SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

FAD/NAD(P)-binding domain alignments in PDB chains (SCOP 1.75)

These alignments are sequences aligned to the 0037441 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                      10        20  
                                                                                       |         |  
d1f8ra1  .................................................................rnpl----AECFQENDYEEFLEIARN
2dw4A  .................................................................kktg----------------------
2h94A  .................................................................kktg----------------------
2iw5A  .................................................................kktg----------------------
2z3yA  .................................................................kktg----------------------
1ltxR  ...................................................................nl----------------------
1vg0A  ...................................................................nl----------------------
1jnrA  .......................................................yypkkyelykadev----------------------
2c76A  .....................................................................M---------------------
2v5zA  .....................................................................M---------------------
2bk5A  .....................................................................M---------------------
2c73A  .....................................................................M---------------------
2c75A  .....................................................................M---------------------
2c72A  .....................................................................M---------------------
1o5wA  .....................................................................M---------------------
1nekA  ...................................................................pv----------------------
1chuA  ...................................................................lp----------------------
1cf3A  ................................................................dvsgr----------------------
1knrA  ...................................................................lp----------------------
2b76A  ..................................................................qtf----------------------
1kf6A  ..................................................................qtf----------------------
3cirA  ....................................................................m----------------------
1ebdA  ..................................................................ete----------------------
1gpeA  ....................................................aqqidvqssllsdpskv----------------------
3cpiG  ....................................................................d----------------------
2bcgG  ....................................................................d----------------------
1d4cA  ...................................................................vk----------------------
1d4dA  ...................................................................vk----------------------
1d5tA  .....................................................................M---------------------
1gndA  .....................................................................M---------------------
1lv0A  .....................................................................M---------------------
1dxlA  ...................................................................en----------------------
3c96A  ....................................................................i----------------------
2i0zA  .....................................................................M---------------------
1lpfA  ....................................................................q----------------------
1reoA  ....................................................................n----------------------
2gmhA  .............................................pritthytiyprdqdkrwegvnme----------------------
1qo8A  ................................................................aiaag----------------------
2gqfA  ..............................................................msqysen----------------------
1pj5A  ....................................................................p----------------------
1b5qA  ....................................................................g----------------------
2iidA  ....................................................................n----------------------
2ivdA  .....................................................................M---------------------
1q9iA  ...................................................................ph----------------------
1jryA  ...................................................................ph----------------------
1p2eA  ...................................................................ph----------------------
1p2hA  ...................................................................ph----------------------
1y0pA  ...................................................................ph----------------------
1ksuA  ...................................................................ph----------------------
1jrzA  ...................................................................ph----------------------
1jrxA  ...................................................................ph----------------------
1kssA  ...................................................................ph----------------------
1v59A  ....................................................................n----------------------
2b7rA  ...................................................................ph----------------------
2b7sA  ...................................................................ph----------------------
3ladA  ....................................................................q----------------------
1m64A  ...................................................................ph----------------------
1lj1A  ...................................................................ph----------------------
1e39A  ...................................................................ph----------------------
2gjcA  .............................................lnstpvthclsdivkkedwsdfkf-----APIRESTVSRAMTSRYF
1pn0A  .................................................................sesy----------------------
1ykjA  ....................................................................m----------------------
1pxbA  ....................................................................m----------------------
1k0iA  ....................................................................m----------------------
1dobA  ....................................................................m----------------------
1iutA  ....................................................................m----------------------
1pxcA  ....................................................................m----------------------
1pbeA  ....................................................................m----------------------
1cj2A  ....................................................................m----------------------
1cc4A  ....................................................................m----------------------
1bgnA  ....................................................................m----------------------
1fohA  ..................................................................esy----------------------
1pbdA  ....................................................................m----------------------
1pbfA  ....................................................................m----------------------
1cj3A  ....................................................................m----------------------
1bgjA  ....................................................................m----------------------
1bf3A  ....................................................................m----------------------
1cj4A  ....................................................................m----------------------
1bkwA  ....................................................................m----------------------
1pxaA  ....................................................................m----------------------
1cc6A  ....................................................................m----------------------
1gesA  .....................................................................M---------------------
2bs3A  ..................................................................qyc----------------------
1qlbA  ..................................................................qyc----------------------
2bs2A  ..................................................................qyc----------------------
1bhyA  ...................................................................da----------------------
1ojtA  ...................................................................da----------------------
1cjcA  ....................................................................a----------------------
1gerA  .....................................................................M---------------------
1lvlA  ..................................................................iqt----------------------
1kdgA  ....................................................................t----------------------
1naaA  ....................................................................p----------------------
1w4xA  ...................................................................pq----------------------
1tdeA  ....................................................................t----------------------
1cl0A  ....................................................................t----------------------
1f6mA  ....................................................................t----------------------
1typA  ....................................................................m----------------------
1tytA  ....................................................................m----------------------
1fecA  .....................................................................----------------------
2tprA  .....................................................................----------------------
1ju2A  .......................................................tsdhdfsylsfayd---------------------A
1tdfA  ....................................................................t----------------------
1trbA  ....................................................................t----------------------
1gxfA  .....................................................................M---------------------
1bzlA  .....................................................................M---------------------
1ndaA  .....................................................................M---------------------
1aogA  .....................................................................----------------------
1onfA  .....................................................................----------------------
1xanA  .....................................................................----------------------
3grsA  .....................................................................----------------------
1fl2A  .....................................................................----------------------
1l9cA  .....................................................................----------------------
2gf3A  .....................................................................----------------------
3bhkA  .....................................................................----------------------
3grtA  .....................................................................----------------------
1grtA  .....................................................................----------------------
1hyuA  ................................................................alnkr----------------------
1w4xA  ....................................................................v----------------------
1sezA  ....................................................................a----------------------
1h6vA  ...................................................................sy----------------------
1rp0A  ...............................................................dlnaft----FDPIKESIVSREMTRRYM
2f5vA  .....................................................................M---------------------
2f6cA  .....................................................................M---------------------
1tzlA  .....................................................................M---------------------
2gv8A  ..................................................................pti----------------------
1vqwA  ..................................................................pti----------------------
2ignA  .....................................................................M---------------------
1vdcA  ....................................................................t----------------------
1ng4A  .....................................................................----------------------
1ryiA  .....................................................................----------------------
1xdiA  ....................................................................t----------------------
2vouA  .................................................................pttd----------------------
1xhcA  ...................................................................hg----------------------
1b8sA  ....................................................................a----------------------
1n4wA  ....................................................................a----------------------
3cnjA  ....................................................................a----------------------
1q1rA  ....................................................................n----------------------
1f8wA  .....................................................................M---------------------
1nhqA  ....................................................................k----------------------
1nhrA  ....................................................................k----------------------
1ijhA  ....................................................................a----------------------
3b6dA  ....................................................................a----------------------
1cc2A  ....................................................................a----------------------
3b3rA  ....................................................................a----------------------
1npxA  .....................................................................M---------------------
1cboA  ....................................................................a----------------------
1nhsA  .....................................................................M---------------------
1nhpA  .....................................................................M---------------------
1mo9A  ....................................................................r----------------------
1fcdA  gyseeaaaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvayylkahkpms----------------------
1m6iA  ..............................................................kapshvp----------------------
1gv4A  .............................................................irapshvp----------------------
3coxA  ................................................................dgdrv----------------------
1d7yA  ...................................................................ka----------------------
1d7yA  .....................................................................----------------------
1fcdA  ....................................................................r----------------------
1ps9A  ....................................................................v----------------------
1djnA  .................................................gtnclthdpipgadaslpdq----------------------
1djqA  .................................................gtnclthdpipgadaslpdq----------------------
2culA  .....................................................................----------------------
1gv4A  ...................................................................ev----------------------
1m6iA  ...................................................................ev----------------------
1nhrA  ....................................................................m----------------------
1nhqA  ....................................................................m----------------------
2gv8A  .........................................................eiylkggkvlsn----------------------
1vqwA  ........................................................reiylkggkvlsn----------------------
1gndA  ..............................................piddgsesqvfcscsydatthfe----------------------
1lv0A  ..............................................piddgsesqvfcscsydatthfe----------------------
1d5tA  ...............................................piddgsesqvfcscsydatthf----------------------
3cpiG  ...............................................predgskdniylsrsydasshf----------------------
2bcgG  ...............................................predgskdniylsrsydasshf----------------------
1fcdA  ..................................................................vkv----------------------


               30        40        50                  60            70                             
                |         |         |                   |             |                             
d1f8ra1  GLKATSNPKHVVIVGAGMAGLSAAYVLAGA......GH...QVTVL.EASER....PGGRVR.TYR.....NE..................
2dw4A  ---------KVIIIGSGVSGLAAARQLQSF......GM...DVTLL.EARDR....VGGRVA.TFR.....KG..................
2h94A  ---------KVIIIGSGVSGLAAARQLQSF......GM...DVTLL.EARDR....VGGRVA.TFR.....KG..................
2iw5A  ---------KVIIIGSGVSGLAAARQLQSF......GM...DVTLL.EARDR....VGGRVA.TFR.....KG..................
2z3yA  ---------KVIIIGSGVSGLAAARQLQSF......GM...DVTLL.EARDR....VGGRVA.TFR.....KG..................
1ltxR  -----PSDFDVIVIGTGLPESIIAAACSRS......GQ...RVLHV.DSRSY....YGGNWA.SFS.....FS..................
1vg0A  -----PSDFDVIVIGTGLPESIIAAACSRS......GQ...RVLHV.DSRSY....YGGNWA.SFS.....FS..................
1jnrA  --PTEVVETDILIIGGGFSGCGAAYEAAYWaklg..GL...KVTLV.EKAAV....E-----.---.....--..................
2c76A  -----SNKCDVVVVGGGISGMAAAKLLHDS......GL...NVVVL.EARDR....VGGRTY.TLR.....NQ..................
2v5zA  -----SNKCDVVVVGGGISGMAAAKLLHDS......GL...NVVVL.EARDR....VGGRTY.TLR.....NQ..................
2bk5A  -----SNKCDVVVVGGGISGMAAAKLLHDS......GL...NVVVL.EARDR....VGGRTY.TLR.....NQ..................
2c73A  -----SNKCDVVVVGGGISGMAAAKLLHDS......GL...NVVVL.EARDR....VGGRTY.TLR.....NQ..................
2c75A  -----SNKCDVVVVGGGISGMAAAKLLHDS......GL...NVVVL.EARDR....VGGRTY.TLR.....NQ..................
2c72A  -----SNKCDVVVVGGGISGMAAAKLLHDS......GL...NVVVL.EARDR....VGGRTY.TLR.....NQ..................
1o5wA  --------FDVVVIGGGISGLAAAKLLSEY......KI...NVLVL.EARDR....VGGRTY.TVR.....NE..................
1nekA  ------REFDAVVIGAGGAGMRAALQISQS......GQ...TCALL.SK---....V-----.---.....--..................
1chuA  -----EHSCDVLIIGSGAAGLSLALRLADQ......-H...QVIVL.SKGPV....TEG---.---.....--..................
1cf3A  -------TVDYIIAGGGLTGLTTAARLTENp.....NI...SVLVI.ESGSY....E-----.---.....SDrgpiiedlnaygdifgss
1knrA  -----EHSCDVLIIGSGAAGLSLALRLADQ......-H...QVIVL.SKGPV....TEG---.---.....--..................
2b76A  -------QADLAIVGAGGAGLRAAIAAAQAnp....NA...KIALI.SK---....V-----.---.....--..................
1kf6A  -------QADLAIVGAGGAGLRAAIAAAQAnp....NA...KIALI.SK---....V-----.---.....--..................
3cirA  ----QTFQADLAIVGAGGAGLRAAIAAAQAnp....NA...KIALI.SK---....V-----.---.....--..................
1ebdA  ----------TLVVGAGPGGYVAAIRAAQL......GQ...KVTIV.EKGNL....G-----.---.....--..................
1gpeA  ----AGKTYDYIIAGGGLTGLTVAAKLTENp.....KI...KVLVI.EKGFY....------.---.....-Esndgaiiedpnaygqifg
3cpiG  ------TDYDVIVLGTGITECILSGLLSVD......GK...KVLHI.DKQDH....YGGEAA.SVT.....LSqlyekfkqnpiskeeres
2bcgG  ------TDYDVIVLGTGITECILSGLLSVD......GK...KVLHI.DKQDH....YGGEAA.SVT.....LSqlyekfkqnpiskeeres
1d4cA  ------ETTDVVIIGSGGAGLAAAVSARDA......GA...KVILL.EKEPI....PGGNTK.LAA.....GG..................
1d4dA  ------ETTDVVIIGSGGAGLAAAVSARDA......GA...KVILL.EKEPI....PGGNTK.LAA.....GG..................
1d5tA  -----DEEYDVIVLGTGLTECILSGIMSVN......GK...KVLHM.DRNPY....YGGESS.SITp....LEelykrfqllegppetm..
1gndA  -----DEEYDVIVLGTGLTECILSGIMSVN......GK...KVLHM.DRNPY....YGGESS.SITp....LEelykrfqllegppetm..
1lv0A  -----DEEYDVIVLGTGLTECILSGIMSVN......GK...KVLHM.DRNPY....YGGESS.SITp....LEelykrfqllegppetm..
1dxlA  ---------DVVIIGGGPGGYVAAIKAAQL......GF...KTTCI.EKRGA....LG----.---.....--..................
3c96A  ---------DILIAGAGIGGLSCALALHQA......GIg..KVTLL.ESSSE....I-----.--R.....PL..................
2i0zA  -------HYDVIVIGGGPSGLMAAIGAAEE......GA...NVLLL.DKGNK....LGRKLA.ISG.....GG..................
1lpfA  -------KFDVVVIGAGPGGYVAAIRAAQL......GL...KTACI.EK--Y....IG----.--KegkvaLG..................
1reoA  -------PKHVVVVGAGMSGLSAAYVLSGA......GH...QVTVL.EASER....AGGRVR.TYR.....ND..................
2gmhA  ---RFAEEADVVIVGAGPAGLSAATRLKQLaaqhekDL...RVCLV.EKAAH....IGAHTL.S--.....--..................
1qo8A  ----PSETTQVLVVGAGSAGFNASLAAKKA......GA...NVILV.DKAPF....SGGNSM.ISA.....GG..................
2gqfA  -----------IIIGAGAAGLFCAAQLAKL......GK...SVTVF.DNGKK....IGRKIL.MSG.....GG..................
1pj5A  ---------RIVIIGAGIVGTNLADELVTR......GWn..NITVL.DQGPL....N-----.--M.....PG..................
1b5qA  --------PRVIVVGAGMSGISAAKRLSEA......GIt..DLLIL.EATDH....IGGRMH.KTN.....FA..................
2iidA  -------PKHVVIVGAGMAGLSAAYVLAGA......GH...QVTVL.EASER....PGGRVR.TYR.....NE..................
2ivdA  ---------NVAVVGGGISGLAVAHHLRSR......GT...DAVLL.ESSAR....LGGAVG.THA.....LA..................
1q9iA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1jryA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1p2eA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1p2hA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1y0pA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1ksuA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1jrzA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1jrxA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1kssA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1v59A  ------KSHDVVIIGGGPAGYVAAIKAAQL......GF...NTACV.EKRGK....LG----.---.....--..................
2b7rA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
2b7sA  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
3ladA  -------KFDVIVIGAGPGGYVAAIKSAQL......GL...KTALI.EKYKG....K-----.--Egkta.LG..................
1m64A  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1lj1A  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
1e39A  ------DTVDVVVVGSGGAGFSAAISATDS......GA...KVILI.EKEPV....IGGNAK.LAA.....GG..................
2gjcA  KDLDKFAVSDVIIVGAGSSGLSAAYVIAKNrp....DL...KVCII.ESSVA....P-----.---.....--..................
1pn0A  --------CDVLIVGAGPAGLMAARVLSEYvrqkp.DL...KVRII.DKRST....K-----.---.....--..................
1ykjA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1pxbA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1k0iA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1dobA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1iutA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1pxcA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1pbeA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1cj2A  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER---....------.--R.....TP..................
1cc4A  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1bgnA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1fohA  --------CDVLIVGAGPAGLMAARVLSEYvrqkp.DL...KVRII.DKRST....K-----.---.....--..................
1pbdA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1pbfA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1cj3A  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER---....------.---.....--..................
1bgjA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1bf3A  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1cj4A  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-TT....P-----.---.....--..................
1bkwA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1pxaA  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1cc6A  -------KTQVAIIGAGPSGLLLGQLLHKA......GI...DNVIL.ER-QT....P-----.---.....--..................
1gesA  -----TKHYDYIAIGGGSGGIASINRAAMY......GQ...KCALI.EA-KE....LG----.---.....--..................
2bs3A  ---------DSLVIGGGLAGLRAAVATQQK......GL...STIVL.---SL....I-----.---.....--..................
1qlbA  ---------DSLVIGGGLAGLRAAVATQQK......GL...STIVL.---SL....I-----.---.....--..................
2bs2A  ---------DSLVIGGGLAGLRAAVATQQK......GL...STIVL.---SL....I-----.---.....--..................
1bhyA  -------EYDVVVLGGGPGGYSAAFAAADE......GL...KVAIV.ERYKT....LG----.---.....--..................
1ojtA  -------EYDVVVLGGGPGGYSAAFAAADE......GL...KVAIV.ERYKT....LG----.---.....--..................
1cjcA  ------------------------------......--...-----.-----....------.---.....--..................
1gerA  -----TKHYDYIAIGGGSGGIASINRAAMY......GQ...KCALI.EA-KE....LG----.---.....--..................
1lvlA  ---------TLLIIGGGPGGYVAAIRAGQL......GI...PTVLV.EG-QA....LG----.---.....--..................
1kdgA  -------PYDYIIVGAGPGGIIAADRLSEA......GK...KVLLL.ER-GG....P----S.TKQ.....TG..................
1naaA  --------YDYIIVGAGPGGIIAADRLSEA......GK...KVLLL.ER-GG....P----S.TKQ.....TG..................
1w4xA  ------------------------------......--...-----.-----....------.---.....--..................
1tdeA  ------KHSKLLILGSGPAGYTAAVYAARA......NL...QPVLI.TGMEK....GGQLTT.TTE.....VE..................
1cl0A  ------KHSKLLILGSGPAGYTAAVYAARA......NL...QPVLI.TGMEK....GGQLTT.TTE.....VE..................
1f6mA  ------KHSKLLILGSGPAGYTAAVYAARA......NL...QPVLI.TGMEK....GGQLTT.TTE.....VE..................
1typA  -----SRAYDLVVIGAGSGGLEAGWNAASL......HKk..RVAVI.DLQKH....HG-PPH.YAA.....LG..................
1tytA  -----SRAYDLVVIGAGSGGLEAGWNAASL......HKk..RVAVI.DLQKH....HG-PPH.YAA.....LG..................
1fecA  --------YDLVVIGAGSGGLEAGWNAASL......HKk..RVAVI.DLQKH....HG-PPH.YAA.....LG..................
2tprA  --------YDLVVIGAGSGGLEAGWNAASL......HKk..RVAVI.DLQKH....HG-PPH.YAA.....LG..................
1ju2A  TDLELEGSYDYVIVGGGTSGCPLAATLSEK......-Y...KVLVL.ERGSL....P-----.--Ta....YP..................
1tdfA  ------KHSKLLILGSGPAGYTAAVYAARA......NL...QPVLI.TGMEK....GGQLTT.TTE.....VE..................
1trbA  ------KHSKLLILGSGPAGYTAAVYAARA......NL...QPVLI.TGMEK....GGQLTT.TTE.....VE..................
1gxfA  -----SKIFDLVVIGAGSGGLEAAWNAATLy.....KK...RVAVI.DVQMV....HG-PPF.FSA.....LG..................
1bzlA  -----SKIFDLVVIGAGSGGLEAAWNAATLy.....KK...RVAVI.DVQMV....HG-PPF.FSA.....LG..................
1ndaA  -----SKIFDLVVIGAGSGGLEAAWNAATLy.....KK...RVAVI.DVQMV....HG-PPF.FSA.....LG..................
1aogA  --------FDLVVIGAGSGGLEAAWNAATLy.....KK...RVAVI.DVQMV....HG-PPF.FSA.....LG..................
1onfA  --------YDLIVIGGGSGGMAAARRAARH......NA...KVALV.EK-SR....LG----.---.....--..................
1xanA  --------YDYLVIGGGSGGLASARRAAEL......GA...RAAVV.ES-HK....LG----.---.....--..................
3grsA  --------YDYLVIGGGSGGLASARRAAEL......GA...RAAVV.ES-HK....LG----.---.....--..................
1fl2A  --------YDVLIVGSGPAGAAAAIYSARK......GI...RTGLM.--GER....FGGQILdTVD.....IE..................
1l9cA  -------HFDVIVVGAGSMGMAAGYQLAKQ......GV...KTLLV.DAFDP....P-----.--H.....TN..................
2gf3A  -------HFDVIVVGAGSMGMAAGYQLAKQ......GV...KTLLV.DAFDP....P-----.--H.....TN..................
3bhkA  -------HFDVIVVGAGSMGMAAGYQLAKQ......GV...KTLLV.DAFDP....P-----.---.....--..................
3grtA  --------YDYLVIGGGSGGLESAWRAAEL......GA...RAAVV.ES-HK....LG----.---.....--..................
1grtA  --------YDYLVIGGGSGGLESAWRAAEL......GA...RAAVV.ES-HK....LG----.---.....--..................
1hyuA  ------DAYDVLIVGSGPAGAAAAVYSARK......GI...RTGLM.--GER....FGGQVLdTVD.....IE..................
1w4xA  ---------DVLVVGAGFSGLYALYRLREL......GR...SVHVI.ETAGD....VGGVWY.WNR.....YP..................
1sezA  --------KRVAVIGAGVSGLAAAYKLKIH......GL...NVTVF.EAEGK....AGGKLR.SVS.....QD..................
1h6vA  -------DFDLIIIGGGSGGLAAAKEAAKF......DK...KVMVL.DF-VT....PTPLGT.NWG.....LG..................
1rp0A  TDMITYAETDVVVVGAGSAGLSAAYEISKNp.....NV...QVAII.EQSVS....P-----.---.....--..................
2f5vA  -----DIKYDVVIVGSGPIGCTYARELVGA......GY...KVAMF.DIGEI....------.--D.....SGlkigahkkntveyqknid
2f6cA  -----DIKYDVVIVGSGPIGCTYARELVGA......GY...KVAMF.DIGEI....------.--D.....SGlkigahkkntveyqknid
1tzlA  -----DIKYDVVIVGSGPIGCTYARELVGA......GY...KVAMF.DIGEI....------.--D.....SGlkigahkkntveyqknid
2gv8A  --------RKIAIIGAGPSGLVTAKALLAE......KAfd.QVTLF.ERRGS....PGGVWN.YTS.....TLsnklpvpstnpilttepi
1vqwA  --------RKIAIIGAGPSGLVTAKALLAE......KAfd.QVTLF.ERRGS....PGGVWN.YTS.....TLsnklpvpstnpilttepi
2ignA  -----DIKYDVVIVGSGPIGCTYARELVGA......GY...KVAMF.DIG-E....I-----.--D.....SGlkigahkkntveyqknid
1vdcA  ------HNTRLCIVGSGPAAHTAAIYAARA......EL...KPLLF.EGWMAndiaPGGQLT.TTTd....VE..................
