681973 ...................................................................
cwb_MDP0000320804|PACid:22671446 ...................................................................
cwb_MDP0000474647|PACid:22667377 ...................................................................
cwb_MDP0000566648|PACid:22666666 ...................................................................
cwb_MDP0000171379|PACid:22629613 ...................................................................
cwb_MDP0000814529|PACid:22673539 ...................................................................
cwb_MDP0000218295|PACid:22671514 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000795437|PACid:22664825 ...................................................................
cwb_MDP0000919706|PACid:22656631 ...................................................................
cwb_MDP0000295675|PACid:22626457 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000272126|PACid:22655119 ...................................................................
cwb_MDP0000196881|PACid:22654963 ...................................................................
cwb_MDP0000268346|PACid:22678394 ...................................................................
cwb_MDP0000147542|PACid:22652542 ...................................................................
cwb_MDP0000948298|PACid:22676144 ...................................................................
cwb_MDP0000220943|PACid:22675739 ...................................................................
cwb_MDP0000182589|PACid:22648509 ...................................................................
cwb_MDP0000557870|PACid:22631128 ...................................................................
cwb_MDP0000308870|PACid:22652882 ...................................................................
cwb_MDP0000322449|PACid:22657441 ...................................................................
cwb_MDP0000286494|PACid:22671310 ...................................................................
cwb_MDP0000150868|PACid:22621264 ...................................................................
cwb_MDP0000155608|PACid:22665289 ...................................................................
cwb_MDP0000168505|PACid:22672316 ...................................................................
cwb_MDP0000196888|PACid:22670849 ...................................................................
cwb_MDP0000154812|PACid:22632894 ...................................................................
cwb_MDP0000186080|PACid:22622639 ...................................................................
cwb_MDP0000220012|PACid:22626541 ...................................................................
cwb_MDP0000169409|PACid:22673915 ...................................................................
cwb_MDP0000373095|PACid:22661923 ...................................................................
cwb_MDP0000235846|PACid:22627807 ...................................................................
cwb_MDP0000207126|PACid:22623152 ...................................................................
cwb_MDP0000268357|PACid:22630891 ...................................................................
cwb_MDP0000149067|PACid:22669209 ...................................................................


                                                                                                   
                                                                                                   
d1xdia1                          ..................................................................
cwb_MDP0000813172|PACid:22649115 ..................................................................
cwb_MDP0000251581|PACid:22621152 ..................................................................
cwb_MDP0000188391|PACid:22626210 ..................................................................
cwb_MDP0000254144|PACid:22644986 ..................................................................
cwb_MDP0000321972|PACid:22643109 ..................................................................
cwb_MDP0000299806|PACid:22682346 ..................................................................
cwb_MDP0000283451|PACid:22680462 ..................................................................
cwb_MDP0000296714|PACid:22644308 ..................................................................
cwb_MDP0000162193|PACid:22629958 ..................................................................
cwb_MDP0000769741|PACid:22637873 ..................................................................
cwb_MDP0000295277|PACid:22625688 ..................................................................
cwb_MDP0000897124|PACid:22647159 ..................................................................
cwb_MDP0000854208|PACid:22682207 ..................................................................
cwb_MDP0000241767|PACid:22665328 ..................................................................
cwb_MDP0000318858|PACid:22682838 ..................................................................
cwb_MDP0000248995|PACid:22642703 ..................................................................
cwb_MDP0000442206|PACid:22660061 ..................................................................
cwb_MDP0000181673|PACid:22646891 ..................................................................
cwb_MDP0000315409|PACid:22681973 ..................................................................
cwb_MDP0000053966|PACid:22620929 ..................................................................
cwb_MDP0000294615|PACid:22655955 ..................................................................
cwb_MDP0000306147|PACid:22679041 ..................................................................
cwb_MDP0000180064|PACid:22628138 ..................................................................
cwb_MDP0000261625|PACid:22630921 ..................................................................
cwb_MDP0000300208|PACid:22651331 ..................................................................
cwb_MDP0000247171|PACid:22623108 ..................................................................
cwb_MDP0000308095|PACid:22667065 ..................................................................
cwb_MDP0000319421|PACid:22624123 ..................................................................
cwb_MDP0000232295|PACid:22657598 ..................................................................
cwb_MDP0000188994|PACid:22643055 ..................................................................