1ng4A  -------HYEAVVIGGGIIGSAIAYYLAKE......NK...NTALF.ES-GT....MGGRTT.SAA.....AG..................
1ryiA  -------HYEAVVIGGGIIGSAIAYYLAKE......NK...NTALF.ES-GT....MGGRTT.SAA.....AG..................
1xdiA  ---------RIVILGGGPAGYEAALVAATS......HPettQVTVI.DC-DG....IGGAAV.LDDc....VPsktfiastglrtelrrap
2vouA  ---------RIAVVGGSISGLTAALMLRDA......GV...DVDVY.ERSPQ....P-----.---.....--..................
1xhcA  --------SKVVIVGNGPGGFELAKQLSQT......-Y...EVTVI.DKEPV....P-----.--Yy....SK..................
1b8sA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
1n4wA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
3cnjA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
1q1rA  ----------VVIVGTGLAGVEVAFGLRAS......GWeg.NIRLV.GDATV....I-----.---.....--..................
1f8wA  ---------KVIVLGSSHGGYEAVEELLNLhp....DA...EIQWY.EKGDF....I-----.--S.....FL..................
1nhqA  ------------------------------......--...-----.-----....------.---.....--..................
1nhrA  ------------------------------......--...-----.-----....------.---.....--..................
1ijhA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
3b6dA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
1cc2A  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
3b3rA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
1npxA  ---------KVIVLGSSHGGYEAVEELLNLhp....DA...EIQWY.EKGDF....I-----.--S.....FL..................
1cboA  -----------VVIGTGYGAAVSALRLGEA......GV...QTLML.EMGQL....W-----.--N.....QPgpdgnifcgmlnpdkrss
1nhsA  ---------KVIVLGSSHGGYEAVEELLNLhp....DA...EIQWY.EKGDF....I-----.--S.....FL..................
1nhpA  ---------KVIVLGSSHGGYEAVEELLNLhp....DA...EIQWY.EKGDF....I-----.---.....--..................
1mo9A  -------EYDAIFIGGGAAGRFGSAYLRAM......GG...RQLIV.DRWPF....LG----.---.....--..................
1fcdA  ------------------------------......--...KVIIL.DSSQT....------.---.....--..................
1m6iA  ----------FLLIGGGTAAFAAARSIRARdp....GA...RVLIV.SEDPE....L-----.--Pym...RPplskelwfsddpnvtk..
1gv4A  ----------FLLIGGGTAAFAAARSIRARdp....GA...RVLIV.SEDPE....L-----.--Pym...RPplskelwfsddpnvtk..
3coxA  ---------PALVIGSGYGGAVAALRLTQA......GI...PTQIV.EMGRS....W-----.--D.....TPgsdgkifcgmlnpdkrsm
1d7yA  ---------PVVVLGAGLASVSFVAELRQA......GYqg.LITVVgDEAER....------.--P.....YD..................
1d7yA  ------------------------------......--...-----.-----....------.---.....--..................
1fcdA  ---------KVVVVGGGTGGATAAKYIKLAdp....SI...EVTLI.EPNTD....Y-----.---.....--..................
1ps9A  ------------------------------......--...-----.-----....------.---.....--..................
1djnA  ------------------------------......--...-----.-----....------.---.....--..................
1djqA  ------------------------------......--...-----.-----....------.---.....--..................
2culA  --------YQVLIVGAGFSGAETAFWLAQK......GV...RVGLL.TQ---....------.---.....--..................
1gv4A  ------------------------------......--...-----.-----....------.---.....--..................
1m6iA  ------------------------------......--...-----.-----....------.---.....--..................
1nhrA  ------------------------------......--...-----.-----....------.---.....--..................
1nhqA  ------------------------------......--...-----.-----....------.---.....--..................
2gv8A  ------------------------------......--...-----.-----....------.---.....--..................
1vqwA  ------------------------------......--...-----.-----....------.---.....--..................
1gndA  ------------------------------......--...-----.-----....------.---.....--..................
1lv0A  ------------------------------......--...-----.-----....------.---.....--..................
1d5tA  ------------------------------......--...-----.-----....------.---.....--..................
3cpiG  ------------------------------......--...-----.-----....------.---.....--..................
2bcgG  ------------------------------......--...-----.-----....------.---.....--..................
1fcdA  ------------------------------......--...-----.-----....------.---.....--..................


                                                                        80            90            
                                                                         |             |            
d1f8ra1  ............................................................EAGWYAN....LGPMRLPEK........HRI
2dw4A  ............................................................--NYVAD....LGAMVVTGL........GGN
2h94A  ............................................................--NYVAD....LGAMVVTGL........GGN
2iw5A  ............................................................--NYVAD....LGAMVVTGL........GGN
2z3yA  ............................................................--NYVAD....LGAMVVTGL........GGN
1ltxR  ............................................................--GLL--....---------........---
1vg0A  ............................................................--GLL--....---------........---
1jnrA  ............................................................-RSGAVA....QGLSAINTY........IDL
2c76A  ............................................................-KVKYVD....LGGSYVGPT........QNR
2v5zA  ............................................................-KVKYVD....LGGSYVGPT........QNR
2bk5A  ............................................................-KVKYVD....LGGSYVGPT........QNR
2c73A  ............................................................-KVKYVD....LGGSYVGPT........QNR
2c75A  ............................................................-KVKYVD....LGGSYVGPT........QNR
2c72A  ............................................................-KVKYVD....LGGSYVGPT........QNR
1o5wA  ............................................................-HVKWVD....VGGAYVGPT........QNR
1nekA  ............................................................-------....--------F........PTR
1chuA  ............................................................--STFYA....QGGIAAV--........---
1cf3A  ....................................vdhayetvelatnnqtalirsgngLGGSTLV....NGGTWTRPH........KAQ
1knrA  ............................................................--STFYA....QGGIAAV--........---
2b76A  ............................................................-------....--------Y........PMR
1kf6A  ............................................................-------....--------Y........PMR
3cirA  ............................................................-------....--------Y........PMR
1ebdA  ............................................................--GVCLN....VGCIPSKALisa.....SHR
1gpeA  ........ttvdqnyltvplinnrtnnikagkglggstlingdswtrpdkvqidswekvfGMEGW--....--------N........WDN
3cpiG  ....kfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiykvpA------....---------........---
2bcgG  ....kfgkdrdwnvdlipkflmangeltnilihtdvtryvdfkqvsgsyvfkqgkiykvpA------....---------........---
1d4cA  ............................................................-------....--------M........NAA
1d4dA  ............................................................-------....--------M........NAA
1d5tA  ............................................................GRGRDWN....VDLIPKFLMa.......NGQ
1gndA  ............................................................GRGRDWN....VDLIPKFLMa.......NGQ
1lv0A  ............................................................GRGRDWN....VDLIPKFLMa.......NGQ
1dxlA  ............................................................--GTCLN....VGCIPSKALlhsshm..YHE
3c96A  ............................................................GVGIN--....--------I........QPA
2i0zA  ............................................................RCNVT--....--------N........RLP
1lpfA  ............................................................--GTCLN....VGCIPSKALldssyk..YHE
1reoA  ............................................................KEDWYAN....LGPMRLPEK........HRI
2gmhA  ............................................................--GAC--....--------Ld.......PRA
1qo8A  ............................................................-------....--------M........NAV
2gqfA  ............................................................FCNFTNLev..TPAHYLSQN........PHF
1pj5A  ............................................................--GSTSH....APGLVFQTN........PSK
1b5qA  ............................................................--GINVE....LGANWVEGVnggk....MNP
2iidA  ............................................................EAGWYAN....LGPMRLPEK........HRI
2ivdA  ............................................................--GYLVE....QGPNSFLDR........EPA
1q9iA  ............................................................-------....--------M........NAA
1jryA  ............................................................-------....--------M........NAA
1p2eA  ............................................................-------....--------M........NAA
1p2hA  ............................................................-------....--------M........NAA
1y0pA  ............................................................-------....--------M........NAA
1ksuA  ............................................................-------....--------M........NAA
1jrzA  ............................................................-------....--------M........NAA
1jrxA  ............................................................-------....--------M........NAA
1kssA  ............................................................-------....--------M........NAA
1v59A  ............................................................--GTCLN....VGCIPSKALlnnshl..FHQ
2b7rA  ............................................................-------....--------M........NAA
2b7sA  ............................................................-------....--------M........NAA
3ladA  ............................................................--GTCLN....VGCIPSKALldssyk..FHE
1m64A  ............................................................-------....--------M........NAA
1lj1A  ............................................................-------....--------M........NAA
1e39A  ............................................................-------....--------M........NAA
2gjcA  ............................................................--GGGSW....LGGQLFSAMvm......RKP
1pn0A  ............................................................VYNGQAD....G-------L........QCR
1ykjA  ............................................................--DYV--....LGRIRGGVL........EQG
1pxbA  ............................................................--DYV--....LGRIRAGVL........EQG
1k0iA  ............................................................--DYV--....LGRIRAGVL........EQG
1dobA  ............................................................--DYV--....LGRIRAGVL........EQG
1iutA  ............................................................--DYV--....LGRIRAGVL........EQG
1pxcA  ............................................................--DYV--....LGRIRAGVL........EQG
1pbeA  ............................................................--DYV--....LGRIRAGVL........EQG
1cj2A  ............................................................--DYV--....LGRIRAGVL........EQG
1cc4A  ............................................................--DYV--....LGRIRAGVL........EQG
1bgnA  ............................................................--DYV--....LGRIRAGVL........EQG
1fohA  ............................................................VYNGQAD....G-------L........QCR
1pbdA  ............................................................--DYV--....LGRIRAGVL........EQG
1pbfA  ............................................................--DYV--....LGRIRAGVL........EQG
1cj3A  ............................................................--QTPDE....VLGRIRAGVl.......EQG
1bgjA  ............................................................--DYV--....LGRIRAGVL........EQG
1bf3A  ............................................................--DYV--....LGKIRAGVL........EQG
1cj4A  ............................................................--DYV--....LGRIRAGVL........EQG
1bkwA  ............................................................--DYV--....LGRIKAGVL........EQG
1pxaA  ............................................................--DYV--....LGRIRAGVL........EQG
1cc6A  ............................................................--DYV--....LGRIRAGVL........EQG
1gesA  ............................................................--GTCVN....VGCVPKKVMwh......AAQ
2bs3A  ............................................................-------....--------P........VKR
1qlbA  ............................................................-------....--------P........VKR
2bs2A  ............................................................-------....--------P........VKR
1bhyA  ............................................................--GVCLN....VGCIPSKALlh......NA-
1ojtA  ............................................................--GVCLN....VGCIPSKALlh......NA-
1cjcA  ............................................................-------....---------........---
1gerA  ............................................................--GTCVN....VGCVPKKVMwh......AAQ
1lvlA  ............................................................--GTCLN....IGCIPSKAL........IHV
1kdgA  ............................................................--GTYVA....PWATSSGLTkfdi....PGL
1naaA  ............................................................--GTYVA....PWATSSGLTkfdi....PGL
1w4xA  ............................................................-------....---------........---
1tdeA  ............................................................--NWPGD....PNDLTGPLL........MER
1cl0A  ............................................................--NWPGD....PNDLTGPLL........MER
1f6mA  ............................................................--NWPGD....PNDLTGPLL........MER
1typA  ............................................................--GTCVN....VGCVPKKLMvtgan...YMD
1tytA  ............................................................--GTCVN....VGCVPKKLMvtgan...YMD
1fecA  ............................................................--GTCVN....VGCVPKKLMvtgan...YMD
2tprA  ............................................................--GTCVN....VGCVPKKLMvtgan...YMD
1ju2A  ............................................................--NVLTA....DGFVYNLQQeddg....KTP
1tdfA  ............................................................--NWPGD....PNDLTGPLL........MER
1trbA  ............................................................--NWPGD....PNDLTGPLL........MER
1gxfA  ............................................................--GTCVN....VGCVPKKLMvtgaq...YME
1bzlA  ............................................................--GTCVN....VGCVPKKLMvtgaq...YME
1ndaA  ............................................................--GTCVN....VGCVPKKLMvtgaq...YME
1aogA  ............................................................--GTCVN....VGCVPKKLMvtgaq...YME
1onfA  ............................................................--GTCVN....VGCVPKKIMfn......AAS
1xanA  ............................................................--GTCVN....VGCVPKKVMwntav...HSE
3grsA  ............................................................--GTCVN....VGCVPKKVMwntav...HSE
1fl2A  ............................................................--NYI--....--------Svp......KTE
1l9cA  ............................................................--GSHHG....DTRIIRHAYgeg.....REY
2gf3A  ............................................................--GSHHG....DTRIIRHAYgeg.....REY
3bhkA  ............................................................HTNGSHHg...DTKIIRHAYgeg.....REY
3grtA  ............................................................--GTCVN....VGCVPKKVMwntav...HSE
1grtA  ............................................................--GTCVN....VGCVPKKVMwntav...HSE
1hyuA  ............................................................--NYI--....--------Svp......KTE
1w4xA  ............................................................--GARCD....IESIEYCYSfseevlqeWNW
1sezA  ............................................................--GLIWD....EGANTMTES........EGD
1h6vA  ............................................................--GTCVN....VGCIPKKLM........HQA
1rp0A  ............................................................--GGGAW....LGGQLFSAMiv......RKP
2f5vA  ........kfvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsGQAVTRV....VGGMSTHWTcatprfdrEQR
2f6cA  ........kfvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsGQAVTRV....VGGMSTHWTcatprfdrEQR
1tzlA  ........kfvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsGQAVTRV....VGGMSTHWTcatprfdrEQR
2gv8A  ...........................................vgpaalpvypsplyrdlQTNTPIE....LMGYCDQSF........KPQ
1vqwA  ...........................................vgpaalpvypsplyrdlQTNTPIE....LMGYCDQSF........KPQ
2ignA  kfvnviqgqlmsvsvpvntlvvdtlsptswqastffvrngsnpeqdplrnlsgqavtrvvGGMSTAW....TCATPRFDR........EQR
1vdcA  ............................................................--NFPGF....PEGILGVEL........TDK
1ng4A  ............................................................MLGAHAEc...EERDAFFDF........AMH
1ryiA  ............................................................MLGAHAEc...EERDAFFDF........AMH
1xdiA  ..........................................................hlGFHIDFD....DAKISLPQI........HAR
2vouA  ............................................................LSGFGTG....--------Ivv......QPE
1xhcA  ............................................................PMLSHYI....AGFIPRNRL........FPY
1b8sA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
1n4wA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
3cnjA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
1q1rA  ............................................................-------....----PHH-L........PPL
1f8wA  ............................................................SCGM---....---------........QLY
1nhqA  ............................................................-------....---------........---
1nhrA  ............................................................-------....---------........---
1ijhA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
3b6dA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
1cc2A  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
3b3rA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
1npxA  ............................................................SCGM---....---------........QLY
1cboA  ...............wfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgVGGGSLV....NGGMAVEPK........RSY
1nhsA  ............................................................CCG----....--------M........QLY
1nhpA  ............................................................--SFLSA....G-------M........QLY
1mo9A  ............................................................--GSCPH....NACVPHHLF........SDC
1fcdA  ............................................................-------....---------........---
1m6iA  ............................................................TLRFKQW....NGKERSIYF........QPP
1gv4A  ............................................................TLQFRQW....NGKERSIYF........QPP
3coxA  ................wladktdqpvsnfmgfginksidryvgvldserfsgikvyqgrgVGGGSLV....NGGMAVTPK........RNY
1d7yA  ............................................................-------....--------R........PPL
1d7yA  ............................................................-------....---------........---
1fcdA  ............................................................--YTCYLsnevIGGDRKLES........IKH
1ps9A  ............................................................-------....---------........---
1djnA  ............................................................-------....---------........---
1djqA  ............................................................-------....---------........---
2culA  ............................................................----SLD....AVMMPFLPPkp......PFP
1gv4A  ............................................................-------....---------........---
1m6iA  ............................................................-------....---------........---
1nhrA  ............................................................-------....---------........---
1nhqA  ............................................................-------....---------........---
2gv8A  ............................................................-------....---------........---
1vqwA  ............................................................-------....---------........---
1gndA  ............................................................-------....T--------........---
1lv0A  ............................................................-------....T--------........---
1d5tA  ............................................................------E....---------........---
3cpiG  ............................................................-------....---------........---
2bcgG  ............................................................-------....---------........---
1fcdA  ............................................................-------....---------........---


                      100                                  110       120       130                  
                        |                                    |         |         |                  
d1f8ra1  VR.....EY..I...RK......F.DLR.................LNE...FSQENDNAWYFIKNIRKKVGEV..................
2dw4A  PM.....AV..V...SK......Q.-VN.................MEL...AKIKQKCPLYEANGQAVPKEKDemveqefnrlleatsyls
2h94A  PM.....AV..V...SK......Q.-VN.................MEL...AKIKQKCPLYEANGQAVPKEKDemveqefnrlleatsyls
2iw5A  PM.....AV..V...SK......Q.-VN.................MEL...AKIKQKCPLYEANGQAVPKEKDemveqefnrlleatsyls
2z3yA  PM.....AV..V...SK......Q.-VN.................MEL...AKIKQKCPLYEANGQAVPKEKDemveqefnrlleatsyls
1ltxR  --.....--..-...--......-.---.................---...----------------------..................
1vg0A  --.....--..-...--......-.---.................---...----------------------..................
1jnrA  T-.....--..-...--......-.---.................---...-------------GRSERQNTL..................
2c76A  IL.....RL..A...KE......L.GLE.................-TY...KVNEVERLIHHVKGKSYPFRGP..................
2v5zA  IL.....RL..A...KE......L.GLE.................-TY...KVNEVERLIHHVKGKSYPFRGP..................
2bk5A  IL.....RL..A...KE......L.GLE.................-TY...KVNEVERLIHHVKGKSYPFRGP..................
2c73A  IL.....RL..A...KE......L.GLE.................-TY...KVNEVERLIHHVKGKSYPFRGP..................
2c75A  IL.....RL..A...KE......L.GLE.................-TY...KVNEVERLIHHVKGKSYPFRGP..................
2c72A  IL.....RL..A...KE......L.GLE.................-TY...KVNEVERLIHHVKGKSYPFRGP..................
1o5wA  IL.....RL..S...KE......L.GIE.................-TY...KVNVNERLVQYVKGKTYPFRGA..................
1nekA  SH.....TV..S...AQ......G.GIT.................VAL...GNTHEDNWEWHMYDTVKGSDYI..................
1chuA  --.....--..F...DE......T.DSId................SHV...EDTLIAGAGICDRHAVEFVASN..................
1cf3A  VD.....SW..E...TV......F.GNE.................---...GWNWDNVAAYSLQAERARAPNA..................
1knrA  --.....--..F...DE......T.DSId................SHV...EDTLIAGAGICDRHAVEFVASN..................
2b76A  SH.....TV..A...AQ......G.GSA.................--A...VAQDHDSFEYHFHDTVAGGDWL..................
1kf6A  SH.....TV..A...AE......G.GSA.................--A...VAQDHDSFEYHFHDTVAGGDWL..................
3cirA  SH.....TV..A...AE......G.GSA.................--A...VAQDHDSFEYHFHDTVAGGDWL..................
1ebdA  YEqa...KH..S...EE......M.GIK.................AEN...VTIDFAKVQEWKASVVKKLTGG..................
1gpeA  MF.....EY..M...KK......A.EAA.................---...----------------------..................
3cpiG  --.....--..-...--......-.---.................---...---------------------Neieaissplmgifekrrm
2bcgG  --.....--..-...--......-.---.................---...---------------------Neieaissplmgifekrrm
1d4cA  ET.....KP..Q...AK......L.GIEdk...............KQ-...---------IMIDDTMKGGRNI..................
1d4dA  ET.....KP..Q...AK......L.GIEdk...............KQ-...---------IMIDDTMKGGRNI..................
1d5tA  LV.....KM..L...LY......T.EVT.................RYL...DFKVVEGSFVYKGGKIYKVPST..................
1gndA  LV.....KM..L...LY......T.EVT.................RYL...DFKVVEGSFVYKGGKIYKVPST..................
1lv0A  LV.....KM..L...LY......T.EVT.................RYL...DFKVVEGSFVYKGGKIYKVPST..................
1dxlA  AK.....HS..F...AN......H.GVK.................VSN...VEIDLAAMMGQKDKAVSNLTRG..................
3c96A  AV.....EA..L...AE......L.GLG.................PAL...AATAIPTHEL------------..................
2i0zA  LD.....EI..V...KH......I.PGN.................---...GRFLYSAFSIFNNED-------..................
1lpfA  AK.....EA..F...KV......H.GIE.................AKG...VTIDVPAMVARKANIVKNLTGG..................
1reoA  VR.....EY..I...RK......F.GLQ.................LNE...FSQENDNAWYFIKNIRKRVGEV..................
2gmhA  FE.....EL..F...PD......W.KEKgap..............LNT...----------------------..................
1qo8A  GT.....KQ..Q...TA......H.GVEdk...............VEW...FIEDAMKGGRQQND--------..................
2gqfA  VK.....SA..L...AR......Y.TNW.................DFI...----------------------..................
1pj5A  TM.....AS..F...AK......Y.TVE.................KLLs..LTEDGVSCFNQVGGLE------..................
1b5qA  IW.....PI..V...NS......TlKLRn................FRS...DFDYLAQNVYKEDGGVYDEDYV..................
2iidA  VR.....EY..I...RK......F.DLR.................LNE...FSQENDNAWYFIKNIRKKVGEV..................
2ivdA  TR.....AL..A...AA......L.NLEgr...............IRA...ADPAAKRRYVYTRGRLRSVPAS..................
1q9iA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1jryA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1p2eA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1p2hA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1y0pA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1ksuA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1jrzA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1jrxA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1kssA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1v59A  MH.....TE..A...QK......R.GIDvngdikinvanfqkakdDAV...KQLTGGIELLFKKNKVTYYKGN..................
2b7rA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
2b7sA  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
3ladA  AH.....ES..F...KL......H.GIS.................TGE...VAIDVPTMIARKDQIVRNLTGG..................
1m64A  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1lj1A  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
1e39A  WT.....DQ..Q...KA......K.KITds...............PEL...MFEDTMKGGQNIND--------..................
2gjcA  AH.....LF..L...QE......L.EIPy................EDE...----------------------..................
1pn0A  TL.....ES..L...KN......L.GLA.................DKI...LSEANDMSTIALYNPDENGHIR..................
1ykjA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1pxbA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1k0iA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1dobA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1iutA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1pxcA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1pbeA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1cj2A  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1cc4A  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1bgnA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1fohA  TL.....ES..L...KN......L.GLA.................DKI...LSEANDMSTIALYNPDENGHIR..................
1pbdA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1pbfA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1cj3A  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1bgjA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1bf3A  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1cj4A  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1bkwA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1pxaA  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1cc6A  MV.....DL..L...RE......A.GVD.................RRM...----------------------..................
1gesA  IR.....EA..I...HM......Y.GPDygfd.............TTI...NKFNWETLIASRTAYIDRIHTS..................
2bs3A  SH.....SA..A...AQ......G.GMQ.................ASLgnsKMSDGDNEDLHFMDTVKGSDWG..................
1qlbA  SH.....SA..A...AQ......G.GMQ.................ASLgnsKMSDGDNEDLHFMDTVKGSDWG..................
2bs2A  SH.....SA..A...AQ......G.GMQ.................ASLgnsKMSDGDNEDLHFMDTVKGSDWG..................
1bhyA  -AvidevRH..L...AA......N.GIK.................YPE...PELDIDMLRAYKDGVVSRLTGG..................
1ojtA  -AvidevRH..L...AA......N.GIK.................YPE...PELDIDMLRAYKDGVVSRLTGG..................
1cjcA  --.....--..-...--......-.---.................---...----------------------..................
1gerA  IR.....EA..I...HM......Y.GPDygfd.............TTI...NKFNWETLIASRTAYIDRIHTS..................
1lvlA  AE.....QFhqA...SRftepspL.GIS.................VAS...PRLDIGQSVAWKDGIVDRLTTG..................
1kdgA  FE.....SL..F...TD......S.NPFwwckd............ITV...FAGCLVGGGTSVNGALYWYPND..................
1naaA  FE.....SL..F...TD......S.NPFwwckd............ITV...FAGCLVGGGTSVNGALYWYPND..................
1w4xA  --.....--..-...--......-.---.................---...----------------------..................
1tdeA  MH.....EH..A...TK......F.ETE.................IIF...-------------DHINKVDLQ..................
1cl0A  MH.....EH..A...TK......F.ETE.................IIF...-------------DHINKVDLQ..................
1f6mA  MH.....EH..A...TK......F.ETE.................IIF...-------------DHINKVDLQ..................
1typA  TI.....RE..S...AG......F.GWEl................DRE...SVRPNWKALIAAKNKAVSGINDs.................
1tytA  TI.....RE..S...AG......F.GWEl................DRE...SVRPNWKALIAAKNKAVSGINDs.................
1fecA  TI.....RE..S...AG......F.GWEl................DRE...SVRPNWKALIAAKNKAVSGINDs.................
2tprA  TI.....RE..S...AG......F.GWEl................DRE...SVRPNWKALIAAKNKAVSGINDs.................
1ju2A  VE.....RF..V...SE......D.GIDnvrgrv...........LGG...TSIINAGVYARANTSIYSASGV..................
1tdfA  MH.....EH..A...TK......F.ETE.................IIF...-------------DHINKVDLQ..................
1trbA  MH.....EH..A...TK......F.ETE.................IIF...-------------DHINKVDLQ..................
1gxfA  HL.....RE..S...AG......F.GWEfd...............RTT...LRAEWKNLIAVKDEAVLNINKS..................
1bzlA  HL.....RE..S...AG......F.GWEfd...............RTT...LRAEWKNLIAVKDEAVLNINKS..................
1ndaA  HL.....RE..S...AG......F.GWEfd...............RTT...LRAEWKKLIAVKDEAVLNINKS..................
1aogA  HL.....RE..S...AG......F.GWEfd...............RTT...LRAEWKNLIAVKDEAVLNINKS..................
1onfA  VH.....DI..LensRH......Y.GFD.................-TK...FSFNLPLLVERRDKYIQRLNNI..................
1xanA  FM.....HD..H...AD......Y.GFP.................SCE...----GKFNWRVIKEKRDAYVSR..................
3grsA  FM.....HD..H...AD......Y.GFP.................SCE...----GKFNWRVIKEKRDAYVSR..................
1fl2A  GQ.....KL..A...GA......L.KVH.................--V...DEYDVDVIDSQSASKLIPAAVE..................
1l9cA  VP.....LA..L...RS......Q.ELW.................YEL...EKETHHKIFTKTGVLVFGPKGE..................
2gf3A  VP.....LA..L...RS......Q.ELW.................YEL...EKETHHKIFTKTGVLVFGPKGE..................
3bhkA  VP.....LA..L...RS......Q.ELW.................YEL...EKETHHKIFTKTGVLVFGPKGE..................
3grtA  FM.....HD..H...AD......Y.GFP.................SCE...----GKFNWRVIKEKRDAYVSR..................
1grtA  FM.....HD..H...AD......Y.GFP.................SCE...----GKFNWRVIKEKRDAYVSR..................
1hyuA  GQ.....KL..A...GA......L.--K.................AHV...SDYDVDVIDSQSASKLVPAATE..................
1w4xA  TE.....RY..A...SQ......P.EILryi..............NFV...ADKFDLRSGITFHTTVTAAAFD..................
1sezA  VT.....FL..I...DS......L.GLRe................KQQ...FPLSQNKRYIARNGTPVLLPSNpidliksnflstgsklqm
1h6vA  ALlgqalKD..S...RN......Y.GWKl................EDT...VKHDWEKMTESVQNHIGSLNWG..................
1rp0A  AH.....LF..L...DE......I.GVA.................YDE...Q---------------------..................
2f5vA  PL.....LV..K...DD......A.DAD.................DAE...WDRLYTKAESYFQTGTDQFKES..................
2f6cA  PL.....LV..K...DD......A.DAD.................DAE...WDRLYTKAESYFQTGTDQFKES..................
1tzlA  PL.....LV..K...DD......A.DAD.................DAE...WDRLYTKAESYFQTGTDQFKES..................
2gv8A  TL.....QF..P...HR......H.TIQe................YQR...IYAQPLLPFIKLATDVLDIEKK..................
1vqwA  TL.....QF..P...HR......H.TIQe................YQR...IYAQPLLPFIKLATDVLDIEKK..................
2ignA  PL.....LV..K...DD......A.DAD.................DAE...WDRLYTKAESYFQTGTDQFKES..................
1vdcA  FR.....KQ..S...ER......F.GTT.................---...----------IFTETVTKVDFS..................
1ng4A  SQ.....RL..Y...KG......L.GEE.................--L...YALSGVDIRQHNGGMFKLAFSE..................
1ryiA  SQ.....RL..Y...KG......L.GEE.................--L...YALSGVDIRQHNGGMFKLAFSE..................
1xdiA  VK.....TL..A...AA......Q.SAD.................ITA...QLLSMGVQVIAGRGELIDSTPG..................
2vouA  LV.....HY..L...LE......Q.GVElds..............ISV...PSSSMEYVDALTGERVGSVPAD..................
1xhcA  SL.....DW..Y...RK......R.GIE.................IRL...AEEAKLI--------------D..................
1b8sA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
1n4wA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
3cnjA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
1q1rA  SK.....AY..L...AG......K.ATAesly.............LRT...PDAYAAQNIQLLGGTQVTAINR..................
1f8wA  LE.....GK..V...KD......V.NSVry...............MTG...EKMESRGVNVFSNTEITAIQPK..................
1nhqA  --.....--..-...--......-.---.................---...----------------------..................
1nhrA  --.....--..-...--......-.---.................---...----------------------..................
1ijhA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
3b6dA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
1cc2A  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
3b3rA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
1npxA  LE.....GK..V...KD......V.NSVry...............MTG...EKMESRGVNVFSNTEITAIQPK..................
1cboA  FE.....EI..L...PR......V.DSSe................MYD...RYFPRANSMLRVNHIDTKWFED..................
1nhsA  LE.....GK..V...KD......V.NSVry...............MTG...EKMESRGVNVFSNTEITAIQPK..................
1nhpA  LE.....GK..V...KD......V.NSVry...............MTG...EKMESRGVNVFSNTEITAIQPK..................
1mo9A  AA.....EL..M...LA......R.TFS.................GQY...WFPDMTEKVVGIKEVVDLFRAG..................
1fcdA  --.....--..-...--......-.---.................---...----------------------..................
1m6iA  SF.....YVs.A...Q-......-.---.................-DL...PHIENGGVAVLTGKKVVQLDVR..................
1gv4A  SF.....YVs.A...QD......-.---.................--L...PNIENGGVAVLTGKKVVHLDVR..................
3coxA  FE.....EI..L...PS......V.DSN.................---...--EMYNKYFPRANTGLGVNNID..................
1d7yA  SK.....DF..M...AH......G.DAEk................IRL...DCKRAPEVEWLLGVTAQSFDPQ..................
1d7yA  --.....--..-...--......-.---.................---...----------------------..................
1fcdA  GY.....DG..L...RA......H.GIQ.................---...----------VVHDSATGIDPD..................
1ps9A  --.....--..-...--......-.---.................---...----------------------..................
1djnA  --.....--..-...--......-.---.................---...----------------------..................
1djqA  --.....--..-...--......-.---.................---...----------------------..................
2culA  PG.....SL..L...ER......A.YDPk................DER...----------------------..................
1gv4A  --.....--..-...--......-.---.................---...----------------------..................
1m6iA  --.....--..-...--......-.---.................---...----------------------..................
1nhrA  --.....--..-...--......-.---.................---...----------------------..................
1nhqA  --.....--..-...--......-.---.................---...----------------------..................
2gv8A  --.....--..-...--......-.---.................---...----------------------..................
1vqwA  --.....--..-...--......-.---.................---...----------------------..................
1gndA  --.....--..-...--......-.---.................---...----------------------..................
1lv0A  --.....--..-...--......-.---.................---...----------------------..................
1d5tA  --.....--..-...--......-.---.................---...----------------------..................
3cpiG  --.....--..-...--......-.---.................---...----------------------..................
2bcgG  --.....--..-...--......-.---.................---...----------------------..................
1fcdA  --.....--..-...--......-.---.................---...----------------------..................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpprditaeflvkskh
2h94A  hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpprditaeflvkskh
2iw5A  hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpprditaeflvkskh
2z3yA  hqldfnvlnnkpvslgqalevviqlqekhvkdeqiehwkkivktqeelkellnkmvnlkekikelhqqykeasevkpprditaeflvkskh
1ltxR  ...........................................................................................
1vg0A  ...........................................................................................
1jnrA  ...........................................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  ...........................................................................................
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  ...........................................................................................
3cpiG  kkflewissykeddlsthqgld.....................................................................
2bcgG  kkflewissykeddlsthqgld.....................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  llepilwknkklsqvsdshesv.....................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  ...........................................................................................
2f6cA  ...........................................................................................
1tzlA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  ...........................................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                     140                    150     
                                                                       |                      |     
d1f8ra1  ...................KKdpgllkypvkpseagksagqlyees.........L-----------............---.-------.
2dw4A  rdltalckeydelaetqgkL-..................................-----------E............---.-------.
2h94A  rdltalckeydelaetqgkL-..................................-----------E............---.-------.
2iw5A  rdltalckeydelaetqgkL-..................................-----------E............---.-------.
2z3yA  rdltalckeydelaetqgkL-..................................-----------E............---.-------.
1ltxR  ...................--..................................------------............---.-------.
1vg0A  ...................--..................................------------............---.-------.
1jnrA  ...................EDyv................................RYVTLDMMGLAR............EDL.V------.
2c76A  ...................FPpvwnpityldhnnf....................WRTMDDMGREIP............SDA.-------.
2v5zA  ...................FPpvwnpityldhnnf....................WRTMDDMGREIP............SDA.-------.
2bk5A  ...................FPpvwnpityldhnnf....................WRTMDDMGREIP............SDA.-------.
2c73A  ...................FPpvwnpityldhnnf....................WRTMDDMGREIP............SDA.-------.
2c75A  ...................FPpvwnpityldhnnf....................WRTMDDMGREIP............SDA.-------.
2c72A  ...................FPpvwnpityldhnnf....................WRTMDDMGREIP............SDA.-------.
1o5wA  ...................FPpvwnplayldynnl....................WRTMDEMGKEIP............VDA.-------.
1nekA  ...................GD..................................-QDAIEYMCKTG............PEA.I------.
1chuA  ...................ARscvqwlidq.........................GVLFDTHIQPNG............EES.-------.
1cf3A  ...................K-..................................------------............---.-------.
1knrA  ...................ARscvqwlidq.........................GVLFDTHIQPNG............EES.-------.
2b76A  ...................CE..................................QDVVDYFVHHCP............TEM.-------.
1kf6A  ...................CE..................................QDVVDYFVHHCP............TEM.-------.
3cirA  ...................CE..................................QDVVDYFVHHCP............TEM.-------.
1ebdA  ...................VEgllkgnkveivkgeayfvdantv...........RVVNGDSAQTYT............FKN.AIIATGS.
1gpeA  ...................--..................................------------............---.-------.
3cpiG  ...................L-..................................------------............---.-------.
2bcgG  ...................L-..................................------------............---.-------.
1d4cA  ...................ND..................................-PELVKVLANNS............SDS.I------.
1d4dA  ...................ND..................................-PELVKVLANNS............SDS.I------.
1d5tA  ...................ETeala..............................SNLMGMFEKRRF............RKF.LVFVANF.
1gndA  ...................ETeala..............................SNLMGMFEKRRF............RKF.LVFVANF.
1lv0A  ...................ETeala..............................SNLMGMFEKRRF............RKF.LVFVANF.
1dxlA  ...................IEglfkknkvtyvkgygkfvspseis..........VDTIEGENTVVK............GKH.IIIATGS.
3c96A  ...................--..................................------------............---.-------.
2i0zA  ...................--..................................------------............---.-------.
1lpfA  ...................IAtlfkangvtsfeghgkllankqve..........VTGLDGKTQVLE............AEN.VIIASGS.
1reoA  ...................KKdpgvlkypvkpseegksagqlyees.........L-----------............---.-------.
2gmhA  ...................--..................................-PVTEDRFGILT............EKY.-------.
1qo8A  ...................--..................................-IKLVTILAEQS............ADG.V------.
2gqfA  ...................--..................................------------............---.-------.
1pj5A  ...................--..................................VATTETRLADLK............RKL.-------.
1b5qA  ...................QK..................................RIELADSVEEMGeklsatlhasgrDDM.SILAMQRl
2iidA  ...................KKdpgllkypvkpseagksagqlyees.........L-----------............---.-------.
2ivdA  ...................PPafl...............................A----SDILPLG............ARL.RVAGELF.
1q9iA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1jryA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1p2eA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1p2hA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1y0pA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1ksuA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1jrzA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1jrxA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1kssA  ...................--..................................-PALVKVLSSHS............KDS.V------.
1v59A  ...................GSfedetkirvtpvdg....................LEGTVKEDHILD............VKN.IIVATGS.
2b7rA  ...................--..................................-PALVKVLSSHS............KDS.V------.
2b7sA  ...................--..................................-PALVKVLSSHS............KDS.V------.
3ladA  ...................VAslikangvtlfeghgkllagkkve..........VTAADGSSQVLD............TEN.VILASGS.
1m64A  ...................--..................................-PALVKVLSSHS............KDS.V------.
1lj1A  ...................--..................................-PALVKVLSSHS............KDS.V------.
1e39A  ...................--..................................-PALVKVLSSHS............KDS.V------.
2gjcA  ...................--..................................------------............---.-------.
1pn0A  ...................RT..................................DRIPDTLPGISR............YHQ.VVLHQGRi
1ykjA  ...................--..................................----ARDGLVHE............---.-------.
1pxbA  ...................--..................................----ARDGLVHE............---.-------.
1k0iA  ...................--..................................----ARDGLVHE............---.-------.
1dobA  ...................--..................................----ARDGLVHE............---.-------.
1iutA  ...................--..................................----ARDGLVHE............---.-------.
1pxcA  ...................--..................................----ARDGLVHE............---.-------.
1pbeA  ...................--..................................----ARDGLVHE............---.-------.
1cj2A  ...................--..................................----ARDGLVHE............---.-------.
1cc4A  ...................--..................................----ARDGLVHE............---.-------.
1bgnA  ...................--..................................----ARDGLVHE............---.-------.
1fohA  ...................RT..................................DRIPDTLPGISR............YHQ.VVLHQGRi
1pbdA  ...................--..................................----ARDGLVHE............---.-------.
1pbfA  ...................--..................................----ARDGLVHE............---.-------.
1cj3A  ...................--..................................----ARDGLVHE............---.-------.
1bgjA  ...................--..................................----ARDGLVHE............---.-------.
1bf3A  ...................--..................................----ARDGLVHE............---.-------.
1cj4A  ...................--..................................----ARDGLVHE............---.-------.
1bkwA  ...................--..................................----ARDGLVHE............---.-------.
1pxaA  ...................--..................................----ARDGLVHE............---.-------.
1cc6A  ...................--..................................----ARDGLVHE............---.-------.
1gesA  ...................YEnvlgknnvdvikgfarfvd...............AKTLEVNGETIT............ADH.ILIATGG.
2bs3A  ...................CD..................................-QKVARMFVNTA............PKA.I------.
1qlbA  ...................CD..................................-QKVARMFVNTA............PKA.I------.
2bs2A  ...................CD..................................-QKVARMFVNTA............PKA.I------.
1bhyA  ...................LAgmaksrkvdviqgdgqfldphhlevsltagdayeQAAPTGEKKIVA............FKN.CIIAAGS.
1ojtA  ...................LAgmaksrkvdviqgdgqfldphhlevsltagdayeQAAPTGEKKIVA............FKN.CIIAAGS.
1cjcA  ...................--..................................------------............---.-------.
1gerA  ...................YEnvlgknnvdvikgfarfvd...............AKTLEVNGETIT............ADH.ILIATGG.
1lvlA  ...................VAallkkhgvkvvhgwakvld...............GKQVEVDGQRIQ............CEH.LLLATGS.
1kdgA  ...................GDfsssvg............................WPSSWTNHAPYT............SKL.-------.
1naaA  ...................GDfsssvg............................WPSSWTNHAPYT............SKL.-------.
1w4xA  ...................--..................................------------............---.-------.
1tdeA  ...................NR..................................PFRLNGDNGEYT............CDA.LIIATGA.
1cl0A  ...................NR..................................PFRLNGDNGEYT............CDA.LIIATGA.
1f6mA  ...................NR..................................PFRLNGDNGEYT............CDA.LIIATGA.
1typA  ...................YEgmfadtegltfhqgwgalqdnhtvlvres.....ADPNSAVLETLD............TEY.ILLATGS.
1tytA  ...................YEgmfadtegltfhqgfgalqdnhtvlvres.....ADPNSAVLETLD............TEY.ILLATGS.
1fecA  ...................YEgmfadtegltfhqgfgalqdnhtvlvres.....ADPNSAVLETLD............TEY.ILLATGS.
2tprA  ...................YEgmfadtegltfhqgfgalqdnhtvlvres.....ADPNSAVLETLD............TEY.ILLATGS.
1ju2A  ...................DW..................................DMDLVNQTYEWV............EDT.IVYKPNSq
1tdfA  ...................NR..................................PFRLNGDNGEYT............CDA.LIIATGA.
1trbA  ...................NR..................................PFRLNGDNGEYT............CDA.LIIATGA.
1gxfA  ...................YDemfrdteglefflgwgslesknvvnvres.....ADPASAVKERLE............TEH.ILLASGS.
1bzlA  ...................YDemfrdteglefflgwgslesknvvnvres.....ADPASAVKERLE............TEH.ILLASGS.
1ndaA  ...................YEemfrdteglefflgwgslesknvvnvres.....ADPASAVKERLE............TEN.ILLASGS.
1aogA  ...................YDemfrdteglefflgwgslesknvvnvres.....ADPASAVKERLE............TEH.ILLASGS.
1onfA  ...................YRqnlskdkvdlyegtasflsenrilikgtkdnnn.KDNGPLNEEILE............GRN.ILIAVGN.
1xanA  ...................LNaiyqnnltkshieiirghaaftsdp.........KPTIEVSGKKYT............APH.ILIATGG.
3grsA  ...................LNaiyqnnltkshieiirghaaftsdp.........KPTIEVSGKKYT............APH.ILIATGG.
1fl2A  ...................GGl.................................HQIETASGAVLK............ARS.IIVATGA.
1l9cA  ...................SA..................................FVAE--------............---.-------.
2gf3A  ...................SA..................................FVAE--------............---.-------.
3bhkA  ...................SA..................................FVAE--------............---.-------.
3grtA  ...................LNaiyqnnltkshieiirghaaftsdp.........KPTIEVSGKKYT............APH.ILIATGG.
1grtA  ...................LNaiyqnnltkshieiirghaaftsdp.........KPTIEVSGKKYT............APH.ILIATGG.
1hyuA  ...................GGl.................................HQIETASGAVLK............ARS.IIIATGA.
1w4xA  ...................EAtnt...............................WTVDTNHGDRIR............ARY.LIMASGQl
1sezA  ...................S-..................................------------............---.-------.
1h6vA  ...................YRvalrekkvvyenaygkfigphkim..........ATNNKGKEKVYS............AER.FLIATGE.
1rp0A  ...................--..................................------------............---.-------.
2f5vA  ...................IR..................................HNLVLNKLAEEY............KGQ.-------.
2f6cA  ...................IR..................................HNLVLNKLAEEY............KGQ.-------.
1tzlA  ...................IR..................................HNLVLNKLAEEY............KGQ.-------.
2gv8A  ...................DGs.................................W-VVTYKGTKAGspiskdi.....FDA.VSICNGHy
1vqwA  ...................DGs.................................W-VVTYKGTKAGspiskdi.....FDA.VSICNGHy
2ignA  ...................IR..................................HNLVLNKLTEEY............KGQ.-------.
1vdcA  ...................SK..................................PFKLFTDSKAIL............ADA.VILAIGA.
1ng4A  ...................EDvlqlr.............................Q---MDDLDSV-............---.-------.
1ryiA  ...................EDvlqlr.............................Q---MDDLDSV-............---.-------.
1xdiA  ...................LArhrik.............................ATAADGSTSEHE............ADV.VLVATGA.
2vouA  ...................WR..................................------------............---.-------.
1xhcA  ...................RG..................................RKVVITEKGEVP............YDT.LVLATGA.
1b8sA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
1n4wA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
3cnjA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
1q1rA  ...................DR..................................QQVILSDGRALD............YDR.LVLATGG.
1f8wA  ...................EHqvtv..............................KDLVSGEERVEN............YDK.LIISPGA.
1nhqA  ...................--..................................------------............---.LIISPGA.
1nhrA  ...................--..................................------------............---.LIISPGA.
1ijhA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
3b6dA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
1cc2A  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
3b3rA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
1npxA  ...................EHqvtv..............................KDLVSGEERVEN............YDK.LIISPGA.
1cboA  ...................TE..................................WYKFARVSREQA............GKA.-GLGT--.
1nhsA  ...................EHqvtv..............................KDLVSGEERVEN............YDK.LIISPGA.
1nhpA  ...................EHqvtv..............................KDLVSGEERVEN............YDK.LIISPGA.
1mo9A  ...................RNgphgimnfqskeqlnleyilncpakvid......NHTVEAAGKVFK............AKN.LILAVGA.
1fcdA  ...................--..................................------------............---.-------.
1m6iA  ...................DN..................................-MVKLNDGSQIT............YEK.CLIATGG.
1gv4A  ...................GN..................................-MVKLNDGSQIT............FEK.CLIATGG.
3coxA  ...................QA..................................WFESTEWYKFAR............TGRkTAQRSGFt
1d7yA  ...................AH..................................-TVALSDGRTLP............YGT.LVLATGA.