cwb_MDP0000159189|PACid:22672554 ..................................................................
cwb_MDP0000656178|PACid:22657871 ..................................................................
cwb_MDP0000910523|PACid:22620639 ..................................................................
cwb_MDP0000119941|PACid:22643547 ..................................................................
cwb_MDP0000231799|PACid:22673471 ..................................................................
cwb_MDP0000255025|PACid:22624807 ..................................................................
cwb_MDP0000231632|PACid:22622264 ..................................................................
cwb_MDP0000173300|PACid:22648712 ..................................................................
cwb_MDP0000158474|PACid:22655457 ..................................................................
cwb_MDP0000276878|PACid:22649644 ..................................................................
cwb_MDP0000154720|PACid:22639222 ..................................................................
cwb_MDP0000549646|PACid:22624756 ..................................................................
cwb_MDP0000158853|PACid:22672016 vgssgedldsmaeplpsddsgsatsssppplqilfageathrthystthgaylsglreanrllqhy
cwb_MDP0000702799|PACid:22650781 vgssgedldsmaeplpsddsgsatsssppplqilfageathrthystthgaylsglreanrllqhy
cwb_MDP0000233110|PACid:22669060 ..................................................................
cwb_MDP0000260827|PACid:22621315 ..................................................................
cwb_MDP0000941459|PACid:22654340 ..................................................................
cwb_MDP0000185338|PACid:22637072 ..................................................................
cwb_MDP0000451172|PACid:22678939 ..................................................................
cwb_MDP0000136847|PACid:22626492 ..................................................................
cwb_MDP0000177641|PACid:22624304 ..................................................................
cwb_MDP0000413935|PACid:22663920 ..................................................................
cwb_MDP0000206098|PACid:22637273 ..................................................................
cwb_MDP0000845788|PACid:22673064 ..................................................................
cwb_MDP0000465595|PACid:22654474 ..................................................................
cwb_MDP0000137211|PACid:22645789 ..................................................................
cwb_MDP0000130099|PACid:22624356 ..................................................................
cwb_MDP0000425135|PACid:22674685 ..................................................................
cwb_MDP0000200780|PACid:22660656 ..................................................................
cwb_MDP0000142434|PACid:22683351 ..................................................................
cwb_MDP0000248951|PACid:22626490 ..................................................................
cwb_MDP0000869086|PACid:22644121 ..................................................................
cwb_MDP0000318256|PACid:22681338 ..................................................................
cwb_MDP0000231634|PACid:22622267 ..................................................................
cwb_MDP0000626995|PACid:22630905 ..................................................................
cwb_MDP0000123832|PACid:22633934 ..................................................................
cwb_MDP0000236092|PACid:22632501 ..................................................................
cwb_MDP0000199159|PACid:22674497 ..................................................................
cwb_MDP0000162755|PACid:22662459 ..................................................................
cwb_MDP0000173666|PACid:22649255 ..................................................................
cwb_MDP0000262982|PACid:22620906 ..................................................................
cwb_MDP0000184832|PACid:22636281 ..................................................................
cwb_MDP0000598927|PACid:22655979 ..................................................................
cwb_MDP0000561228|PACid:22637769 ..................................................................
cwb_MDP0000175650|PACid:22652650 ..................................................................
cwb_MDP0000233802|PACid:22672706 ..................................................................
cwb_MDP0000321186|PACid:22667177 ..................................................................
cwb_MDP0000161955|PACid:22660959 ..................................................................
cwb_MDP0000213381|PACid:22663844 ..................................................................
cwb_MDP0000168437|PACid:22624648 ..................................................................
cwb_MDP0000823251|PACid:22668430 ..................................................................
cwb_MDP0000191389|PACid:22631180 ..................................................................
cwb_MDP0000199319|PACid:22658752 ..................................................................
cwb_MDP0000857446|PACid:22649571 ..................................................................
cwb_MDP0000266638|PACid:22658651 ..................................................................
cwb_MDP0000208936|PACid:22641581 ..................................................................
cwb_MDP0000202883|PACid:22663993 ..................................................................
cwb_MDP0000288439|PACid:22643642 ..................................................................
cwb_MDP0000295839|PACid:22658517 ..................................................................
cwb_MDP0000903805|PACid:22678063 ..................................................................
cwb_MDP0000202123|PACid:22678734 ..................................................................
cwb_MDP0000227773|PACid:22639029 ..................................................................