1d7yA  ...................--..................................------------............---.-------.
1fcdA  ...................KK..................................-LVKTAGGAEFG............YDR.CVVAPGI.
1ps9A  ...................--..................................------------............---.-------.
1djnA  ...................--..................................------------............---.-------.
1djqA  ...................--..................................------------............---.-------.
2culA  ...................--..................................------------............---.-------.
1gv4A  ...................--..................................------------............---.-------.
1m6iA  ...................--..................................------------............---.-------.
1nhrA  ...................--..................................------------............---.-------.
1nhqA  ...................--..................................------------............---.-------.
2gv8A  ...................--..................................------------............---.-------.
1vqwA  ...................--..................................------------............---.-------.
1gndA  ...................--..................................------------............---.-------.
1lv0A  ...................--..................................------------............---.-------.
1d5tA  ...................--..................................------------............---.-------.
3cpiG  ...................--..................................-ESMTDDVKDIY............---.-------.
2bcgG  ...................--..................................-ESMTDDVKDIY............---.-------.
1fcdA  ...................--..................................------------............---.-------.


               160              170                   180       190         200                     
                 |                |                     |         |           |                     
d1f8ra1  .----G..KVVE.......ELKRTNCSYILNKYDT............YSTKEYLIKEG..DLSPGAVDMIGDLL.....NE..........
2dw4A  .-----..----.......----------------............-----------..--------EKLQEL.....EA..........
2h94A  .-----..----.......----------------............-----------..--------EKLQEL.....EA..........
2iw5A  .-----..----.......----------------............-----------..--------EKLQEL.....EA..........
2z3yA  .-----..----.......----------------............-----------..--------EKLQEL.....EA..........
1ltxR  .-----..----.......----------------............-----------..--------------.....--..........
1vg0A  .-----..----.......----------------............-----------..--------------.....--..........
1jnrA  .-----..----.......----------------............-----------..-------ADYARHV.....--..........
2c76A  .-PWKA..PLAEe......WDNMTMKELLDKLCWT............ESAKQL-----..-------ATLFVNL.....--..........
2v5zA  .-PWKA..PLAEe......WDNMTMKELLDKLCWT............ESAKQL-----..-------ATLFVNL.....--..........
2bk5A  .-PWKA..PLAEe......WDNMTMKELLDKLCWT............ESAKQL-----..-------ATLFVNL.....--..........
2c73A  .-PWKA..PLAEe......WDNMTMKELLDKLCWT............ESAKQL-----..-------ATLFVNL.....--..........
2c75A  .-PWKA..PLAEe......WDNMTMKELLDKLCWT............ESAKQL-----..-------ATLFVNL.....--..........
2c72A  .-PWKA..PLAEe......WDNMTMKELLDKLCWT............ESAKQL-----..-------ATLFVNL.....--..........
1o5wA  .-PWQA..RHAQe......WDKMTMKDLIDKICWT............KTA--------..----REFAYLFVNI.....--..........
1nekA  .-----..----.......----------------............-----------..--------LELEHM.....--..........
1chuA  .-----..----.......----------------............-----------..--------YHLTRE.....--..........
1cf3A  .-----..----.......----------------............-----------..--------QIAAGH.....--..........
1knrA  .-----..----.......----------------............-----------..--------YHLTRE.....--..........
2b76A  .-----..----.......----------------............-----------..--------TQLELW.....--..........
1kf6A  .-----..----.......----------------............-----------..--------TQLELW.....--..........
3cirA  .-----..----.......----------------............-----------..--------TQLELW.....--..........
1ebdA  .RPIEL..PNFK.......-FSNRILDSTGALNLG............EVPKSLVVIGG..GYIGIELGTAYANF.....--..........
1gpeA  .-----..----.......----------------............-----------..--------------.....--..........
3cpiG  .-----..----.......---------------Dkn..........TMDEVYYKFGL..GNSTKEFIGHAMAL.....WT..........
2bcgG  .-----..----.......---------------Dkn..........TMDEVYYKFGL..GNSTKEFIGHAMAL.....WT..........
1d4cA  .-----..----.......----------------............-----------..--------DWLTSM.....--..........
1d4dA  .-----..----.......----------------............-----------..--------DWLTSM.....--..........
1d5tA  .DENDP..KTFE.......GVDPQNTSMRDVYRKF............DLGQDV-----..--------IDFTGH.....--..........
1gndA  .DENDP..KTFE.......GVDPQNTSMRDVYRKF............DLGQDV-----..--------IDFTGH.....--..........
1lv0A  .DENDP..KTFE.......GVDPQNTSMRDVYRKF............DLGQDV-----..--------IDFTGH.....--..........
1dxlA  .DVKSL..PGVT.......IDEKKIVSSTGALALS............EIPKKLVVIGA..GYIGLEMGSVWGRI.....--..........
3c96A  .-----..----.......----------------............-----------..--------RYIDQS.....--..........
2i0zA  .-----..----.......----------------............-----------..------IITFFENL.....--..........
1lpfA  .RPVEI..PPAP.......LSDDIIVDSTGALEFQ............AVPKKLGVIGA..GVIGLELGSVWARL.....--..........
1reoA  .----G..KVV-.......----------------............-----------..--------EELKRT.....NCsyilnkydty
2gmhA  .-----..----.......----------------............-----------..--------------.....--..........
1qo8A  .-----..----.......----------------............-----------..--------QWLESL.....--..........
2gqfA  .-----..----.......----------------............-----------..--------SLVAEQ.....--..........
1pj5A  .-----..----.......----------------............-----------..--------GYAAAW.....--..........
1b5qA  .NEHQP..NGPA.......TPVDMVVDYYKFDYEF............AEPPRV-----..--------TSLQNTvplatFS..........
2iidA  .----G..KVVE.......ELKRTNCSYILNKYDT............YSTKEYLIKEG..DLSPGAVDMIGDLL.....NE..........
2ivdA  .SRRA-..----.......--------------PE............GVDESLAAFGR..RHLGHRATQVLLDA.....VQtg........
1q9iA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1jryA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1p2eA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1p2hA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1y0pA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1ksuA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1jrzA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1jrxA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1kssA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1v59A  .EVTPF..PGIE.......IDEEKIVSSTGALSLK............EIPKRLTIIGG..GIIGLEMGSVYSRL.....--..........
2b7rA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
2b7sA  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
3ladA  .KPVEI..PPAP.......VDQDVIVDSTGALDFQ............NVPGKLGVIGA..GVIGLELGSVWARL.....--..........
1m64A  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1lj1A  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
1e39A  .-----..----.......----------------............-----------..--------DWMTAM.....--..........
2gjcA  .-----..----.......----------------............-----------..--------------.....--..........
1pn0A  .ERRIL..DSIA.......EISDTRIKVERPLIPE............KME--------..--------IDSSKA.....ED..........
1ykjA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1pxbA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1k0iA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1dobA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1iutA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1pxcA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1pbeA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1cj2A  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1cc4A  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1bgnA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1fohA  eRHILD..SIAE.......ISDTRIKVERPLIPEK............ME---------..--------IDSSKA.....ED..........
1pbdA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1pbfA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1cj3A  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1bgjA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1bf3A  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1cj4A  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1bkwA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1pxaA  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1cc6A  .-----..----.......----------------............-----------..---GVEIAFAGQRR.....--..........
1gesA  .RPSHP..DIPG.......--VEYGIDSDGFFALP............ALPERVAVVGA..GYIGVELGGVINGL.....--..........
2bs3A  .-----..----.......----------------............-----------..--------RELAAW.....--..........
1qlbA  .-----..----.......----------------............-----------..--------RELAAW.....--..........
2bs2A  .-----..----.......----------------............-----------..--------RELAAW.....--..........
1bhyA  .RVTKL..PFIP.......-EDPRIIDSSGALALK............EVPGKLLIIGG..GIIGLEMGTVYSTL.....--..........
1ojtA  .RVTKL..PFIP.......-EDPRIIDSSGALALK............EVPGKLLIIGG..GIIGLEMGTVYSTL.....--..........
1cjcA  .----L..DIPG.......EELPGVFSARAFVGWYnglpenrelapdLSCDTAVILGQ..GNVALDVARILLTP.....PDhlektditea
1gerA  .RPSHP..DIPG.......--VEYGIDSDGFFALP............ALPERVAVVGA..GYIAVELAGVINGL.....--..........
1lvlA  .SSVEL..PMLP.......-LGGPVISSTEALAPK............ALPQHLVVVGG..GYIGLELGIAYRKL.....--..........
1kdgA  .SSRLPstDHPS.......TDGQRYLEQSFNVV--............-----------..-------SQLLKGQ.....--..........
1naaA  .SSRLPstDHPS.......TDGQRYLEQSFNVV--............-----------..-------SQLLKGQ.....--..........
1w4xA  .---LP..NFPGlkd....FAGNLYHTGNWPHEPVd...........FSGQRVGVIGT..GSSGIQVSPQIAKQ.....--..........
1tdeA  .SARYL..GLPSeea....FKGRGVSACATCDGFF............YRNQKVAVIGG..GNTAVEEALYLSNI.....--..........
1cl0A  .SARYL..GLPSeea....FKGRGVSACATCDGFF............YRNQKVAVIGG..GNTAVEEALYLSNI.....--..........
1f6mA  .SARYL..GLPSeea....FKGRGVSASATCDGFF............YRNQKVAVIGG..GNTAVEEALYLSNI.....--..........
1typA  .WPQHL..GIEG.......--DDLCITSNEAFYLD............EAPKRALCVGG..GYISIEFAGIFNAY.....-K..........
1tytA  .WPQHL..GIEG.......--DDLCITSNEAFYLD............EAPKRALCVGG..GYISIEFAGIFNAY.....-K..........
1fecA  .WPQHL..GIEG.......--DDLCITSNEAFYLD............EAPKRALCVGG..GYISIEFAGIFNAY.....-K..........
2tprA  .WPQHL..GIEG.......--DDLCITSNEAFYLD............EAPKRALCVGG..GYISIEFAGIFNAY.....-K..........
1ju2A  .SWQSV..TKTA.......FLEAGVHPNHGF----............-----------..--------------.....--..........
1tdfA  .SARYL..GLPSeea....FKGRGVSACATSDGFF............YRNQKVAVIGG..GNTAVEEALYLSNI.....--..........
1trbA  .SARYL..GLPSeea....FKGRGVSACATSDGFF............YRNQKVAVIGG..GNTAVEEALYLSNI.....--..........
1gxfA  .WPHMP..NIPG.......--IEHCISSNEAFYLP............EPPRRVLTVGG..GFISVEFAGIFNAY.....--..........
1bzlA  .WPHMP..NIPG.......--IEHCISSNEAFYLP............EPPRRVLTVGG..GFISVEFAGIFNAY.....--..........
1ndaA  .WPHMP..NIPG.......--IEHCISSNEAFYLP............EPPRRVLTVGG..GFISVEFAGIFNAY.....--..........
1aogA  .WPHMP..NIPG.......--IEHCISSNEAFYLP............EPPRRVLTVGG..GFISVEFAGIFNAY.....--..........
1onfA  .KPVFP..PVKG.......IE--NTISSDEF---Fni..........KESKKIGIVGS..GYIAVELINVIKRL.....--..........
1xanA  .MPSTP..HESQi......PGASLGITSDGFFQLE............ELPGRSVIVGA..GYIAVEMAGILSAL.....--..........
3grsA  .MPSTP..HESQi......PGASLGITSDGFFQLE............ELPGRSVIVGA..GYIAVEMAGILSAL.....--..........
1fl2A  .KWRNM..NVPGedq....YRTKGVTYCPHCDGPL............FKGKRVAVIGG..GNSGVEAAIDLAGI.....--..........
1l9cA  .-----..----.......----------------............-----------..------TMEAAKEH.....--..........
2gf3A  .-----..----.......----------------............-----------..------TMEAAKEH.....--..........
3bhkA  .-----..----.......----------------............-----------..------TMEAAKEH.....--..........
3grtA  .MPSTP..HESQi......PGASLGITSDGFFQLE............ELPGRSVIVGA..GYIAVEMAGILSAL.....--..........
1grtA  .MPSTP..HESQi......PGASLGITSDGFFQLE............ELPGRSVIVGA..GYIAVEMAGILSAL.....--..........
1hyuA  .KWRNM..NVPGedq....YRTKGVTYCPHCDGPL............FKGKRVAVIGG..GNSGVEAAIDLAGI.....--..........
1w4xA  sVPQLP..NFPGlkd....FAGNLYHTGNWPHEPVd...........FSGQRVGVIGT..GSSGIQVSPQIAKQ.....--..........
1sezA  .-----..----.......--------------G-............-----------..--------FFQRH-.....--..........
1h6vA  .RPRYL..GIPG.......-DKEYCISSDDLFSLP............YCPGKTLVVGA..SYVALECAGFLAGI.....--..........
1rp0A  .-----..----.......----------------............-----------..--------------.....--..........
2f5vA  .-----..----.......RDFQQIPLAAT-----............RRS--------..--------PTFVEW.....--..........
2f6cA  .-----..----.......RDFQQIPLAAT-----............RRS--------..--------PTFVEW.....--..........
1tzlA  .-----..----.......RDFQQIPLAAT-----............RRS--------..--------PTFVEW.....--..........
2gv8A  eVPYIP..NIKGldeyakaVPGSVLHSSLFREPEL............FVGESVLVVGG..ASSANDLVRHLTPV.....--..........
1vqwA  eVPYIP..NIKGldeyakaVPGSVLHSSLFREPEL............FVGESVLVVGG..ASSANDLVRHLTPV.....--..........
2ignA  .-----..----.......RDFQQIPLAAT-----............RRS--------..--------PTFVEW.....--..........
1vdcA  .VAKRL..SFVGsgevlggFWNRGISACAVCDGAApi..........FRNKPLAVIGG..GDSAMEEANFLTKY.....--..........
1ng4A  .-----..----.......----------------............-----------..--------SWYSKE.....--..........
1ryiA  .-----..----.......----------------............-----------..--------SWYSKE.....--..........
1xdiA  .SPRIL..PSAQ.......PDGERILTWRQLYDLD............ALPDHLIVVGS..GVTGAEFVDAYTEL.....--..........
2vouA  .-----..----.......----------------............-----------..--------FTSY--.....--..........
1xhcA  .RAREP..QIKGkeyl...LTLRTIFDADRIKESI............ENSGEAIIIGG..GFIGLELAGNLAEA.....--..........
1b8sA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
1n4wA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
3cnjA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
1q1rA  .RPRPL..PVASgav....GKANNFRYLRTLEDAEcirrql......IADNRLVVIGG..GYIGLEVAATAIKA.....--..........
1f8wA  .VPFEL..DIPG.......KDLDNIYLMRGRQWAIklkqktvd....PEVNNVVVIGS..GYIGIEAAEAFAKA.....--..........
1nhqA  .VPFEL..DIPG.......KDLDNIYLMRGRQWAIklkqktvd....PEVNNVVVIGS..GYIGIEAAEAFAKA.....--..........
1nhrA  .VPFEL..DIPG.......KDLDNIYLMRGRQWAIklkqktvd....PEVNNVVVIGS..GYIGIEAAEAFAKA.....--..........
1ijhA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
3b6dA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
1cc2A  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
3b3rA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
1npxA  .VPFEL..DIPG.......KDLDNIYLMRGRQWAIklkqktvd....PEVNNVVVIGS..GYIGIEAAEAFAKA.....--..........
1cboA  .-----..----.......VFVPNVYDF-------............-----------..GYMQREAAGEVPKS.....--..........
1nhsA  .VPFEL..DIPG.......KDLDNIYLMRGRQWAIklkqktvd....PEVNNVVVIGS..GYIGIEAAEAFAKA.....--..........
1nhpA  .VPFEL..DIPG.......KDLDNIYLMRGRQWAIklkqktvd....PEVNNVVVIGS..GYIGIEAAEAFAKA.....--..........
1mo9A  .GPGTL..DVPG.......VNAKGVFDHATLVEELdy..........EPGSTVVVVGG..SKTAVEYGCFFNAT.....--..........
1fcdA  .-----..----.......----------------............-----------..--------------.....--..........
1m6iA  .TPRSL..SAID.......RAGAEVKSRTTLFRKIgdfrslekis..REVKSITIIGG..GFLGSELACALGRK.....AR..........
1gv4A  .TPRSL..SAID.......RAGAEVKSRTTLFRKIgdfralekis..REVKSITVIGG..GFLGSELACALGRK.....SQ..........
3coxA  .TAFVP..NVYD.......FE-----------YM-............-----------..---KKEAAGQVTKS.....--..........
1d7yA  .APRAL..PTLQ.......GATMPVHTLRTLEDARriqagl......RPQSRLLIVGG..GVIGLELAATARTA.....--..........
1d7yA  .-----..----.......----------------............----RLLIVGG..GVIGLELAATARTA.....--..........
1fcdA  .ELIYD..KIEGys.....E---------------............-----------..--------------.....--..........
1ps9A  .-PRTP..PIDG.......IDHPKVLSYLDVLRDKa...........PVGNKVAIIGC..GGIGFDTAMYLSQP.....GEstsqniagfc
1djnA  .-----..----.......-----LTPEQVMDGKK............KIGKRVVILNAdtYFMAPSLAEKLATA.....--..........
1djqA  .-----..----.......-----LTPEQVMDGKK............KIGKRVVILNAdtYFMAPSLAEKLATA.....--..........
2culA  .-----..----.......----------------............-----------..--------VWAFHA.....--..........
1gv4A  .-----..----.......----------------............---KSITVIGG..GFLGSELACALGRK.....SQ..........
1m6iA  .-----..----.......----------------............---KSITIIGG..GFLGSELACALGRK.....AR..........
1nhrA  .-----..----.......----------------............----KVIVLGS..SHGGYEAVEELLNL.....--..........
1nhqA  .-----..----.......----------------............----KVIVLGS..SHGGYEAVEELLNL.....--..........
2gv8A  .-----..----.......----------------............-----------..--------------.....--..........
1vqwA  .-----..----.......----------------............-----------..--------------.....--..........
1gndA  .-----..----.......----------------............-----------..--------------.....--..........
1lv0A  .-----..----.......----------------............-----------..--------------.....--..........
1d5tA  .-----..----.......----------------............-----------..--------------.....--..........
3cpiG  .-----..----.......----------------............-----------..--------------.....--..........
2bcgG  .-----..----.......----------------............-----------..--------------.....--..........
1fcdA  .-----..----.......----------------............-----------..--------------.....--..........


                                    210                                           220               
                                      |                                             |               
d1f8ra1  ..........................DSGY...YVSFIESLK.................................HDDIFAYE..KR....
2dw4A  ..........................NPPS...DVYLSSRDRqildwhfanlefanatplstlslkhwd......QDDDFEFT..GS....
2h94A  ..........................NPPS...DVYLSSRDRqildwhfanlefanatplstlslkhwd......QDDDFEFT..GS....
2iw5A  ..........................NPPS...DVYLSSRDRqildwhfanlefanatplstlslkhwd......QDDDFEFT..GS....
2z3yA  ..........................NPPS...DVYLSSRDRqildwhfanlefanatplstlslkhwd......QDDDFEFT..GS....
1ltxR  ..........................----...---------.................................--------..--....
1vg0A  ..........................----...---------.................................--------..--....
1jnrA  ..........................--DG...TVHLFEKWGlpiwktpdgk.......................YVREG---..QW....
2c76A  ..........................--CVta.ETHEVSALWflwyvkqcggtt.....................RIISTTNG..GQ....
2v5zA  ..........................--CVta.ETHEVSALWflwyvkqcggtt.....................RIISTTNG..GQ....
2bk5A  ..........................--CVta.ETHEVSALWflwyvkqcggtt.....................RIFSTTNG..GQ....
2c73A  ..........................--CVta.ETHEVSALWflwyvkqcggtt.....................RIISTTNG..GQ....
2c75A  ..........................--CVta.ETHEVSALWflwyvkqcggtt.....................RIISTTNG..GQ....
2c72A  ..........................--CVta.ETHEVSALWflwyvkqcggtt.....................RIISTTNG..GQ....
1o5wA  ..........................--NVts.EPHEVSALWflwyvrqcggta.....................RIFSVTNG..GQ....
1nekA  ..........................--GL...PFSRLDDGRiyqrpfggqsknfggeqaa..............RTAAAA--..--....
1chuA  ..........................--GGhs.HRRILHAAD.................................ATGRE---..--....
1cf3A  ..........................YFNA...SCHGVNGTVhagprdtgddysp....................I-------..--....
1knrA  ..........................--GGhs.HRRILHAAD.................................ATGRE---..--....
2b76A  ..........................--GC...PWSRRPDGSvnvrrfggmkiert...................W-------..-F....
1kf6A  ..........................--GC...PWSRRPDGSvnvrrfggmkiert...................W-------..-F....
3cirA  ..........................--GC...PWSRRPDGSvnvrrfggmkiert...................W-------..-F....
1ebdA  ..........................--GT...KVTILEGAG.................................EILSGFEK..Q-....
1gpeA  ..........................----...---------.................................--------..--....
3cpiG  ..........................----...------NDDylqqparpsferillyc................QSVARYGK..SP....
2bcgG  ..........................----...------NDDylqqparpsferillyc................QSVARYGK..SP....
1d4cA  ..........................--GA...DMTDVGRMGgas..............................VNRSHRPT..GG....
1d4dA  ..........................--GA...DMTDVGRMGgas..............................VNRSHRPT..GG....
1d5tA  ..........................----...-ALALYRTDdyldqpcletinriklys...............ESLARYGK..SP....
1gndA  ..........................----...-ALALYRTDdyldqpcletinriklys...............ESLARYGK..SP....
1lv0A  ..........................----...-ALALYRTDdyldqpcletinriklys...............ESLARYGK..SP....
1dxlA  ..........................--GS...EVTVVEFAS.................................EIVPTMDA..E-....
3c96A  ..........................--GA...TVWSEPRGV.................................-EAGNAYP..QY....
2i0zA  ..........................--GV...KLKEEDHGR.................................MFPVSNKAq.S-....
1lpfA  ..........................--GA...EVTVLEALD.................................KFLPAADE..Q-....
1reoA  stkeyllkegnlspgavdmigdlmneDSGY...YVSFPESLR.................................HDDIFAYE..KR....
2gmhA  ..........................--RI...PVPILPGLP.................................-----MNNhgNY....
1qo8A  ..........................--GA...NLDDLKRSGgar..............................VDRTHRPH..GG....
2gqfA  ..........................--GI...TYHEKELGQ.................................LFCDEGAE..Q-....
1pj5A  ..........................--GI...EGRLLSPAEcqelyplldgeni....................LGGLHVPS..DG....
1b5qA  ..........................DFGD...DVYFVADQ-.................................--------..--....
2iidA  ..........................DSGY...YVSFIESLK.................................HDDIFAYE..KR....
2ivdA  ..........................IYAG...DVEQLSVAAtfpmlvkmerehrslilgairaqkaqrqaalp.AGTAPKLS..GA....
1q9iA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1jryA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1p2eA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1p2hA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1y0pA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1ksuA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1jrzA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1jrxA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1kssA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1v59A  ..........................--GS...KVTVVEFQP.................................QIGASMDG..E-....