cwb_MDP0000317524|PACid:22631851 ..................................................................
cwb_MDP0000320748|PACid:22658808 ..................................................................
cwb_MDP0000634676|PACid:22625957 ..................................................................
cwb_MDP0000235846|PACid:22627807 ..................................................................
cwb_MDP0000251344|PACid:22682514 ..................................................................
cwb_MDP0000501957|PACid:22671723 ..................................................................
cwb_MDP0000209681|PACid:22642739 ..................................................................
cwb_MDP0000293482|PACid:22637734 ..................................................................
cwb_MDP0000233995|PACid:22662680 ..................................................................
cwb_MDP0000257243|PACid:22657003 ..................................................................
cwb_MDP0000160099|PACid:22658087 ..................................................................
cwb_MDP0000193196|PACid:22649572 ..................................................................
cwb_MDP0000208234|PACid:22624840 ..................................................................
cwb_MDP0000251783|PACid:22654795 ..................................................................
cwb_MDP0000686885|PACid:22670382 ..................................................................
cwb_MDP0000138851|PACid:22674897 ..................................................................
cwb_MDP0000194930|PACid:22667971 ..................................................................
cwb_MDP0000169201|PACid:22625917 ..................................................................
cwb_MDP0000399642|PACid:22674547 ..................................................................
cwb_MDP0000582079|PACid:22634000 ..................................................................
cwb_MDP0000129765|PACid:22673448 ..................................................................
cwb_MDP0000272655|PACid:22672104 ..................................................................
cwb_MDP0000686821|PACid:22637777 ..................................................................
cwb_MDP0000170414|PACid:22675630 ..................................................................
cwb_MDP0000320804|PACid:22671446 ..................................................................
cwb_MDP0000189790|PACid:22676146 ..................................................................
cwb_MDP0000847111|PACid:22682055 ..................................................................
cwb_MDP0000289536|PACid:22677728 ..................................................................
cwb_MDP0000123987|PACid:22662898 ..................................................................
cwb_MDP0000245245|PACid:22671727 ..................................................................
cwb_MDP0000188553|PACid:22658192 ..................................................................
cwb_MDP0000296599|PACid:22628159 ..................................................................
cwb_MDP0000746652|PACid:22636428 ..................................................................
cwb_MDP0000259265|PACid:22650727 ..................................................................
cwb_MDP0000151331|PACid:22656760 ..................................................................
cwb_MDP0000309775|PACid:22670556 ..................................................................
cwb_MDP0000232736|PACid:22657363 ..................................................................
cwb_MDP0000320539|PACid:22651795 ..................................................................
cwb_MDP0000239909|PACid:22648375 ..................................................................
cwb_MDP0000259264|PACid:22650726 ..................................................................
cwb_MDP0000293613|PACid:22654008 ..................................................................
cwb_MDP0000253362|PACid:22653297 ..................................................................
cwb_MDP0000182973|PACid:22649063 ..................................................................
cwb_MDP0000138005|PACid:22620884 ..................................................................
cwb_MDP0000261301|PACid:22674262 ..................................................................
cwb_MDP0000771633|PACid:22649768 ..................................................................
cwb_MDP0000851102|PACid:22674240 ..................................................................
cwb_MDP0000159873|PACid:22673571 ..................................................................
cwb_MDP0000140206|PACid:22652348 ..................................................................
cwb_MDP0000261201|PACid:22657417 ..................................................................
cwb_MDP0000252244|PACid:22643267 ..................................................................
cwb_MDP0000261821|PACid:22664612 ..................................................................
cwb_MDP0000124454|PACid:22663639 ..................................................................
cwb_MDP0000234830|PACid:22664319 ..................................................................
cwb_MDP0000297861|PACid:22646554 ..................................................................
cwb_MDP0000152184|PACid:22632666 ..................................................................
cwb_MDP0000157871|PACid:22670351 ..................................................................
cwb_MDP0000250932|PACid:22662666 ..................................................................
cwb_MDP0000219521|PACid:22657613 ..................................................................
cwb_MDP0000239289|PACid:22649630 ..................................................................
cwb_MDP0000258995|PACid:22632347 ..................................................................
cwb_MDP0000167343|PACid:22638473 ..................................................................
cwb_MDP0000222306|PACid:22645946 ..................................................................