2b7rA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
2b7sA  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
3ladA  ..........................--GA...EVTVLEAMD.................................KFLPAVDE..Q-....
1m64A  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1lj1A  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
1e39A  ..........................--GA...DLTDVGMMGgas..............................VNRAHRPT..GG....
2gjcA  ..........................--GD...YVVVKHAAL.................................--------..--....
1pn0A  ..........................PEAY...PVTMTLRYMsedestpl.........................Q-------..--....
1ykjA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1pxbA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1k0iA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1dobA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1iutA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1pxcA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1pbeA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1cj2A  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1cc4A  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1bgnA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1fohA  ..........................PEAY...PVTM-----.................................--------..--....
1pbdA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1pbfA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1cj3A  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1bgjA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1bf3A  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1cj4A  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1bkwA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1pxaA  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1cc6A  ..........................--RI...DLKRLSGGK.................................TVTVYGQT..E-....
1gesA  ..........................--GA...KTHLFEMFD.................................APLPSFDP..M-....
2bs3A  ..........................--GV...PWTRIHKGDrmaiinaqkttiteedfrhglihsrdfggtkkwR-------..--....
1qlbA  ..........................--GV...PWTRIHKGDrmaiinaqkttiteedfrhglihsrdfggtkkwR-------..--....
2bs2A  ..........................--GV...PWTRIHKGDrmaiinaqkttiteedfrhglihsrdfggtkkwR-------..--....
1bhyA  ..........................--GS...RLDVVEMMD.................................GLMQGADR..D-....
1ojtA  ..........................--GS...RLDVVEMMD.................................GLMQGADR..D-....
1cjcA  ........algalrqsrvktvwivgrR---...--------Gplqvaftikelremiqlpgtrpmldpadf....LGLQDRIK..EA....
1gerA  ..........................--GA...KTHLFVRKH.................................APLRSFDP..M-....
1lvlA  ..........................--GA...QVSVVEARE.................................RILPTYDS..E-....
1kdgA  ..........................--GY...NQATINDNPnykdh............................VFGYSAFD..FL....
1naaA  ..........................--GY...NQATINDNPnykdh............................VFGYSAFD..FL....
1w4xA  ..........................--AA...ELFVFQRTPhfavp............................ARNAPLDP..EF....
1tdeA  ..........................--AS...EVHLIHRRD.................................GFRAEKI-..--....
1cl0A  ..........................--AS...EVHLIHRRD.................................GFRAEKI-..--....
1f6mA  ..........................--AS...EVHLIHRRD.................................GFRAEKI-..--....
1typA  ..........................ARGG...QVDLAYRGD.................................MILRGFDS..E-....
1tytA  ..........................ARGG...QVDLAYRGD.................................MILRGFDS..E-....
1fecA  ..........................ARGG...QVDLAYRGD.................................MILRGFDS..E-....
2tprA  ..........................ARGG...QVDLAYRGD.................................MILRGFDS..E-....
1ju2A  ..........................----...SLDHEEGTR.................................ITGSTFDN..K-....
1tdfA  ..........................--AS...EVHLIHRRD.................................GFRAEKI-..--....
1trbA  ..........................--AS...EVHLIHRRD.................................GFRAEKI-..--....
1gxfA  ..........................--KPkdgQVTLCYRGE.................................MILRGFDH..T-....
1bzlA  ..........................--KPkdgQVTLCYRGE.................................MILRGFDH..T-....
1ndaA  ..........................--KPkdgQVTLCYRGE.................................MILRGFDH..T-....
1aogA  ..........................--KPkdgQVTLCYRGE.................................MILRGFDH..T-....
1onfA  ..........................--GI...DSYIFARGN.................................RILRKFDE..S-....
1xanA  ..........................--GS...KTSLMIRHD.................................KVLRSFDS..M-....
3grsA  ..........................--GS...KTSLMIRHD.................................KVLRSFDS..M-....
1fl2A  ..........................--VE...HVTLLEFAP.................................EMKA----..--....
1l9cA  ..........................--SL...TVDLLEGDEinkrwpgitvpen....................YNAIFEPN..SG....
2gf3A  ..........................--SL...TVDLLEGDEinkrwpgitvpen....................YNAIFEPN..SG....
3bhkA  ..........................--SL...TVDLLEGDEinkrwpgitvpen....................YNAIFEPN..SG....
3grtA  ..........................--GS...KTSLMIRHD.................................KVLRSFDS..M-....
1grtA  ..........................--GS...KTSLMIRHD.................................KVLRSFDS..M-....
1hyuA  ..........................--VE...HVTLLEFAP.................................EMKA----..--....
1w4xA  ..........................--AA...ELFVFQRTP.................................HFAVPARNa.P-....
1sezA  ..........................-FGK...EVVDYLIDP.................................FVAGTCGG..DPdsls
1h6vA  ..........................--GL...DVTVMVRSI.................................-LLRGFDQ..D-....
1rp0A  ..........................--DT...YVVVKHAAL.................................--------..--....
2f5vA  ..........................--SS...ANTVFDLQN.................................RPNTDAPEe.RF....
2f6cA  ..........................--SS...ANTVFDLQN.................................RPNTDAPEe.RF....
1tzlA  ..........................--SS...ANTVFDLQN.................................RPNTDAPEe.RF....
2gv8A  ..........................----...---------.................................--------..--....
1vqwA  ..........................----...---------.................................--------..--....
2ignA  ..........................--SS...ANTVFDLQN.................................RPNTDAPEe.RF....
1vdcA  ..........................--GS...KVYIIHRRD.................................AFRA----..--....
1ng4A  ..........................--EVl..EKE-----Pyasgd............................IFGASFIQd.DV....
1ryiA  ..........................--EVl..EKE-----Pyasgd............................IFGASFIQd.DV....
1xdiA  ..........................--GV...PVTVVASQD.................................HVLPYEDA..D-....
2vouA  ..........................----...---------.................................--------..--....
1xhcA  ..........................--GY...HVKLIHRGA.................................MFLGLDE-..E-....
1b8sA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
1n4wA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
3cnjA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
1q1rA  ..........................--NM...HVTLLDTAA.................................RVLERVTA..P-....
1f8wA  ..........................--GK...KVTVIDILD.................................RPLGVYLDk.E-....
1nhqA  ..........................--GK...KVTVIDILD.................................RPLGVYLDk.E-....
1nhrA  ..........................--GK...KVTVIDILD.................................RPLGVYLDk.E-....
1ijhA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
3b6dA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
1cc2A  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
3b3rA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
1npxA  ..........................--GK...KVTVIDILD.................................RPLGVYLDk.E-....
1cboA  ..........................--AL...ATEVIYGNN.................................HGKQSLDK..T-....
1nhsA  ..........................--GK...KVTVIDILD.................................RPLGVYLDk.E-....
1nhpA  ..........................--GK...KVTVIDILD.................................RPLGVYLDk.E-....
1mo9A  ..........................--GR...RTVMLVRTE.................................PLKLIKDN..E-....
1fcdA  ..........................----...---------.................................--------..--....
1m6iA  ..........................ALGT...EVIQL----.................................--------..--....
1gv4A  ..........................ASGI...EVIQL----.................................--------..--....
3coxA  ..........................--GL...GGEVIYGNN.................................AGKKSLDKt.Y-....
1d7yA  ..........................--GV...HVSLVETQP.................................RLMSR---..--....
1d7yA  ..........................--GV...HVSLVETQP.................................RLMSRAAPa.T-....
1fcdA  ..........................----...---------.................................--------..--....
1ps9A  .........................nEWGI...DSSLQQAGGlspqgmqiprsprqiv.................MLQRKASK..PG....
1djnA  ..........................--GH...EVTIVSGVH.................................LANYMHFTl.EY....
1djqA  ..........................--GH...EVTIVSGVH.................................LANYMHFTl.EY....
2culA  ..........................----...---------.................................--------..--....
1gv4A  ..........................ASGI...EVIQLFPEK.................................GNMGKILPq.Y-....
1m6iA  ..........................ALGT...EVIQLFPEK.................................GNMGKILPe.Y-....
1nhrA  ..........................HPDA...EIQWYEKGDfisfcs...........................CGMQLYLE..GK....
1nhqA  ..........................HPDA...EIQWYEKGDfisfls...........................SGMQLYLE..GK....
2gv8A  ..........................----...---------.................................--------..--....
1vqwA  ..........................----...---------.................................--------..--....
1gndA  ..........................----...---------.................................--------..--....
1lv0A  ..........................----...---------.................................--------..--....
1d5tA  ..........................----...---------.................................--------..--....
3cpiG  ..........................----...---------.................................--------..--....
2bcgG  ..........................----...---------.................................--------..--....
1fcdA  ..........................----...---------.................................--------..--....


                                                        230                240                      
                                                          |                  |                      
d1f8ra1  .................................................FDE.......IVD..GMDKLPTAMYRD...............
2dw4A  .................................................HLT.......VRN..GYSCVPVALAE-...............
2h94A  .................................................HLT.......VRN..GYSCVPVALAE-...............
2iw5A  .................................................HLT.......VRN..GYSCVPVALAE-...............
2z3yA  .................................................HLT.......VRN..GYSCVPVALAE-...............
1ltxR  .................................................---.......---..------------...............
1vg0A  .................................................---.......---..------------...............
1jnrA  .................................................QIM.......IHGesYKPIIAEAAKMA...............
2c76A  .................................................ERK.......FVG..GSGQVSERIMDL...............
2v5zA  .................................................ERK.......FVG..GSGQVSERIMDL...............
2bk5A  .................................................ERK.......FVG..GSGQVSERIMDL...............
2c73A  .................................................ERK.......FVG..GSGQVSERIMDL...............
2c75A  .................................................ERK.......FVG..GSGQVSERIMDL...............
2c72A  .................................................ERK.......FVG..GSGQVSERIMDL...............
1o5wA  .................................................ERK.......FVG..GSGQVSEQIMGL...............
1nekA  .................................................DRT.......GHA..LLHTLYQQNLKN...............
1chuA  .................................................---.......---..VETTLVSKALNH...............
1cf3A  .................................................---.......---..-VKALMSAVEDRgvptkkdfgcgdphg
1knrA  .................................................---.......---..VETTLVSKALNH...............
2b76A  .................................................AAD.......KTGfhMLHTLFQTSLQF...............
1kf6A  .................................................AAD.......KTGfhMLHTLFQTSLQF...............
3cirA  .................................................AAD.......KTGfhMLHTLFQTSLQF...............
1ebdA  .................................................---.......---..MAAIIKKRLKKK...............
1gpeA  .................................................---.......---..------------...............
3cpiG  .................................................YLY.......PMY..GLGELPQGFARL...............
2bcgG  .................................................YLY.......PMY..GLGELPQGFARL...............
1d4cA  .................................................AGV.......GAH..VAQVLWDNAVKR...............
1d4dA  .................................................AGV.......GAH..VAQVLWDNAVKR...............
1d5tA  .................................................YLY.......PLY..GLGELPQGFARL...............
1gndA  .................................................YLY.......PLY..GLGELPQGFARL...............
1lv0A  .................................................YLY.......PLY..GLGELPQGFARL...............
1dxlA  .................................................---.......---..IRKQFQRSLEKQ...............
3c96A  .................................................SIH.......RGE..LQMILLAAVRER...............
2i0zA  .................................................---.......---..VVDALLTRLKDL...............
1lpfA  .................................................---.......---..IAKEALKVLTKQ...............
1reoA  .................................................FDE.......IVG..GMDKLPTSMYRA...............
2gmhA  .................................................VVR.......LGH..LVSWMGEQAEAL...............
1qo8A  .................................................KSS.......GPE..IIDTLRKAAKEQ...............
2gqfA  .................................................---.......---..IVEMLKSECDKY...............
1pj5A  .................................................LAS.......AAR..AVQLLIKRTESA...............
1b5qA  .................................................---.......--R..GYEAVVYYLAGQylktddksgki....
2iidA  .................................................FDE.......IVD..GMDKLPTAMYRD...............
2ivdA  .................................................LST.......FDG..GLQVLIDALAAS...............
1q9iA  .................................................CGV.......GAH..VVQVLYDNAVKR...............
1jryA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1p2eA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1p2hA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1y0pA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1ksuA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1jrzA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1jrxA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1kssA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1v59A  .................................................---.......---..VAKATQKFLKKQ...............
2b7rA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
2b7sA  .................................................AGV.......GAH..VVQVLYDNAVKR...............
3ladA  .................................................---.......---..VAKEAQKILTKQ...............
1m64A  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1lj1A  .................................................AGV.......GAH..VVQVLYDNAVKR...............
1e39A  .................................................AGV.......GAH..VVQVLYDNAVKR...............
2gjcA  .................................................---.......---..FISTVLSKVLQL...............
1pn0A  .................................................---.......---..------FGHKTE...............
1ykjA  .................................................---.......---..VTRDLMEAREAC...............
1pxbA  .................................................---.......---..VTRDLMEAREAC...............
1k0iA  .................................................---.......---..VTRDLMEAREAC...............
1dobA  .................................................---.......---..VTRDLMEAREAC...............
1iutA  .................................................---.......---..VTRDLMEAREAC...............
1pxcA  .................................................---.......---..VTRDLMEAREAC...............
1pbeA  .................................................---.......---..VTRDLMEAREAC...............
1cj2A  .................................................---.......---..VTRDLMEAREAS...............
1cc4A  .................................................---.......---..VTRDLMEAREAS...............
1bgnA  .................................................---.......---..VTRDLMEAREAS...............
1fohA  .................................................---.......---..----TLRYMSDH...............
1pbdA  .................................................---.......---..VTRDLMEAREAS...............
1pbfA  .................................................---.......---..VTRDLMEAREAS...............
1cj3A  .................................................---.......---..VTRDLMEAREAS...............
1bgjA  .................................................---.......---..VTRDLMEAREAS...............
1bf3A  .................................................---.......---..VTRDLMEAREAS...............
1cj4A  .................................................---.......---..VTRDLMEAREAS...............
1bkwA  .................................................---.......---..VTRDLMEAREAS...............
1pxaA  .................................................---.......---..VTRDLMEAREAC...............
1cc6A  .................................................---.......---..VTRDLMEAREAS...............
1gesA  .................................................---.......---..ISETLVEVMNAE...............
2bs3A  .................................................--TcytadatGHT..MLFAVANECLKL...............
1qlbA  .................................................--TcytadatGHT..MLFAVANECLKL...............
2bs2A  .................................................--TcytadatGHT..MLFAVANECLKL...............
1bhyA  .................................................---.......---..LVKVWQKQNEYR...............
1ojtA  .................................................---.......---..LVKVWQKQNEYR...............
1cjcA  .................................................ARP.......RKR..LMELLLRTATEK...............
1gerA  .................................................---.......---..ISETLVEVMNAE...............
1lvlA  .................................................---.......---..LTAPVAESLKKL...............
1kdgA  .................................................NGK.......RAG..PVATYLQTALAR...............
1naaA  .................................................NGK.......RAG..PVATYLQTALAR...............
1w4xA  .................................................LAD.......LKK..RYAEFREESRNTpggthryqgpksale
1tdeA  .................................................---.......---..LIKRLMDKVENG...............
1cl0A  .................................................---.......---..LIKRLMDKVENG...............
1f6mA  .................................................---.......---..LIKRLMDKVENG...............
1typA  .................................................---.......---..LRKQLTEQLRAN...............
1tytA  .................................................---.......---..LRKQLTEQLRAN...............
1fecA  .................................................---.......---..LRKQLTEQLRAN...............
2tprA  .................................................---.......---..LRKQLTEQLRAN...............
1ju2A  .................................................---.......---..GTRHAADELLNK...............
1tdfA  .................................................---.......---..LIKRLMDKVENG...............
1trbA  .................................................---.......---..LIKRLMDKVENG...............
1gxfA  .................................................---.......---..LREELTKQLTAN...............
1bzlA  .................................................---.......---..LREELTKQLTAN...............
1ndaA  .................................................---.......---..LREELTKQLTAN...............
1aogA  .................................................---.......---..LREELTKQLTAN...............
1onfA  .................................................---.......---..VINVLENDMKKN...............
1xanA  .................................................---.......---..ISTNCTEELENA...............
3grsA  .................................................---.......---..ISTNCTEELENA...............
1fl2A  .................................................---.......---..-DQVLQDKLRSL...............
1l9cA  .................................................VLF.......SEN..CIRAYRELAEAR...............
2gf3A  .................................................VLF.......SEN..CIRAYRELAEAR...............
3bhkA  .................................................VLF.......SEN..CIRAYRELAEAR...............
3grtA  .................................................---.......---..ISTNCTEELENA...............
1grtA  .................................................---.......---..ISTNCTEELENA...............
1hyuA  .................................................---.......---..-DQVLQDKVRSL...............
1w4xA  .................................................---.......---..LDPEFLADLKKRyaefreesrntpggt
1sezA  mhhsfpelwnlekrfgsvilgairsklspknekkqgppktsankkrqrgSFS.......FLG..GMQTLTDAICKD...............
1h6vA  .................................................---.......---..MANKIGEHMEEH...............
1rp0A  .................................................---.......---..FTSTIMSKLLAR...............
2f5vA  .................................................NLF.......PAV..ACERVVRNALNS...............
2f6cA  .................................................NLF.......PAV..ACERVVRNALNS...............
1tzlA  .................................................NLF.......PAV..ACERVVRNALNS...............
2gv8A  .................................................---.......---..------------...............
1vqwA  .................................................---.......---..------------...............
2ignA  .................................................NLF.......PAV..ACERVVRNALNS...............
1vdcA  .................................................---.......---..-SKIMQQRALSN...............
1ng4A  .................................................HVE.......PYF..VCKAYVKAAKML...............
1ryiA  .................................................HVE.......PYF..VCKAYVKAAKML...............
1xdiA  .................................................---.......---..AALVLEESFAER...............
2vouA  .................................................---.......---..--DSIYGGLYEL...............
1xhcA  .................................................---.......---..LSNMIKDMLEET...............
1b8sA  .................................................---.......---..----YLAAALGT...............
1n4wA  .................................................---.......---..----YLAAALGT...............
3cnjA  .................................................---.......---..----YLAAALGT...............
1q1rA  .................................................---.......---..PVSAFYEHLHRE...............
1f8wA  .................................................---.......---..FTDVLTEEMEAN...............
1nhqA  .................................................---.......---..FTDVLTEEMEAN...............
1nhrA  .................................................---.......---..FTDVLTEEMEAN...............
1ijhA  .................................................---.......---..----YLAAALGT...............
3b6dA  .................................................---.......---..----YLAAALGT...............
1cc2A  .................................................---.......---..----YLAAALGT...............
3b3rA  .................................................---.......---..----YLAAALGT...............
1npxA  .................................................---.......---..FTDVLTEEMEAN...............
1cboA  .................................................---.......---..----YLAAALGT...............
1nhsA  .................................................---.......---..FTDVLTEEMEAN...............
1nhpA  .................................................---.......---..FTDVLTEEMEAN...............
1mo9A  .................................................---.......---..TRAYVLDRMKEQ...............
1fcdA  .................................................---.......---..------------...............
1m6iA  .................................................---.......---..------------...............
1gv4A  .................................................---.......---..------------...............
3coxA  .................................................---.......---..----LAQAAATG...............
1d7yA  .................................................---.......---..------------...............
1d7yA  .................................................---.......---..LADFVARYHAAQ...............
1fcdA  .................................................---.......---..------------...............
1ps9A  .................................................QGL.......GKT..TGWIHRTTLLSR...............
1djnA  .................................................PNM.......MRR..LHELHVEELGDH...............
1djqA  .................................................PNM.......MRR..LHELHVEELGDH...............
2culA  .................................................---.......---..RAKYLLEGL---...............
1gv4A  .................................................---.......---..LSNWTMEKVKRE...............
1m6iA  .................................................---.......---..LSNWTMEKVRRE...............
1nhrA  .................................................VKD.......VNS..VRYMTGEKMESR...............
1nhqA  .................................................VKD.......VNS..VRYMTGEKMESR...............
2gv8A  .................................................---.......---..------------...............
1vqwA  .................................................---.......---..------------...............
1gndA  .................................................---.......---..------------...............
1lv0A  .................................................---.......---..------------...............
1d5tA  .................................................---.......---..------------...............
3cpiG  .................................................---.......---..------------...............
2bcgG  .................................................---.......---..------------...............
1fcdA  .................................................---.......---..------------...............


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  ...........................................................................................
1vg0A  ...........................................................................................
1jnrA  ...........................................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  vsmfpntlhedqvrsdaarewllpnyqr...............................................................
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  vsdeelvetlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfgtkrlileidyyemfnr........
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  hryqgpksalevsdeelvetlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfgtkrlileidyyem
1sezA  ...........................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  ...........................................................................................
2f6cA  ...........................................................................................
1tzlA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  ...........................................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                250          260                           270                               280    
                  |            |                             |                                 |    
d1f8ra1  ...I...Q.DKVH..FNA.QVIKIQQN..D....Q.......K.....VT..VVY...............ETL....SKE.....TPSV.T
2dw4A  ...-...G.LDIK..LNT.AVRQVRYT..A....S.......G.....CE..VIA...............VNTrs..TSQ.....TFIY.K
2h94A  ...-...G.LDIK..LNT.AVRQVRYT..A....S.......G.....CE..VIA...............VNTrs..TSQ.....TFIY.K
2iw5A  ...-...G.LDIK..LNT.AVRQVRYT..A....S.......G.....CE..VIA...............VNTrs..TSQ.....TFIY.K
2z3yA  ...-...G.LDIK..LNT.AVRQVRYT..A....S.......G.....CE..VIA...............VNTrs..TSQ.....TFIY.K
1ltxR  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1vg0A  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1jnrA  ...V...GeENIY..ERV.FIFELLKD..N....N.......Dpna..VAg.AVG...............FSVr...EPK.....FYVF.K
2c76A  ...L...G.DRVK..LER.PVIYIDQT..R....E.......N.....VL..VET...............LNH....---.....-EMY.E
2v5zA  ...L...G.DRVK..LER.PVIYIDQT..R....E.......N.....VL..VET...............LNH....---.....-EMY.E
2bk5A  ...L...G.DRVK..LER.PVIYIDQT..R....E.......N.....VL..VET...............LNH....---.....-EMY.E
2c73A  ...L...G.DRVK..LER.PVIYIDQT..R....E.......N.....VL..VET...............LNH....---.....-EMY.E
2c75A  ...L...G.DRVK..LER.PVIYIDQT..R....E.......N.....VL..VET...............LNH....---.....-EMY.E
2c72A  ...L...G.DRVK..LER.PVIYIDQT..R....E.......N.....VL..VET...............LNH....---.....-EMY.E
1o5wA  ...L...G.DKVK..LSS.PVTYIDQT..D....D.......N.....II..VET...............LNH....---.....-EHY.E
1nekA  ...-...H.TTIF..SEW.YALDLVKN..Q....D.......G.....AV..VGC...............TALcie.TGE.....VVYF.K
1chuA  ...P...N.IRVL..ERT.NAVDLIVS..D....KiglpgtrR.....VVg.AWV...............WNRn...KET.....VETC.H
1cf3A  ...P...N.LQVL..TGQ.YVGKVLLS..Q....N.......Gttpr.AVg.VEF...............GTH....KGN.....THNV.Y
1knrA  ...P...N.IRVL..ERT.NAVDLIVS..D....KiglpgtrR.....VVg.AWV...............WNRn...KET.....VETC.H
2b76A  ...P...Q.IQRF..DEH.FVLDILVD..D....G.......H.....VRg.LVA...............MNMm...EGT.....LVQI.R
1kf6A  ...P...Q.IQRF..DEH.FVLDILVD..D....G.......H.....VRg.LVA...............MNMm...EGT.....LVQI.R
3cirA  ...P...Q.IQRF..DEH.FVLDILVD..D....G.......H.....VRg.LVA...............MNMm...EGT.....LVQI.R
1ebdA  ...-...G.VEVV..TNA.LAKGAEER..E....D.......G.....VT..VTY...............EA-....NGE.....TKTI.D
1gpeA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
3cpiG  ...SaiyG.GTYM..LDT.PIDEVLYK..Kdt..G.......K.....FEg.VKT...............KLG....---.....--TF.K
2bcgG  ...SaiyG.GTYM..LDT.PIDEVLYK..Kdt..G.......K.....FEg.VKT...............KLG....---.....--TF.K
1d4cA  ...-...G.TDIR..LNS.RVVRILED..As...G.......K.....VTg.VLV...............KGEy...TGY.....-YVI.K
1d4dA  ...-...G.TDIR..LNS.RVVRILED..As...G.......K.....VTg.VLV...............KGEy...TGY.....-YVI.K
1d5tA  ...SaiyG.GTYM..LNK.PVDDIIME..N....G.......K.....VVg.VKS...............EGE....---.....--VA.R
1gndA  ...SaiyG.GTYM..LNK.PVDDIIME..N....G.......K.....VVg.VKS...............EGE....---.....--VA.R
1lv0A  ...SaiyG.GTYM..LNK.PVDDIIME..N....G.......K.....VVg.VKS...............EGE....---.....--VA.R
1dxlA  ...-...G.MKFK..LKT.KVVGVDTS..G....D.......G.....VK..LTV...............EPSa...GGE.....QTII.E
3c96A  ...L...GqQAVR..TGL.GVERIEER..D....G.......R.....VL..IGA...............RDG....HGK.....PQAL.G
2i0zA  ...-...G.VKIR..TNT.PVETIEYE..N....G.......Q.....TKa.VIL...............QTG....---.....-EVL.E
1lpfA  ...-...G.LNIR..LGA.RVTASEVK..K....K.......Q.....VT..VTF...............TDA....NGE.....-QKE.T
1reoA  ...I...E.EKVH..LNA.QVIKIQKN..A....E.......K.....VT..VVY...............QTP....AKE.....MASV.T
2gmhA  ...-...G.VEVY..PGY.AAAEILFH..E....D.......Gs....VKg.IATndvgiqkdgapkttfERG....---.....-LEL.H
1qo8A  ...-...G.IDTR..LNS.RVVKLVVN..D....D.......Hs....VVg.AVV...............HGKh...TGY.....-YMI.G
2gqfA  ...-...G.AKIL..LRS.EVSQVERIqnD....E.......K.....VRf.VLQ...............VNS....---.....-TQW.Q
1pj5A  ...-...G.VTYR..GST.TVTGIEQS..G....G.......R.....VTg.VQT...............ADG....---.....--VI.P
1b5qA  ...V...D.PRLQ..LNK.VVREIKYS..P....G.......G.....VT..VKT...............EDN....---.....-SVY.S
2iidA  ...I...Q.DKVH..FNA.QVIKIQQN..D....Q.......K.....VT..VVY...............ETL....SKE.....TPSV.T
2ivdA  ...L...G.DAAH..VGA.RVEGLARE..D....G.......G.....WR..LII...............EE-....HGR.....RAEL.S
1q9iA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1jryA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1p2eA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1p2hA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1y0pA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1ksuA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1jrzA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1jrxA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1kssA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1v59A  ...-...G.LDFK..LST.KVISAKRN..D....D.......Kn....VVe.IVV...............EDTk...TNK.....QENL.E
2b7rA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
2b7sA  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
3ladA  ...-...G.LKIL..LGA.RVTGTEVK..N....K.......Q.....VT..VKF...............VDA....EGE.....-KSQ.A
1m64A  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1lj1A  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
1e39A  ...-...N.IDLR..MNT.RGIEVLKD..D....K.......Gt....VKg.ILV...............KGM....YKG.....YYWV.K
2gjcA  ...P...N.VKLF..NAT.CVEDLVTR..Ppt..E.......K.....GE..VTV...............AGVv...TNW.....TLVT.Q
1pn0A  ...-...N.GLFR..SNL.QTQEEEDA..N....-.......-.....--..YRL...............PEGke..AGE.....IETV.H
1ykjA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1pxbA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1k0iA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1dobA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1iutA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1pxcA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1pbeA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1cj2A  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1cc4A  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1bgnA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1fohA  ...E...S.TPLQ..FGH.KTENSLFH..S....Nlqtqee.Ed....AN..YRL...............PEGke..AGE.....IETV.H
1pbdA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1pbfA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1cj3A  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1bgjA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1bf3A  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1cj4A  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1bkwA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1pxaA  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1cc6A  ...-...G.ATTV..YQA.AEVRLHDLq.G....E.......R.....PY..VTF...............ER-....DGE.....RLRL.D
1gesA  ...-...G.PQLH..TNA.IPKAVVKN..T....D.......Gs....LT..LEL...............EDG....---.....-RSE.T
2bs3A  ...-...G.VSIQ..DRK.EAIALIHQ..D....G.......K.....CYg.AVV...............RDLv...TGD.....IIAY.V
1qlbA  ...-...G.VSIQ..DRK.EAIALIHQ..D....G.......K.....CYg.AVV...............RDLv...TGD.....IIAY.V
2bs2A  ...-...G.VSIQ..DRK.EAIALIHQ..D....G.......K.....CYg.AVV...............RDLv...TGD.....IIAY.V
1bhyA  ...-...F.DNIM..VNT.KTVAVEPK..E....D.......G.....VY..VTF...............EGA....NAP.....KEPQ.R
1ojtA  ...-...F.DNIM..VNT.KTVAVEPK..E....D.......G.....VY..VTF...............EGA....NAP.....KEPQ.R
1cjcA  ...P...G.V---..---.--------..-....-.......-.....--..---...............---....---.....----.-
1gerA  ...-...G.PQLH..TNA.IPKAVVKN..T....D.......Gs....LT..LEL...............EDG....---.....-RSE.T
1lvlA  ...-...G.IALH..LGH.SVEGYENG..C....-.......-.....--..LLA...............NDG....KGG.....QLRL.E
1kdgA  ...P...N.FTFK..TNV.MVSNVVRN..G....S.......Q.....ILg.VQT...............NDPtlgpNGF.....IPVT.P
1naaA  ...P...N.FTFK..TNV.MVSNVVRN..G....S.......Q.....ILg.VQT...............NDPtlgpNGF.....IPVT.P
1w4xA  ...D...N.VHLVdtLSA.PIETITPR..G....-.......-.....--..VRT...............SER....---.....--EY.E
1tdeA  ...-...N.IILH..TNR.TLEEVTGD..Q....M.......G.....VTg.VRL...............RDTqn..SDN.....IESL.D
1cl0A  ...-...N.IILH..TNR.TLEEVTGD..Q....M.......G.....VTg.VRL...............RDTqn..SDN.....IESL.D
1f6mA  ...-...N.IILH..TNR.TLEEVTGD..Q....M.......G.....VTg.VRL...............RDTqn..SDN.....IESL.D
1typA  ...-...G.INVR..THE.NPAKVTKN..A....D.......G.....TRh.VVF...............ESG....---.....-AEA.D
1tytA  ...-...G.INVR..THE.NPAKVTKN..A....D.......G.....TRh.VVF...............ESG....---.....-AEA.D
1fecA  ...-...G.INVR..THE.NPAKVTKN..A....D.......G.....TRh.VVF...............ESG....---.....-AEA.D
2tprA  ...-...G.INVR..THE.NPAKVTKN..A....D.......G.....TRh.VVF...............ESG....---.....-AEA.D
1ju2A  ...GnsnN.LRVG..VHA.SVEKIIFS..N....A.......Pglt..ATg.VIY...............RDS....NGT.....PHQA.F
1tdfA  ...-...N.IILH..TNR.TLEEVTGD..Q....M.......G.....VTg.VRL...............RDTqn..SDN.....IESL.D
1trbA  ...-...N.IILH..TNR.TLEEVTGD..Q....M.......G.....VTg.VRL...............RDTqn..SDN.....IESL.D
1gxfA  ...-...G.IQIL..TKE.NPAKVELN..A....D.......G.....SKs.VTF...............ESG....---.....-KKM.D
1bzlA  ...-...G.IQIL..TKE.NPAKVELN..A....D.......G.....SKs.VTF...............ESG....---.....-KKM.D
1ndaA  ...-...G.IQIL..TKE.NPAKVELN..A....D.......G.....SKs.VTF...............ESG....---.....-KKM.D
1aogA  ...-...G.IQIL..TKE.NPAKVELN..A....D.......G.....SKs.VTF...............ESG....---.....-KKM.D
1onfA  ...-...N.INIV..TFA.DVVEIKKV..S....D.......K.....NLs.IHL...............SDG....---.....-RIYeH
1xanA  ...-...G.VEVL..KFS.QVKEVKKT..L....S.......Gle...VSm.VTA...............VPG....--Rlpvm.TM-IpD
3grsA  ...-...G.VEVL..KFS.QVKEVKKT..L....S.......Gle...VSm.VTA...............VPG....--Rlpvm.TM-IpD
1fl2A  ...K...N.VDII..LNA.QTTEVKGD..G....S.......K.....VVg.LEY...............RDRv...SGD.....IHNI.E
1l9cA  ...-...G.AKVL..THT.RVEDFDIS..P....D.......S.....VK..IET...............ANG....---.....--SY.T
2gf3A  ...-...G.AKVL..THT.RVEDFDIS..P....D.......S.....VK..IET...............ANG....---.....--SY.T
3bhkA  ...-...G.AKVL..THT.RVEDFDIS..P....D.......S.....VK..IET...............ANG....---.....--SY.T
3grtA  ...-...G.VEVL..KFS.QVKEVKKT..L....S.......Gle...VSm.VTA...............VPG....--Rlpvm.TM-IpD
1grtA  ...-...G.VEVL..KFS.QVKEVKKT..L....S.......Gle...VSm.VTA...............VPG....--Rlpvm.TM-IpD
1hyuA  ...K...N.VDII..LNA.QTTEVKGD..G....S.......K.....VVg.LEY...............RDRv...SGD.....IHSV.A
1w4xA  fnrD...N.VHLVdtLSA.PIETITPR..G....-.......-.....--..VRT...............SER....---.....--EY.E
1sezA  ...Lr..E.DELR..LNS.RVLELSCSctEdsaiD.......S.....WS..IIS...............ASPh...KRQ.....SEEE.S
1h6vA  ...-...G.IKFI..RQF.VPTKIEQI..EagtpG.......R.....LK..VTA...............KSTn...SEE.....TIED.E
1rp0A  ...P...N.VKLF..NAV.AAEDLIVK..G....N.......R.....VGg.VVTnwalvaqnhhtqsc.MDP....---.....-NVM.E
2f5vA  ...-...-.----..---.EIESLHIH..D....-.......-.....--..LIS...............GDR....---.....-FEI.K
2f6cA  ...-...-.----..---.EIESLHIH..D....-.......-.....--..LIS...............GDR....---.....-FEI.K
1tzlA  ...-...-.----..---.EIESLHIH..D....-.......-.....--..LIS...............GDR....---.....-FEI.K
2gv8A  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1vqwA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
2ignA  ...-...-.----..---.EIESLHIH..D....-.......-.....--..LIS...............GDR....---.....-FEI.K
1vdcA  ...P...K.IDVI..WNS.SVVEAYGD..G....E.......Rd....VLggLKV...............KNVv...TGD.....VSDL.K
1ng4A  ...-...G.AEIF..EHT.PVLHVERD..G....E.......A.....LF..IKT...............PSG....---.....--DV.W
1ryiA  ...-...G.AEIF..EHT.PVLHVERD..G....E.......A.....LF..IKT...............PSG....---.....--DV.W
1xdiA  ...-...G.VRLF..KNA.RAASVTRT..G....A.......G.....VL..VTM...............TDG....---.....-RTV.E
2vouA  ...F...GpERYH..TSK.CLVGLSQD..S....E.......T.....VQ..MRF...............SDG....---.....-TKA.E
1xhcA  ...-...G.VKFF..LNS.ELLEANEE..G....-.......-.....--..VLT...............NSG....---.....--FI.E
1b8sA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
1n4wA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
3cnjA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
1q1rA  ...A...G.VDIR..TGT.QVCGFEMS..T....D.......Qqk...VTa.VLC...............EDG....---.....-TRL.P
1f8wA  ...-...N.ITIA..TGE.TVERYEGD..G....-.......R.....VQk.VVT...............DKN....---.....--AY.D
1nhqA  ...-...N.ITIA..TGE.TVERYEGD..G....-.......R.....VQk.VVT...............DKN....---.....--AY.D
1nhrA  ...-...N.ITIA..TGE.TVERYEGD..G....-.......R.....VQk.VVT...............DKN....---.....--AY.D
1ijhA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
3b6dA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
1cc2A  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
3b3rA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
1npxA  ...-...N.ITIA..TGE.TVERYEGD..G....-.......R.....VQk.VVT...............DKN....---.....--AY.D
1cboA  ...G...K.VTIQ..TLH.QVKTIRQT..K....D.......Ggya..LT..VEQ...............KDT....DGKlla..TKEI.S
1nhsA  ...-...N.ITIA..TGE.TVERYEGD..G....-.......R.....VQk.VVT...............DKN....---.....--AY.D
1nhpA  ...-...N.ITIA..TGE.TVERYEGD..G....-.......R.....VQk.VVT...............DKN....---.....--AY.D
1mo9A  ...-...G.MEII..SGS.NVTRIEED..A....N.......Gr....VQa.VVA...............MTP....NGE.....-MRI.E
1fcdA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1m6iA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1gv4A  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
3coxA  ...-...K.LTIT..TLH.RVTKVAPAt.G....S.......G.....YS..VTM...............EQI....DEQgnvvaTKVV.T
1d7yA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1d7yA  ...-...G.VDLR..FER.SVTGSVDG..V....-.......-.....--..VLL...............DDG....---.....-TRI.A
1fcdA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1ps9A  ...-...G.VKMI..PGV.SYQKIDDD..G....L.......H.....VV..I--...............---....NGE.....TQVL.A
1djnA  ...F...C.SRIE..PGRmEIYNIWGD..G....S.......KrtyrgPG..VSP...............RDA....NTS.....HRWI.E
1djqA  ...F...C.SRIE..PGRmEIYNIWGD..G....S.......KrtyrgPG..VSP...............RDA....NTS.....HRWI.E
2culA  ...-...R.PLHL..FQA.TATGLLLE..G....N.......R.....VVg.VRT...............WEG....---.....-PPA.R
1gv4A  ...-...G.VKVM..PNA.IVQSVGVS..G....G.......R.....LL..IKL...............KDG....---.....-RKV.E
1m6iA  ...-...G.VKVM..PNA.IVQSVGVS..S....G.......K.....LL..IKL...............KDG....---.....-RKV.E
1nhrA  ...-...G.VNVF..SNT.EITAIQPK..E....H.......Q.....--..VTV...............KDLv...SGE.....ERVE.N
1nhqA  ...-...G.VNVF..SNT.EITAIQPK..E....H.......Q.....--..VTV...............KDLv...SGE.....ERVE.N
2gv8A  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1vqwA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1gndA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1lv0A  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1d5tA  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
3cpiG  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
2bcgG  ...-...-.----..---.--------..-....-.......-.....--..---...............---....---.....----.-
1fcdA  ...-...-.----..---.-------D..G....G.......E.....MM..VET...............AFG....---.....-DEF.K


                290          300                                                                    
                  |            |                                                                    
d1f8ra1  A...DYVIVCTTSRA...VRLIKFN..................................................................
2dw4A  C...DAVLCTLPLGV...LKQQPPAvqfv..............................................................
2h94A  C...DAVLCTLPLGV...LKQQPPAvqfv..............................................................
2iw5A  C...DAVLCTLPLGV...LKQQPPAvqfv..............................................................
2z3yA  C...DAVLCTLPLGV...LKQQPPAvqfv..............................................................
1ltxR  -...-----------...-------..................................................................
1vg0A  -...-----------...-------..................................................................
1jnrA  A...KAVILATGGATl..LFRPRSTgeaagrtwyaifdtgsgyymglkagamltqfehrfipfrfkdgygpvgawflffkckaknaygeey
2c76A  A...KYVISAIPPTL...GMKIHFN..................................................................
2v5zA  A...KYVISAIPPTL...GMKIHFN..................................................................
2bk5A  A...KYVISAIPPTL...GMKIHFN..................................................................
2c73A  A...KYVISAIPPTL...GMKIHFN..................................................................
2c75A  A...KYVISAIPPTL...GMKIHFN..................................................................
2c72A  A...KYVISAIPPTL...GMKIHFN..................................................................
1o5wA  C...KYVISAIPPIL...TAKIHFK..................................................................
1nekA  A...RATVLATGGAGr..I-YQSTTnahintgdgvgmairagvpvqdmemwqfhptgiagagvlvtegcrgeggyllnkhgerfmeryapn
1chuA  A...KAVVLATGGASk..VYQYTTN..................................................................
1cf3A  Ak..HEVLLAAGSAV...SPTILEYsgigmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgdysekah
1knrA  A...KAVVLATGGASk..VYQYTTN..................................................................
2b76A  A...NAVVMATGGAG...RVYRYNTnggivtgdgmgmalshgvplrdmefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmg
1kf6A  A...NAVVMATGGAG...RVYRYNTnggivtgdgmgmalshgvplrdmefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmg
3cirA  A...NAVVMATGGAG...RVYRYNTnggivtgdgmgmalshgvplrdmefvqyhpaglpgsgilmtegcrgeggilvnkngyrylqdygmg
1ebdA  A...DYVLVTVGRRP...NTDELG-..................................................................
1gpeA  -...-----------...-------..................................................................
3cpiG  A...PLVIA------...-------..................................................................
2bcgG  A...PLVIA------...-------..................................................................
1d4cA  A...DAVVIAAGGFAk..NNERVSKydpklkgfkatnhpgatgdgldvalqagaatrdleyiqahptyspaggvmiteavrgngaivvnre
1d4dA  A...DAVVIAAGGFAk..NNERVSKydpklkgfkatnhpgatgdgldvalqagaatrdlqyiqahptyspaggvmiteavrgngaivvnre
1d5tA  C...KQLICDPSYVPd..RVR----..................................................................
1gndA  C...KQLICDPSYVPd..RVR----..................................................................
1lv0A  C...KQLICDPSYVPd..RVR----..................................................................
1dxlA  A...DVVLVSAGRTP...FTSGLN-..................................................................
3c96A  A...DVLVGADGIHSa..VRAHLHP..................................................................
2i0zA  T...NHVVIAVGGKS...VPQTGS-..................................................................
1lpfA  F...DKLIVAVGRRPv..TTDLLA-..................................................................
1reoA  A...DYVIVCTTSRA...TRRIKFE..................................................................
2gmhA  A...KVTIFAEGCHGh..LAKQLYKkfdlrancepqtygiglkelwvidekkwkpgrvdhtvgwpldrhtygg..................
1qo8A  A...KSVVLATGGYGm..NKEMIAYyrptmkdmtssnnitatgdgvlmakeigasmtdidwvqahptvgkdsrilisetvrgvgavmvnkd
2gqfA  C...KNLIVATGGLS...MPGLGATpfgyqiaeqfgipvippraslvpftyretdkfltalsgislpvtitalcgksfynqllfthrgisg
1pj5A  A...DIVVSCAGFWGak.IGAMIGMavpllplahqyvkttpvpaqqgrndqpngarlpi................................
1b5qA  A...DYVMVSASLGVlq.SDLIQFK..................................................................
2iidA  A...DYVIVCTTSRA...VRLIKFN..................................................................
2ivdA  V...AQVVLAAPAHA...TAKLL--..................................................................
1q9iA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1jryA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1p2eA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1p2hA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1y0pA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1ksuA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1jrzA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1jrxA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1kssA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavrgngailvnre
1v59A  A...EVLLVAVGRRP...YIAGLG-..................................................................
2b7rA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvtdavrgngailvnre
2b7sA  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqahptlsvkggvmvteavkgngailvnre
3ladA  F...DKLIVAVGRRPv..TTDLLA-..................................................................
1m64A  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyifahptlsvkggvmvteavrgngailvnre
1lj1A  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyifahptlsvkggvmvteavrgngailvnre
1e39A  A...DAVILATGGFAk..NNERVAKldpslkgfistnqpgavgdgldvaenaggalkdmqyiqaaptlsvkggvmvteavrgngailvnre
2gjcA  A...HGTQCCMDPNV...-------..................................................................
1pn0A  C...KYVIGCDGGHSw..VRRTLGFemigeqtdyiwgvldavpasnfpdirsrca....................................
1ykjA  C...DYIAGCDGFHGi..SRQSIPAerlkvfervypfgwlglladt.............................................
1pxbA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1k0iA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1dobA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1iutA  C...DYIAGCDGFHGi..SRQSIPAerlkvfervypfgwlglladt.............................................
1pxcA  C...DYIAGCDGFHGi..SRQSIPAerlkvfervypfgwlglladt.............................................
1pbeA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1cj2A  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1cc4A  C...DYIAGCDGAHGi..SRQSIPAerlkvferv.........................................................
1bgnA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1fohA  C...KYVIGCDGGHSw..VRRTLGFemigeqtdyiwgvldavpasnfpdirsrca....................................
1pbdA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1pbfA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1cj3A  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1bgjA  C...DYIAGCDGFRGi..SRQSIPAerlkvferv.........................................................
1bf3A  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1cj4A  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1bkwA  C...DYIAGCDGFHGi..SRQSIPAerlkvferv.........................................................
1pxaA  C...DYIAGCDGFHGi..SRQSIPAerlkvfervypfgwlglladt.............................................
1cc6A  C...DYIAGCDGFHGi..SSQSIPAerlkvfervypfgwlglladt.............................................
1gesA  V...DCLIWAIGREP...ANDNIN-..................................................................
2bs3A  A...KGTLIATGGYGr..IYKNTTNavvcegtgtaialetgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfm......
1qlbA  A...KGTLIATGGYGr..IYKNTTNavvcegtgtaialetgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfm......
2bs2A  A...KGTLIATGGYGr..IYKNTTNavvcegtgtaialetgiaqlgnmeavqfhptplfpsgilltegcrgdggilrdvdghrfm......
1bhyA  Y...DAVLVAAGRAP...NGKLIS-..................................................................
1ojtA  Y...DAVLVAAGRAP...NGKLIS-..................................................................