cwb_MDP0000829384|PACid:22650105 ..................................................................
cwb_MDP0000145663|PACid:22632174 ..................................................................
cwb_MDP0000288439|PACid:22643642 ..................................................................
cwb_MDP0000267350|PACid:22676208 ..................................................................
cwb_MDP0000155608|PACid:22665289 ..................................................................
cwb_MDP0000194622|PACid:22683388 ..................................................................
cwb_MDP0000134271|PACid:22620865 ..................................................................
cwb_MDP0000312748|PACid:22644976 ..................................................................
cwb_MDP0000197715|PACid:22640206 ..................................................................
cwb_MDP0000220943|PACid:22675739 ..................................................................
cwb_MDP0000320539|PACid:22651795 ..................................................................
cwb_MDP0000140206|PACid:22652348 ..................................................................
cwb_MDP0000215521|PACid:22667208 ..................................................................
cwb_MDP0000203847|PACid:22681509 ..................................................................
cwb_MDP0000201011|PACid:22661057 ..................................................................
cwb_MDP0000204596|PACid:22635084 ..................................................................
cwb_MDP0000148978|PACid:22620687 ..................................................................
cwb_MDP0000130369|PACid:22663416 ..................................................................
cwb_MDP0000314606|PACid:22664349 ..................................................................
cwb_MDP0000263146|PACid:22654671 ..................................................................
cwb_MDP0000250583|PACid:22633065 ..................................................................
cwb_MDP0000208233|PACid:22624841 ..................................................................
cwb_MDP0000158720|PACid:22655873 ..................................................................
cwb_MDP0000152184|PACid:22632666 ..................................................................
cwb_MDP0000182702|PACid:22680484 ..................................................................
cwb_MDP0000261638|PACid:22646820 ..................................................................
cwb_MDP0000130370|PACid:22654204 ..................................................................
cwb_MDP0000272119|PACid:22671033 ..................................................................
cwb_MDP0000305861|PACid:22662391 ..................................................................
cwb_MDP0000255696|PACid:22677008 ..................................................................
cwb_MDP0000214280|PACid:22681133 ..................................................................
cwb_MDP0000210966|PACid:22644665 ..................................................................
cwb_MDP0000610999|PACid:22659782 ..................................................................
cwb_MDP0000242546|PACid:22662348 ..................................................................
cwb_MDP0000320742|PACid:22645070 ..................................................................
cwb_MDP0000654164|PACid:22658363 ..................................................................
cwb_MDP0000256300|PACid:22644503 ..................................................................
cwb_MDP0000235080|PACid:22654616 ..................................................................
cwb_MDP0000284363|PACid:22634918 ..................................................................
cwb_MDP0000125043|PACid:22648273 ..................................................................
cwb_MDP0000192359|PACid:22632529 ..................................................................
cwb_MDP0000440005|PACid:22623062 ..................................................................
cwb_MDP0000609131|PACid:22633588 ..................................................................
cwb_MDP0000362000|PACid:22628256 ..................................................................
cwb_MDP0000150210|PACid:22663655 ..................................................................
cwb_MDP0000158790|PACid:22624362 ..................................................................
cwb_MDP0000427950|PACid:22623610 ..................................................................
cwb_MDP0000569169|PACid:22666591 ..................................................................
cwb_MDP0000525742|PACid:22647174 ..................................................................
cwb_MDP0000559829|PACid:22672870 ..................................................................
cwb_MDP0000321788|PACid:22641842 ..................................................................
cwb_MDP0000919183|PACid:22661837 ..................................................................
cwb_MDP0000146158|PACid:22623090 ..................................................................
cwb_MDP0000832077|PACid:22645850 ..................................................................
cwb_MDP0000621365|PACid:22669861 ..................................................................
cwb_MDP0000875229|PACid:22620206 ..................................................................
cwb_MDP0000251344|PACid:22682514 ..................................................................
cwb_MDP0000168919|PACid:22641114 ..................................................................
cwb_MDP0000267855|PACid:22645516 ..................................................................
cwb_MDP0000195207|PACid:22668389 ..................................................................
cwb_MDP0000400145|PACid:22662498 ..................................................................
cwb_MDP0000919183|PACid:22661837 ..................................................................
cwb_MDP0000307336|PACid:22681275 ..................................................................
cwb_MDP0000263146|PACid:22654671 ..................................................................