1cjcA  -...-----------...-------..................................................................
1gerA  V...DCLIWAIGREP...ANDNIN-..................................................................
1lvlA  A...DRVLVAVGRRP...RTKGFN-..................................................................
1kdgA  K...GRVILSAGAFG...TSRILFQsgigptdmiqtvqsnptaaaalppqnqwinlpvgmnaqdnpsinlvfthpsidayenwadvwsnpr
1naaA  K...GRVILSAGAFG...TSRILFQsgigptdmiqtvqsnptaaaalppqnqwinlpvgmnaqdnpsinlvfthpsidayenwadvwsnpr
1w4xA  L...DSLVLATG---...-------..................................................................
1tdeA  V...AGLFVAIGHSP...NTAIFE-..................................................................
1cl0A  V...AGLFVAIGHSP...NTAIFE-..................................................................
1f6mA  V...AGLFVAIGHSP...NTAIFE-..................................................................
1typA  Y...DVVMLAIGRVP...RSQTLQ-..................................................................
1tytA  Y...DVVMLAIGRVP...RSQTLQ-..................................................................
1fecA  Y...DVVMLAIGRVP...RSQTLQ-..................................................................
2tprA  Y...DVVMLAIGRVP...RSQTLQ-..................................................................
1ju2A  VrskGEVIVSAGTIG...TPQLLL-..................................................................
1tdfA  V...AGLFVAIGHSP...NTAIFE-..................................................................
1trbA  V...AGLFVAIGHSP...NTAIFE-..................................................................
1gxfA  F...DLVMMAIGRSP...RTKDLQ-..................................................................
1bzlA  F...DLVMMAIGRSP...RTKDLQ-..................................................................
1ndaA  F...DLVMMAIGRSP...RTKDLQ-..................................................................
1aogA  F...DLVMMAIGRSP...RTKDLQ-..................................................................
1onfA  F...DHVIYCVGRSP...DTENLK-..................................................................
1xanA  V...DCLLWAIGRVP...NTKDLS-..................................................................
3grsA  V...DCLLWAIGRVP...NTKDLS-..................................................................
1fl2A  L...AGIFVQIGLLP...NTNWLE-..................................................................
1l9cA  A...DKLIVSMGAWN...-SKLLSKlnldiplqpyrqvvgffesdeskysndid.....................................
2gf3A  A...DKLIVSMGAWN...-SKLLSKlnldiplqpyrqvvgffesdeskysndid.....................................
3bhkA  A...DKLIVSMGAWN...-SKLLSKlnldiplqpyrqvvgffesdeskysndid.....................................
3grtA  V...DCLLWAIGRVP...NTKDLS-..................................................................
1grtA  V...DCLLWAIGRVP...NTKDLS-..................................................................
1hyuA  L...AGIFVQIGLLP...NTHWLE-..................................................................
1w4xA  L...DSLVLATGFDA...LTGALF-..................................................................
1sezA  F...DAVIMTAPLCDvk.SMKIAKRgnpfllnfipevdyvplsvvittfkrenvkyplegfgvlvpskeqqhglktlgtlfss........
1h6vA  F...NTVLLAVGRDS...CTRTIG-..................................................................
1rp0A  A...KIVVSSCGHDGpfgATGVKR-..................................................................
2f5vA  A...DVYVLTAGAVH...NTQLLVNsgfgqlgrpnptnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytp
2f6cA  A...DVYVLTAGAVH...NTQLLVNsgfgqlgrpnptnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytp
1tzlA  A...DVYVLTAGAVH...NTQLLVNsgfgqlgrpnptnppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytp
2gv8A  -...-----------...-------..................................................................
1vqwA  -...-----------...-------..................................................................
2ignA  A...DVYVLTAGAVH...NTQLLVNsgfgqlgrpnpanppellpslgsyiteqslvfcqtvmstelidsvksdmtirgtpgeltysvtytp
1vdcA  V...SGLFFAIGHEP...ATKFLD-..................................................................
1ng4A  A...NHVVVASGVWSgm.FFKQLGLnnaflpvkgeclsvwnddipltktlyhdhc....................................
1ryiA  A...NHVVVASGVWSgm.FFKQLGLnnaflpvkgeclsvwnddipltktly........................................
1xdiA  G...SHALMTIGSVP...NTSGLG-..................................................................
2vouA  A...NWVIGADGGASvv.RKRLLGIept...............................................................
1xhcA  G...KVKICAIGIVP...NVDLA--..................................................................
1b8sA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgi..................
1n4wA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgi..................
3cnjA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgi..................
1q1rA  A...DLVIAGIGLIP...NCELA--..................................................................
1f8wA  A...DLVVVAVGVRP...NTAWLK-..................................................................
1nhqA  A...DLVVVAVGVRP...NTAWLK-..................................................................
1nhrA  A...DLVVVAVGVRP...NTAWLK-..................................................................
1ijhA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgidaw...............
3b6dA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipa.....................
1cc2A  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipa.....................
3b3rA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipa.....................
1npxA  A...DLVVVAVGVRP...NTAWLK-..................................................................
1cboA  C...RYLFLGAGSLG...STELLVRardtgtlpnlnsevgagwgpngnimtaranhmwnptgahqssi.......................
1nhsA  A...DLVVVAVGVRP...NTAWLK-..................................................................
1nhpA  A...DLVVVAVGVRP...NTAWLK-..................................................................
1mo9A  T...DFVFLGLGEQPr..SAELAK-..................................................................
1fcdA  -...-----------...-------..................................................................
1m6iA  -...-----------...-------..................................................................
1gv4A  -...-----------...-------..................................................................
3coxA  A...DRVFFAAGSVG...TSKLLVSmkaqghlpnlssqvgegwgnngnimvgranhmwdatgskqatiptmgidnwadptapifaeiap..
1d7yA  -...-----------...-------..................................................................
1d7yA  A...DMVVVGIGVLA...NDALA--..................................................................
1fcdA  -...-----------...-------..................................................................
1ps9A  V...DNVVICAG---...-------..................................................................
1djnA  F...DSLVLVTGRHS...ECTLW--..................................................................
1djqA  F...DSLVLVTGRHS...ECTLW--..................................................................
2culA  G...EKVVLAVGSFLg..ARLFLGGvveeagrls.........................................................
1gv4A  T...DHIVTAVGLEP...NVELAK-..................................................................
1m6iA  T...DHIVAAVGLEP...NVELAK-..................................................................
1nhrA  Y...DKLIISPGAVP...-------..................................................................
1nhqA  Y...DKLIISPGAVP...-------..................................................................
2gv8A  I...DRVIYCTGYLYsvpFPSLAK-..................................................................
1vqwA  I...DRVIYCTGYLYsvpFPSLAK-..................................................................
1gndA  -...-----------...-------..................................................................
1lv0A  -...-----------...-------..................................................................
1d5tA  -...-----------...-------..................................................................
3cpiG  -...-----------...-------..................................................................
2bcgG  -...-----------...-------..................................................................
1fcdA  A...DVINLI-----...-------..................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  ...........................................................................................
1vg0A  ...........................................................................................
1jnrA  iktraaelekykpygaaqpiptplrnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafedfldmtvsqallwacqnidpqeq
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  akdlagrdvvarsimieiregrgcdgpwgphaklkldhlgkevlesrlpgilelsrtfahvdpvkep........................
1chuA  ...........................................................................................
1cf3A  ellntkleqwaeeavarggf.......................................................................
1knrA  ...........................................................................................
2b76A  petplgepknkymelgprdkvsqafwhewrkgntistprgdvvy...............................................
1kf6A  petplgepknkymelgprdkvsqafwhewrkgntistprgdvvy...............................................
3cirA  petplgepknkymelgprdkvsqafwhewrkgntistprgdvvy...............................................
1ebdA  ...........................................................................................
1gpeA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  gnrfmneittrdkasaailqqkgesaylvfddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqfer
1d4dA  gnrfmneittrdkasaailqqkgesaylvfddsirkslkaiegyvhlnivkegktieelakqidvpaaelaktvtayngfvksgkdaqfer
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  gnrfiselttrdkasdailkqpgqfawiifdnqlykkakmvrgydhlemlykgdtveqlakstgmkvadlaktvsdyngyvasgkdtafgr
2gqfA  pavlqisnyw.................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  gkrfvneittrdkasaailaqtgksaylifddsvrkslckidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1jryA  gkrfvneittkdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1p2eA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1p2hA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1y0pA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1ksuA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1jrzA  gkrfvneittydkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1jrxA  gkrfvneittadkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1kssA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1v59A  ...........................................................................................
2b7rA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
2b7sA  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
3ladA  ...........................................................................................
1m64A  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1lj1A  gkrfvneittadkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
1e39A  gkrfvneittrdkasaailaqtgksaylifddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdfer
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  padaaqylanqsgvfagaspklnfwraysgsdgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgtvlt..
1naaA  padaaqylanqsgvfagaspklnfwraysgsdgftryaqgtvrpgaasvnsslpynasqiftitvylstgiqsrgrigidaalrgtvlt..
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  ...........................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  gastnkhpdwwnekvknhmmqhqedp.................................................................
2f6cA  gastnkhpdwwnekvknhmmqhqedplpipfedpe........................................................
1tzlA  gastnkhpdwwnekvknhmmqhqedp.................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  gastnkhpdwwnekvknhmmqhqe...................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ..........PPLL.............................................................................
2dw4A  ..........PPLP.............................................................................
2h94A  ..........PPLP.............................................................................
2iw5A  ..........PPLP.............................................................................
2z3yA  ..........PPLP.............................................................................
1ltxR  ..........----.............................................................................
1vg0A  ..........----.............................................................................
1jnrA  .....pseaaPAEP.............................................................................
2c76A  ..........PPLP.............................................................................
2v5zA  ..........PPLP.............................................................................
2bk5A  ..........PPLP.............................................................................
2c73A  ..........PPLP.............................................................................
2c75A  ..........PPLP.............................................................................
2c72A  ..........PPLP.............................................................................
1o5wA  ..........PELP.............................................................................
1nekA  ..........IPVI.............................................................................
1chuA  ..........PDISsgdgiamawragcrvanlefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
1cf3A  ..........H---.............................................................................
1knrA  ..........PDISsgdgiamawragcrvanlefnqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivarai
2b76A  ..........L--Dlrhlgekklherlpficelakay......................................................
1kf6A  ..........L--Dlrhlgekklherlpficelakay......................................................
3cirA  ..........L--Dlrhlgekklherlpficelakay......................................................
1ebdA  ..........----.............................................................................
1gpeA  ..........----.............................................................................
3cpiG  ..........----.............................................................................
2bcgG  ..........----.............................................................................
1d4cA  ..........PDLP.............................................................................
1d4dA  ..........PDLP.............................................................................
1d5tA  ..........----.............................................................................
1gndA  ..........----.............................................................................
1lv0A  ..........----.............................................................................
1dxlA  ..........----.............................................................................
3c96A  ..........DQRPlshggitmwrgvtefdrfldgktmivandehwsrlvaypisarhaaegkslvnwvcmvpsaavgqldneadwnrdgr
2i0zA  ..........----.............................................................................
1lpfA  ..........----.............................................................................
1reoA  ..........PPLP.............................................................................
2gmhA  ..........S--Flyhlnegepllalgfvvgldyqnpylspfrefqrwkhh.......................................
1qo8A  admplnmtqsPYYA.............................................................................
2gqfA  ..........Q--Ptesveidllpnhnveeeinqakqsspkqmlktilvrllpkklvelwieqgivq........................
1pj5A  ..........L--Rhqdqdlyyrehgdrygigsyahrpmpvdvdtlgayapetvsehhmpsrldftledflpaweat..............
1b5qA  ..........PKLP.............................................................................
2iidA  ..........PPLL.............................................................................
2ivdA  ..........RPLD.............................................................................
1q9iA  ..........PNLP.............................................................................
1jryA  ..........PNLP.............................................................................
1p2eA  ..........PNLP.............................................................................
1p2hA  ..........PNLP.............................................................................
1y0pA  ..........PNLP.............................................................................
1ksuA  ..........PNLP.............................................................................
1jrzA  ..........PNLP.............................................................................
1jrxA  ..........PNLP.............................................................................
1kssA  ..........PNLP.............................................................................
1v59A  ..........----.............................................................................
2b7rA  ..........PNLP.............................................................................
2b7sA  ..........PNLP.............................................................................
3ladA  ..........----.............................................................................
1m64A  ..........PNLP.............................................................................
1lj1A  ..........PNLP.............................................................................
1e39A  ..........PNLP.............................................................................
2gjcA  ..........---Ielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidq..................................
1pn0A  ..........I---.............................................................................
1ykjA  ..........P--Pvsheliyanhprgfalcsqrs........................................................
1pxbA  ..........Y--Pfgwlglladtppvshelifanhprgfalcsqrs............................................
1k0iA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1dobA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1iutA  ..........P--Pvsheliyanhprgfalcsqrs........................................................
1pxcA  ..........P--Pvsheliyanhprgfalcsqrs........................................................
1pbeA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1cj2A  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1cc4A  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1bgnA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1fohA  ..........I---.............................................................................
1pbdA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1pbfA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1cj3A  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1bgjA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1bf3A  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1cj4A  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1bkwA  ..........Y--Pfgwlglladtppvsheliyanhprgfalcsqrs............................................
1pxaA  ..........P--Pvsheliyanhprgfalcsqrs........................................................
1cc6A  ..........P--Pvsheliyanhprgfalcsqrs........................................................
1gesA  ..........----.............................................................................
2bs3A  ..........P--Dyepekkelasrdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyf...............
1qlbA  ..........P--Dyepekkelasrdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyf...............
2bs2A  ..........P--Dyepekkelasrdvvsrrmiehirkgkgvqspygqhlwldisilgrkhietnlrdvqeiceyf...............
1bhyA  ..........----.............................................................................
1ojtA  ..........----.............................................................................
1cjcA  ..........----.............................................................................
1gerA  ..........----.............................................................................
1lvlA  ..........----.............................................................................
1kdgA  ..........P--Pwlvnpvdktvll.................................................................
1naaA  ..........P--Pwlvnpvdktvll.................................................................
1w4xA  ..........----.............................................................................
1tdeA  ..........----.............................................................................
1cl0A  ..........----.............................................................................
1f6mA  ..........----.............................................................................
1typA  ..........----.............................................................................
1tytA  ..........----.............................................................................
1fecA  ..........----.............................................................................
2tprA  ..........----.............................................................................
1ju2A  ..........----.............................................................................
1tdfA  ..........----.............................................................................
1trbA  ..........----.............................................................................
1gxfA  ..........----.............................................................................
1bzlA  ..........----.............................................................................
1ndaA  ..........----.............................................................................
1aogA  ..........----.............................................................................
1onfA  ..........----.............................................................................
1xanA  ..........----.............................................................................
3grsA  ..........----.............................................................................
1fl2A  ..........----.............................................................................
1l9cA  ..........F--Pgfmvevpngiyygfpsfggcglklgyntfgqkidpdtinrefgvypedesnlrafl.....................
2gf3A  ..........F--Pgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlrafl.....................
3bhkA  ..........F--Pgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlrafl.....................
3grtA  ..........----.............................................................................
1grtA  ..........----.............................................................................
1hyuA  ..........----.............................................................................
1w4xA  ..........----.............................................................................
1sezA  ..........M---.............................................................................
1h6vA  ..........----.............................................................................
1rp0A  ..........----.............................................................................
2f5vA  ..........L---.............................................................................
2f6cA  ..........P---.............................................................................
1tzlA  ..........L---.............................................................................
2gv8A  ..........----.............................................................................
1vqwA  ..........----.............................................................................
2ignA  ..........D---.............................................................................
1vdcA  ..........----.............................................................................
1ng4A  ..........Y--Ivprksgrlvvgatmkpgdwsetpdlgglesvmkka..........................................
1ryiA  ..........H--Dhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkka......................................
1xdiA  ..........----.............................................................................
2vouA  ..........Y---.............................................................................
1xhcA  ..........----.............................................................................
1b8sA  ..........D---.............................................................................
1n4wA  ..........D---.............................................................................
3cnjA  ..........D---.............................................................................
1q1rA  ..........----.............................................................................
1f8wA  ..........----.............................................................................
1nhqA  ..........----.............................................................................
1nhrA  ..........----.............................................................................
1ijhA  ..........D---.............................................................................
3b6dA  ..........L---.............................................................................
1cc2A  ..........L---.............................................................................
3b3rA  ..........L---.............................................................................
1npxA  ..........----.............................................................................
1cboA  ..........P---.............................................................................
1nhsA  ..........----.............................................................................
1nhpA  ..........----.............................................................................
1mo9A  ..........----.............................................................................
1fcdA  ..........----.............................................................................
1m6iA  ..........----.............................................................................
1gv4A  ..........----.............................................................................
3coxA  ..........L--Pagletyvslylaitknperarfqfnsgtgkvdltwaqsqnqkgidmakkvfdkinqkegtiyrtdlfg.........
1d7yA  ..........----.............................................................................
1d7yA  ..........----.............................................................................
1fcdA  ..........----.............................................................................
1ps9A  ..........----.............................................................................
1djnA  ..........----.............................................................................
1djqA  ..........----.............................................................................
2culA  ..........E---.............................................................................
1gv4A  ..........----.............................................................................
1m6iA  ..........----.............................................................................
1nhrA  ..........----.............................................................................
1nhqA  ..........----.............................................................................
2gv8A  ..........----.............................................................................
1vqwA  ..........----.............................................................................
1gndA  ..........----.............................................................................
1lv0A  ..........----.............................................................................
1d5tA  ..........----.............................................................................
3cpiG  ..........----.............................................................................
2bcgG  ..........----.............................................................................
1fcdA  ..........---P.............................................................................


                                              310                         320                       
                                                |                           |                       
d1f8ra1  ................................PKK....AH....A.........LRS....VXFT.P.............YQFQHF....
2dw4A  ................................EWK....TS....A.........VQR....MGFG.Nln...........KVVLCF....
2h94A  ................................EWK....TS....A.........VQR....MGFG.Nln...........KVVLCF....
2iw5A  ................................EWK....TS....A.........VQR....MGFG.Nln...........KVVLCF....
2z3yA  ................................EWK....TS....A.........VQR....MGFG.Nln...........KVVLCF....
1ltxR  ................................---....--....-.........---....----.-.............------....
1vg0A  ................................---....--....-.........---....----.-.............------....
1jnrA  ................................YIM....GS....H.........SGE....AGFW.Vcgpedlmpee...Y-----....
2c76A  ................................MMR....NQ....M.........ITR....VPLG.Svi...........KCIVYY....
2v5zA  ................................MMR....NQ....M.........ITR....VPLG.Svi...........KCIVYY....
2bk5A  ................................MMR....NQ....M.........ITR....VPLG.Svi...........KCIVYY....
2c73A  ................................MMR....NQ....M.........ITR....VPLG.Svi...........KCIVYY....
2c75A  ................................MMR....NQ....M.........ITR....VPLG.Svi...........KCIVYY....
2c72A  ................................MMR....NQ....M.........ITR....VPLG.Svi...........KCIVYY....
1o5wA  ................................PER....NQ....L.........IQR....LPMGaVi............KCMVYY....
1nekA  ................................PTC....HY....M.........MGG....IPTK.Vt............GQALTV....
1chuA  dhemkrlgadcmfldishkpadfirqhfpmiyE--....--....KllglgidltQEP....VPIV.Paahyt........CGGVMV....
1cf3A  ................................---....--....-.........---....----.-.............------....
1knrA  dhemkrlgadcmfldishkpadfirqhfpmiyE--....--....KllglgidltQEP....VPIV.Paahyt........CGGVMV....
2b76A  ................................VGV....DP....V.........KEP....IPVR.Ptahyt........MGGIET....
1kf6A  ................................VGV....DP....V.........KEP....IPVR.Ptahyt........MGGIET....
3cirA  ................................VGV....DP....V.........KEP....IPVR.Ptahyt........MGGIET....
1ebdA  ................................---....--....-.........LEQ....IGIKmTn............RGLIEV....
1gpeA  ................................---....--....-.........---....----.-.............------....
3cpiG  ................................---....--....-.........---....----.-.............------....
2bcgG  ................................---....--....-.........---....----.-.............------....
1d4cA  ................................RELvvapFY....A.........LEI....APAV.Hht...........MGGLVI....
1d4dA  ................................RELvvapFY....A.........LEI....APAV.Hht...........MGGLVI....
1d5tA  ................................---....--....-.........---....----.-.............------....
1gndA  ................................---....--....-.........---....----.-.............------....
1lv0A  ................................---....--....-.........---....----.-.............------....
1dxlA  ................................---....--....-.........LDK....IGVE.Tdk...........LGRILV....
3c96A  ...............................lEDV....LP....F.........FAD....WDLG.WfdirdlltrnqliLQYPMVd...
2i0zA  ................................---....--....-.........-TG....DGYA.Wae...........KAGHTI....
1lpfA  ................................---....--....-.........-AD....SGVTlDe............RGFIYV....
1reoA  ................................PKK....AH....A.........LRS....VHYR.Sgt...........KIFLTC....
2gmhA  ................................PSI....KP....T.........LEG....GKRI.A.............YGARAL....
1qo8A  ................................VKV....AP....G.........IH-....----.Ht............MGGVAI....
2gqfA  ................................DEV....IA....N.........ISK....VRVK.Nl............VDFIHH....
1pj5A  ................................KQL....LP....A.........LAD....SEIE.Dgfn..........GIFSFT....
1b5qA  ................................TWK....VR....A.........IYQ....FDMA.Vyt...........KIFLKF....
2iidA  ................................PKK....AH....A.........LRS....VHYR.Sgt...........KIFLTC....
2ivdA  ................................DAL....AA....L.........VAG....IAYA.Pia...........VVHLGF....
1q9iA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1jryA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1p2eA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1p2hA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1y0pA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1ksuA  ................................RAL....NEg...N.........YYA....IEVT.Pgvhyt........MGGVMI....
1jrzA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1jrxA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1kssA  ................................RAL....NEg...N.........YYA....IEVT.Pgvhat........MGGVMI....
1v59A  ................................---....--....-.........AEK....IGLEvDk............RGRLVI....
2b7rA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
2b7sA  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
3ladA  ................................---....--....-.........-AD....SGVTlDe............RGFIYV....
1m64A  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1lj1A  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
1e39A  ................................RAL....NEgnyyA.........IEV....T---.Pgvhht........MGGVMI....
2gjcA  ................................NQK....LG....G.........MKG....LDMN.Ha............EHDVVI....
1pn0A  ................................---....--....-.........---....----.-.............------....
1ykjA  ................................ATR....SR....Y.........YVQ....VPLS.E.............KVEDWS....
1pxbA  ................................ATR....SR....Y.........YVQ....VPLS.E.............KVEDWS....
1k0iA  ................................ATR....SQ....Y.........YVQ....VPLS.E.............KVEDWS....
1dobA  ................................ATR....SR....Y.........FVQ....VPLS.E.............KVEDWS....
1iutA  ................................ATR....SR....Y.........YVQ....VPLS.E.............KVEDWS....
1pxcA  ................................ATR....SR....Y.........YVQ....VPLS.E.............KVEDWS....
1pbeA  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1cj2A  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1cc4A  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1bgnA  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1fohA  ................................---....--....-.........---....----.-.............------....
1pbdA  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1pbfA  ................................ATR....SR....Y.........AVQ....VPLT.E.............KVEDWS....
1cj3A  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1bgjA  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1bf3A  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1cj4A  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1bkwA  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1pxaA  ................................ATR....SR....Y.........YVQ....VPLS.E.............KVEDWS....
1cc6A  ................................ATR....SR....Y.........YVQ....VPLT.E.............KVEDWS....
1gesA  ................................---....--....-.........LEA....AGVK.Tne...........KGYIVV....
2bs3A  ................................A--....--....G.........IDPaekwAPVL.Pmqhys........MGGIRT....
1qlbA  ................................A--....--....G.........IDPaekwAPVL.Pmqhys........MGGIRT....
2bs2A  ................................A--....--....G.........IDPaekwAPVL.Pmqhys........MGGIRT....
1bhyA  ................................---....--....-.........AEK....AGVAvTd............RGFIEV....
1ojtA  ................................---....--....-.........AEK....AGVAvTd............RGFIEV....
1cjcA  ................................---....--....-.........---....----.-.............------....
1gerA  ................................---....--....-.........LEA....AGVK.Tne...........KGYIVV....
1lvlA  ................................---....--....-.........LEC....LDLKmN.............GAAIAI....
1kdgA  ................................QAL....HD....V.........VSN....IGSI.P.............GLTMIT....
1naaA  ................................QAL....HD....V.........VSN....IGSI.P.............GLTMIT....
1w4xA  ................................---....--....-.........---....----.-.............------....
1tdeA  ................................---....--....-.........-GQ....LELE.Ngyi..........KVQSGI....
1cl0A  ................................---....--....-.........-GQ....LELE.Ngyi..........KVQSGI....
1f6mA  ................................---....--....-.........-GQ....LELE.Ngyi..........KVQSGI....
1typA  ................................---....--....-.........LDK....AGVE.Vak...........NGAIKV....
1tytA  ................................---....--....-.........LDK....AGVE.Vak...........NGAIKV....
1fecA  ................................---....--....-.........LEK....AGVE.Vak...........NGAIKV....
2tprA  ................................---....--....-.........LEK....AGVE.Vak...........NGAIKV....
1ju2A  ................................---....--....-.........LSG....VGPE.-.............------....
1tdfA  ................................---....--....-.........-GQ....LELE.Ngyi..........KVQSGI....
1trbA  ................................---....--....-.........-GQ....LELE.Ngyi..........KVQSGI....
1gxfA  ................................---....--....-.........LQN....AGVM.Ik............NGGVQV....
1bzlA  ................................---....--....-.........LQN....AGVM.Ik............NGGVQV....
1ndaA  ................................---....--....-.........LQN....AGVM.Ik............NGGVQV....
1aogA  ................................---....--....-.........LQN....AGVM.Ik............NGGVQV....
1onfA  ................................---....--....-.........LEK....LNVE.Tn............NNYIVV....
1xanA  ................................---....--....-.........LNK....LGIQ.Tdd...........KGHIIV....
3grsA  ................................---....--....-.........LNK....LGIQ.Tdd...........KGHIIV....
1fl2A  ................................---....--....-.........-GA....VERN.R.............MGEIII....
1l9cA  ................................EEY....MP....G.........ANG....-ELK.Rgavc.........MYTKTL....
2gf3A  ................................EEY....MP....G.........ANG....-ELK.Rgavc.........MYTKTL....
3bhkA  ................................EEY....MP....G.........ANG....-ELK.Rgavc.........MYTKTL....
3grtA  ................................---....--....-.........LNK....LGIQ.Tdd...........KGHIIV....
1grtA  ................................---....--....-.........LNK....LGIQ.Tdd...........KGHIIV....
1hyuA  ................................---....--....-.........-GA....LERN.R.............MGEIII....
1w4xA  ................................---....--....-.........--K....IDIR.G.............VGNVAL....
1sezA  ................................---....--....-.........---....----.-.............------....
1h6vA  ................................---....--....-.........LET....VGVKiNek...........TGKIPV....
1rp0A  ................................---....--....-.........LKS....IGMI.Dhv...........PGMKAL....
2f5vA  ................................---....--....-.........---....----.-.............------....
2f6cA  ................................---....--....-.........---....----.-.............------....
1tzlA  ................................---....--....-.........---....----.-.............------....
2gv8A  ................................---....--....-.........---....----.-.............------....
1vqwA  ................................---....--....-.........---....----.-.............------....
2ignA  ................................---....--....-.........---....----.-.............------....
1vdcA  ................................---....--....-.........-GG....VELD.S.............DGYVVT....
1ng4A  ................................KTM....LP....P.........IQN....MKVD.Rfwa..........GLRPGT....
1ryiA  ................................KTM....LP....A.........IQN....MKVD.Rfwa..........GLRPGT....
1xdiA  ................................---....--....-.........LER....VGIQ.Lgr...........GNYLTV....
2vouA  ................................---....--....-.........---....----.-.............AGYVTW....
1xhcA  ................................---....--....-.........-RR....SGIH.T.............GRGILI....
1b8sA  ................................---....--....-.........---....----.-.............------....
1n4wA  ................................---....--....-.........---....----.-.............------....
3cnjA  ................................---....--....-.........---....----.-.............------....
1q1rA  ................................---....--....-.........-SA....AGLQ.V.............DNGIVI....
1f8wA  ................................---....--....-.........-GT....LELH.P.............NGLIKT....
1nhqA  ................................---....--....-.........-GT....LELH.P.............NGLIKT....
1nhrA  ................................---....--....-.........-GT....LELH.P.............NGLIKT....
1ijhA  ................................---....--....-.........---....----.-.............------....
3b6dA  ................................---....--....-.........---....----.-.............------....
1cc2A  ................................---....--....-.........---....----.-.............------....
3b3rA  ................................---....--....-.........---....----.-.............------....
1npxA  ................................---....--....-.........-GT....LELH.P.............NGLIKT....
1cboA  ................................---....--....-.........---....----.-.............------....
1nhsA  ................................---....--....-.........-GT....LELH.P.............NGLIKT....
1nhpA  ................................---....--....-.........-GT....LELH.P.............NGLIKT....
1mo9A  ................................---....--....-.........ILG....LDLG.P.............KGEVLV....
1fcdA  ................................---....--....-.........---....----.-.............------....
1m6iA  ................................---....--....-.........---....----.-.............------....
1gv4A  ................................---....--....-.........---....----.-.............------....
3coxA  ................................VYY....KT....W.........GDD....FTYH.P.............LGGVLLnkat
1d7yA  ................................---....--....-.........---....----.-.............------....
1d7yA  ................................---....--....-.........-RA....AGLA.C.............DDGIFV....
1fcdA  ................................---....--....-.........---....----.-.............------....
1ps9A  ................................---....--....-.........---....----.-.............------....
1djnA  ................................---....--....-.........---....----.N.............ELKARE....
1djqA  ................................---....--....-.........---....----.N.............ELKARE....
2culA  ................................---....--....-.........---....----.-.............------....
1gv4A  ................................---....--....-.........TGG....LEID.Sd............FGGFRV....
1m6iA  ................................---....--....-.........TGG....LEID.Sd............FGGFRV....
1nhrA  ................................---....--....-.........---....----.-.............------....
1nhqA  ................................---....--....-.........---....----.-.............------....
2gv8A  ................................---....--....-.........LKS....PE--.Tkli..........DDGSHV....
1vqwA  ................................---....--....-.........LKS....PE--.Tkli..........DDGSHV....
1gndA  ................................---....--....-.........---....----.-.............------....
1lv0A  ................................---....--....-.........---....----.-.............------....
1d5tA  ................................---....--....-.........---....----.-.............------....
3cpiG  ................................---....--....-.........---....----.-.............------....
2bcgG  ................................---....--....-.........---....----.-.............------....
1fcdA  ................................PQR....AG....K.........IAQi...AGLT.Nd............AGWCPV....


          330                                                                                       
            |                                                                                       
d1f8ra1  SDPLT...........A..........................................................................
2dw4A  DRVFWd..........Psvnlfghvgsttasrgelflfwnlykapillalvageaagimenisddvivgrclailkgifgssavpqpketv
2h94A  DRVFWd..........Psvnlfghvgsttasrgelflfwnlykapillalvageaagimenisddvivgrclailkgifgssavpqpketv
2iw5A  DRVFWd..........Psvnlfghvgsttasrgelflfwnlykapillalvageaagimenisddvivgrclailkgifgssavpqpketv
2z3yA  DRVFWd..........Psvnlfghvgsttasrgelflfwnlykapillalvageaagimenisddvivgrclailkgifgssavpqpketv
1ltxR  -----...........-..........................................................................
1vg0A  -----...........-..........................................................................
1jnrA  ----Aklfplkynrm.T..........................................................................
2c76A  KEPFW...........Rkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkklcelyakvlgslealepv
2v5zA  KEPFW...........Rkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkklcelyakvlgslealepv
2bk5A  KEPFW...........Rkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkklcelyakvlgslealepv
2c73A  KEPFW...........Rkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkklcelyakvlgslealepv
2c75A  KEPFW...........Rkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkklcelyakvlgslealepv
2c72A  KEPFW...........Rkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahkarklarltkeerlkklcelyakvlgslealepv
1o5wA  KEAFW...........Kkkdycgcmiiedeeapiaitlddtkpdgslpaimgfilarkadrlaklhkdirkrkicelyakvlgsqealypv
1nekA  NEKGEd..........V..........................................................................
1chuA  DDHGR...........T..........................................................................
1cf3A  -----...........-..........................................................................
1knrA  DDHGR...........T..........................................................................
2b76A  DQNCE...........T..........................................................................
1kf6A  DQNCE...........T..........................................................................
3cirA  DQNCE...........T..........................................................................
1ebdA  DQQCR...........T..........................................................................
1gpeA  -----...........-..........................................................................
3cpiG  -----...........-..........................................................................
2bcgG  -----...........-..........................................................................
1d4cA  DTKAEvksektg....K..........................................................................
1d4dA  DTKAEvksekta....K..........................................................................
1d5tA  -----...........-..........................................................................
1gndA  -----...........-..........................................................................
1lv0A  -----...........-..........................................................................
1dxlA  NERFS...........T..........................................................................
3c96A  RDPLPh..........W..........................................................................
2i0zA  TELFP...........Tevpilsnepfirdrslqglalrdinlsvlnpkgkaiishkmdmlfthfglsgpaalrcsqfvvkalkkfktnti
1lpfA  DDHCK...........T..........................................................................
1reoA  TKKFW...........Edegihggksttdlpsrfiyypnhnftsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtf
2gmhA  NEGGF...........Q..........................................................................
1qo8A  NTTASvldlqs.....K..........................................................................
2gqfA  WEFTP...........Ngtegyrtaevtmggvdtkvissktmesn..............................................
1pj5A  PDGGPllges......K..........................................................................
1b5qA  PRKFW...........Pegkgrefflyassrrgyygvwqefekqypdanvllvtvtdeesrrieqqsdeqtkaeimqvlrkmfpgkdvpda
2iidA  TTKFW...........Eddgihggksttdlpsrfiyypnhnftngvgviiaygigddanffqaldfkdcadivfndlslihqlpkkdiqsf
2ivdA  DAGTL...........Papdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmvggarqpglveqdedalaalareelkalagvta
1q9iA  DTKAEvmnakk.....Q..........................................................................
1jryA  DTKAEvmnakk.....Q..........................................................................
1p2eA  DTKAEvmnakk.....Q..........................................................................
1p2hA  DTKAEvmnakk.....Q..........................................................................
1y0pA  DTKAEvmnakk.....Q..........................................................................
1ksuA  DTKAEvmnakk.....Q..........................................................................
1jrzA  DTKAEvmnakk.....Q..........................................................................
1jrxA  DTKAEvmnakk.....Q..........................................................................
1kssA  DTKAEvmnakk.....Q..........................................................................
1v59A  DDQFN...........S..........................................................................
2b7rA  DTKAEvmnakk.....Q..........................................................................
2b7sA  DTKAEvmnakk.....Q..........................................................................
3ladA  DDYCA...........T..........................................................................
1m64A  DTKAEvmnakk.....Q..........................................................................
1lj1A  DTKAEvmnakk.....Q..........................................................................
1e39A  DTKAEvmnakk.....Q..........................................................................
2gjcA  HSGAY...........A..........................................................................
1pn0A  -----...........Hsaesgsimiiprennlvrfyvqlqaraekggrvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvt
1ykjA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1pxbA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1k0iA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1dobA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1iutA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1pxcA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1pbeA  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1cj2A  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1cc4A  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1bgnA  DERFW...........Telkarlpaevaeklvtgpsleksiapltsfvvepm.......................................
1fohA  -----...........Hsaesgsimiiprennlvrfyvqlqaraekggrvdrtkftpevvianakkifhpytfdvqqldwftayhigqrvt
1pbdA  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1pbfA  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1cj3A  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1bgjA  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1bf3A  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1cj4A  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1bkwA  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1pxaA  DERFW...........Telkarlpsevaeklvtgpsleksiaplrsfvvepm.......................................
1cc6A  DERFW...........Telkarlpaevaeklvtgpsleksiaplrsfvvepm.......................................
1gesA  DKYQN...........T..........................................................................
2bs3A  DYRGE...........A..........................................................................
1qlbA  DYRGE...........A..........................................................................
2bs2A  DYRGE...........A..........................................................................
1bhyA  DKQMR...........T..........................................................................
1ojtA  DKQMR...........T..........................................................................
1cjcA  -----...........-..........................................................................
1gerA  DKYQN...........T..........................................................................
1lvlA  DERCQ...........T..........................................................................
1kdgA  PDVTQ...........Tleeyvdaydpatmnsnhwvssttigsspqsavvdsnvkvf..................................
1naaA  PDVTQ...........Tleeyvdaydpatmnsnhwvssttigsspqsavvdsnvkvf..................................
1w4xA  -----...........-..........................................................................
1tdeA  HGNATq..........T..........................................................................
1cl0A  HGNATq..........T..........................................................................
1f6mA  HGNATq..........T..........................................................................
1typA  DAYSK...........T..........................................................................
1tytA  DAYSK...........T..........................................................................
1fecA  DAYSK...........T..........................................................................
2tprA  DAYSK...........T..........................................................................
1ju2A  -----...........-..........................................................................
1tdfA  HGNATq..........T..........................................................................
1trbA  HGNATq..........T..........................................................................
1gxfA  DEYSR...........T..........................................................................
1bzlA  DEYSR...........T..........................................................................
1ndaA  DEYSR...........T..........................................................................
1aogA  DEYSR...........T..........................................................................
1onfA  DENQR...........T..........................................................................
1xanA  DEFQN...........T..........................................................................
3grsA  DEFQN...........T..........................................................................
1fl2A  DAKCE...........T..........................................................................
1l9cA  DEHFIidlh.......P..........................................................................
2gf3A  DEHFIidlh.......P..........................................................................
3bhkA  DEHFIidlh.......P..........................................................................
3grtA  DEFQN...........T..........................................................................
1grtA  DEFQN...........T..........................................................................
1hyuA  DAKCE...........T..........................................................................
1w4xA  KEKWAagprtylglstA..........................................................................
1sezA  -----...........Mfpdrapnnvylyttfvggsrnrelakasrtelkeivtsdlkqllgaegeptyvnhlywskafplyghnydsvld
1h6vA  TDEEQ...........T..........................................................................
1rp0A  DMNTAedaivrltr..E..........................................................................
2f5vA  -----...........-..........................................................................
2f6cA  -----...........-..........................................................................
1tzlA  -----...........-..........................................................................
2gv8A  -----...........-..........................................................................
1vqwA  -----...........-..........................................................................
2ignA  -----...........-..........................................................................
1vdcA  KPGTTq..........T..........................................................................
1ng4A  KDGKPyigrh......P..........................................................................
1ryiA  KDGKPyigrh......P..........................................................................
1xdiA  DRVSR...........T..........................................................................
2vouA  RGVLQ...........Pgevaddvwnyfndkftygllddghliaypipgrenaesprlnfqwywnvaegpdldelmtdvrgirlptsvhnn
1xhcA  DDNFR...........T..........................................................................
1b8sA  -----...........-..........................................................................
1n4wA  -----...........-..........................................................................
3cnjA  -----...........-..........................................................................
1q1rA  NEHMQ...........T..........................................................................
1f8wA  DEYMR...........T..........................................................................
1nhqA  DEYMR...........T..........................................................................
1nhrA  DEYMR...........T..........................................................................
1ijhA  -----...........-..........................................................................
3b6dA  -----...........-..........................................................................
1cc2A  -----...........-..........................................................................
3b3rA  -----...........-..........................................................................
1npxA  DEYMR...........T..........................................................................
1cboA  -----...........-..........................................................................
1nhsA  DEYMR...........T..........................................................................
1nhpA  DEYMR...........T..........................................................................
1mo9A  NEYLQ...........T..........................................................................
1fcdA  -----...........-..........................................................................
1m6iA  -----...........-..........................................................................
1gv4A  -----...........-..........................................................................
3coxA  DNFGRl..........P..........................................................................
1d7yA  -----...........-..........................................................................
1d7yA  DAYGR...........T..........................................................................
1fcdA  -----...........-..........................................................................
1ps9A  -----...........-..........................................................................
1djnA  SEWAE...........N..........................................................................
1djqA  SEWAE...........N..........................................................................
2culA  -----...........-..........................................................................
1gv4A  NAELQ...........-..........................................................................
1m6iA  NAELQ...........-..........................................................................
1nhrA  -----...........-..........................................................................
1nhqA  -----...........-..........................................................................
2gv8A  HNVYQhify.......I..........................................................................
1vqwA  HNVYQhify.......I..........................................................................
1gndA  -----...........-..........................................................................
1lv0A  -----...........-..........................................................................
1d5tA  -----...........-..........................................................................
3cpiG  -----...........-..........................................................................
2bcgG  -----...........-..........................................................................
1fcdA  DIKTFes.........S..........................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  vsrwradpwargsysyvaagssgndydlmaqpitpgpsipgapq...............................................
2h94A  vsrwradpwargsysyvaagssgndydlmaqpitpgpsipgapq...............................................
2iw5A  vsrwradpwargsysyvaagssgndydlmaqpitpgpsipgapq...............................................
2z3yA  vsrwradpwargsysyvaagssgndydlmaqpitpgpsipgapq...............................................
1ltxR  ...........................................................................................
1vg0A  ...........................................................................................
1jnrA  ...........................................................................................
2c76A  hyeeknwceeqysggcyttyfppgiltqygrvlrq........................................................
2v5zA  hyeeknwceeqysggcyttyfppgiltqygrvlrq........................................................
2bk5A  hyeeknwceeqysggcyttyfppgiltqygrvlrq........................................................
2c73A  hyeeknwceeqysggcyttyfppgiltqygrvlrq........................................................
2c75A  hyeeknwceeqysggcyttyfppgiltqygrvlrq........................................................
2c72A  hyeeknwceeqysggcyttyfppgiltqygrvlrq........................................................
1o5wA  hyeeknwceeqysggcytayfppgimtqygrvirq........................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  ...........................................................................................
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  qmsidalpeenseqlfqrmlkqmkedpkkgiknvlkgyvperyflfllekneidgseqagqvshekiralvkdfkeftvnvngtqsiekaf
1lpfA  ...........................................................................................
1reoA  cypsmiqkwsldkyamggittftpyqfqhfseslta.......................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  tdilvprwwsdrfykgtfsnwpvgvnryeydqlra........................................................
2iidA  cypsviqkwsldkyamggittftpyqfqhfsdplta.......................................................
2ivdA  rpsftrvfrwplgipqynlghlervaaidaalq..........................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ekfs.......................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ekfs.......................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  aidkmek....................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  ...........................................................................................
2f6cA  ...........................................................................................
1tzlA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  ...........................................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  slnphnlrqfhskgeslfkpfrdlvlnasspfvtvvadatvdrm...............................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                 340                      350       360       370                   
                                   |                        |         |         |                   
d1f8ra1  ...................SQGRIYFAG......EYTAQAHG.........WIDSTIKSGLRAARDV------nlasen............
2dw4A  ...................PIPRLFFAG......EHTIRNYPa........TVHGALLSGLREAGRIADQ---f.................
2h94A  ...................PIPRLFFAG......EHTIRNYPa........TVHGALLSGLREAGRIADQ---f.................
2iw5A  ...................PIPRLFFAG......EHTIRNYPa........TVHGALLSGLREAGRIADQ---f.................
2z3yA  ...................PIPRLFFAG......EHTIRNYPa........TVHGALLSGLREAGRIADQ---f.................
1ltxR  ...................---------......--------.........----------------------swlkeyqenndvvtensm
1vg0A  ...................---------......--------.........----------------------swlkeyqenndvvtensm
1jnrA  ...................TVKGLFAIG......DCAGANPHk........FSSGSFTEGRIAAKAAVR----fileqkpnpeiddavvee
2c76A  ...................PVDRIYFAGt.....ETATHWSG.........WMEGAVEAGERAAREILH----am................
2v5zA  ...................PVDRIYFAGt.....ETATHWSG.........YMEGAVEAGERAAREILH----am................
2bk5A  ...................PVDRIYFAGt.....ETATHWSG.........YMEGAVEAGERAAREILH----am................
2c73A  ...................PVDRIYFAGt.....ETATHWSG.........FMEGAVEAGERAAREILH----am................
2c75A  ...................PVDRIYFAGt.....ETATHWSG.........LMEGAVEAGERAAREILH----am................
2c72A  ...................PVDRIYFAGt.....ETATHWSG.........HMEGAVEAGERAAREILH----am................
1o5wA  ...................PVGRIYFAGt.....ETATQWSG.........YMEGAVEAGERAAREVLNA---lg................
1nekA  ...................VVPGLFAVG......EIACVSVHganrlggn.SLLDLVVFGRAAGLHL------qesiaeqgalrdasesdv
1chuA  ...................DVEGLYAIG......EVSYTGLHganrmasn.SLLECLVYGWSAAEDITRR---mpyahdistlppwdesrv
1cf3A  ...................---------......--------.........----------------------nttalliqyenyrdwivn
1knrA  ...................DVEGLYAIG......EVSYTGLHganlmasn.SLLECLVYGWSAAEDITRR---mpyahdistlppwdesrv
2b76A  ...................RIKGLFAVG......ECSSVGLHganrlgsn.SLAELVVFGRLAGEQAT-----era...............
1kf6A  ...................RIKGLFAVG......ECSSVGLHganrlgsn.SLAELVVFGRLAGEQAT-----era...............
3cirA  ...................RIKGLFAVG......ECSSVGLHganrlgsn.SLAELVVFGRLAGEQATE----raat..............
1ebdA  ...................SVPNIFAIG......DIVPGP-A.........LAHKASYEGKVAAEAIAG----h.................
1gpeA  ...................---------......--------.........----------------------rtptaaqlaaghsfnatc
3cpiG  ...................---------......--------.........----------------------dptyfp............
2bcgG  ...................---------......--------.........----------------------dptyfp............
1d4cA