cwb_MDP0000309730|PACid:22638555 ..................................................................
cwb_MDP0000163903|PACid:22648802 ..................................................................
cwb_MDP0000611628|PACid:22643604 ..................................................................
cwb_MDP0000119779|PACid:22649695 ..................................................................
cwb_MDP0000120904|PACid:22629470 ..................................................................
cwb_MDP0000150544|PACid:22634453 ..................................................................
cwb_MDP0000902209|PACid:22678199 ..................................................................
cwb_MDP0000269370|PACid:22680893 ..................................................................
cwb_MDP0000146158|PACid:22623090 ..................................................................
cwb_MDP0000124051|PACid:22654473 ..................................................................
cwb_MDP0000255696|PACid:22677008 ..................................................................
cwb_MDP0000305861|PACid:22662391 ..................................................................
cwb_MDP0000611628|PACid:22643604 ..................................................................
cwb_MDP0000309622|PACid:22670269 ..................................................................
cwb_MDP0000239909|PACid:22648375 ..................................................................
cwb_MDP0000126888|PACid:22675379 ..................................................................
cwb_MDP0000869086|PACid:22644121 ..................................................................
cwb_MDP0000317524|PACid:22631851 ..................................................................
cwb_MDP0000160099|PACid:22658087 ..................................................................
cwb_MDP0000251205|PACid:22649529 ..................................................................
cwb_MDP0000314335|PACid:22679828 ..................................................................
cwb_MDP0000638870|PACid:22646063 ..................................................................
cwb_MDP0000790657|PACid:22654829 ..................................................................
cwb_MDP0000748068|PACid:22649054 ..................................................................
cwb_MDP0000727481|PACid:22682921 ..................................................................
cwb_MDP0000301246|PACid:22669391 ..................................................................
cwb_MDP0000190684|PACid:22677586 ..................................................................
cwb_MDP0000456223|PACid:22643829 ..................................................................
cwb_MDP0000745172|PACid:22667211 ..................................................................
cwb_MDP0000407932|PACid:22626437 ..................................................................
cwb_MDP0000440896|PACid:22680420 ..................................................................
cwb_MDP0000694227|PACid:22673619 ..................................................................
cwb_MDP0000123987|PACid:22662898 ..................................................................
cwb_MDP0000138005|PACid:22620884 ..................................................................
cwb_MDP0000258205|PACid:22638470 ..................................................................
cwb_MDP0000245245|PACid:22671727 ..................................................................
cwb_MDP0000306704|PACid:22680179 ..................................................................
cwb_MDP0000478654|PACid:22674637 ..................................................................
cwb_MDP0000728219|PACid:22657389 ..................................................................
cwb_MDP0000170414|PACid:22675630 ..................................................................
cwb_MDP0000284363|PACid:22634918 ..................................................................
cwb_MDP0000219560|PACid:22625984 ..................................................................
cwb_MDP0000235930|PACid:22635275 ..................................................................
cwb_MDP0000755938|PACid:22650525 ..................................................................
cwb_MDP0000138851|PACid:22674897 ..................................................................
cwb_MDP0000261638|PACid:22646820 ..................................................................
cwb_MDP0000317524|PACid:22631851 ..................................................................
cwb_MDP0000294615|PACid:22655955 ..................................................................
cwb_MDP0000208234|PACid:22624840 ..................................................................
cwb_MDP0000216129|PACid:22668259 ..................................................................
cwb_MDP0000219521|PACid:22657613 ..................................................................
cwb_MDP0000248995|PACid:22642703 ..................................................................
cwb_MDP0000256328|PACid:22629063 ..................................................................
cwb_MDP0000181673|PACid:22646891 ..................................................................
cwb_MDP0000169201|PACid:22625917 ..................................................................
cwb_MDP0000263530|PACid:22651991 ..................................................................
cwb_MDP0000295839|PACid:22658517 ..................................................................
cwb_MDP0000297466|PACid:22645872 ..................................................................
cwb_MDP0000281982|PACid:22629373 ..................................................................
cwb_MDP0000053966|PACid:22620929 ..................................................................
cwb_MDP0000795740|PACid:22666880 ..................................................................
cwb_MDP0000212327|PACid:22630830 ..................................................................
cwb_MDP0000437365|PACid:22632357 ..................................................................
cwb_MDP0000135231|PACid:22629791 ..................................................................
cwb_MDP0000167343|PACid:22638473 ..................................................................
cwb_MDP0000222306|PACid:22645946 ..................................................................
cwb_MDP0000183517|PACid:22634175 ..................................................................
cwb_MDP0000686821|PACid:22637777 ..................................................................
cwb_MDP0000430157|PACid:22655785 ..................................................................
cwb_MDP0000373054|PACid:22683333 ..................................................................
cwb_MDP0000295306|PACid:22673308 ..................................................................
cwb_MDP0000233995|PACid:22662680 ..................................................................
cwb_MDP0000209681|PACid:22642739 ..................................................................
cwb_MDP0000876898|PACid:22679933 ..................................................................
cwb_MDP0000738522|PACid:22680891 ..................................................................
cwb_MDP0000399642|PACid:22674547 ..................................................................
cwb_MDP0000215521|PACid:22667208 ..................................................................
cwb_MDP0000170521|PACid:22675770 ..................................................................
cwb_MDP0000262982|PACid:22620906 ..................................................................
cwb_MDP0000321186|PACid:22667177 ..................................................................
cwb_MDP0000266051|PACid:22641431 ..................................................................
cwb_MDP0000837610|PACid:22643529 ..................................................................
cwb_MDP0000582079|PACid:22634000 ..................................................................
cwb_MDP0000538071|PACid:22663035 ..................................................................
cwb_MDP0000241703|PACid:22642424 ..................................................................
cwb_MDP0000671114|PACid:22638724 ..................................................................
cwb_MDP0000315388|PACid:22681954 ..................................................................
cwb_MDP0000134271|PACid:22620865 ..................................................................
cwb_MDP0000297581|PACid:22646099 ..................................................................
cwb_MDP0000911003|PACid:22677366 ..................................................................
cwb_MDP0000576650|PACid:22634720 ..................................................................
cwb_MDP0000149205|PACid:22670334 ..................................................................
cwb_MDP0000315409|PACid:22681973 ..................................................................
cwb_MDP0000320804|PACid:22671446 ..................................................................
cwb_MDP0000474647|PACid:22667377 ..................................................................
cwb_MDP0000566648|PACid:22666666 ..................................................................
cwb_MDP0000171379|PACid:22629613 ..................................................................
cwb_MDP0000814529|PACid:22673539 ..................................................................
cwb_MDP0000218295|PACid:22671514 ..................................................................
cwb_MDP0000220943|PACid:22675739 ..................................................................
cwb_MDP0000795437|PACid:22664825 ..................................................................
cwb_MDP0000919706|PACid:22656631 ..................................................................
cwb_MDP0000295675|PACid:22626457 ..................................................................
cwb_MDP0000147542|PACid:22652542 ..................................................................
cwb_MDP0000272126|PACid:22655119 ..................................................................
cwb_MDP0000196881|PACid:22654963 ..................................................................
cwb_MDP0000268346|PACid:22678394 ..................................................................
cwb_MDP0000147542|PACid:22652542 ..................................................................
cwb_MDP0000948298|PACid:22676144 ..................................................................
cwb_MDP0000220943|PACid:22675739 ..................................................................
cwb_MDP0000182589|PACid:22648509 ..................................................................
cwb_MDP0000557870|PACid:22631128 ..................................................................
cwb_MDP0000308870|PACid:22652882 ..................................................................
cwb_MDP0000322449|PACid:22657441 ..................................................................
cwb_MDP0000286494|PACid:22671310 ..................................................................
cwb_MDP0000150868|PACid:22621264 ..................................................................
cwb_MDP0000155608|PACid:22665289 ..................................................................
cwb_MDP0000168505|PACid:22672316 ..................................................................
cwb_MDP0000196888|PACid:22670849 ..................................................................
cwb_MDP0000154812|PACid:22632894 ..................................................................
cwb_MDP0000186080|PACid:22622639 ..................................................................
cwb_MDP0000220012|PACid:22626541 ..................................................................
cwb_MDP0000169409|PACid:22673915 ..................................................................
cwb_MDP0000373095|PACid:22661923 ..................................................................
cwb_MDP0000235846|PACid:22627807 ..................................................................
cwb_MDP0000207126|PACid:22623152 ..................................................................
cwb_MDP0000268357|PACid:22630891 ..................................................................
cwb_MDP0000149067|PACid:22669209 ..................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0050927 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis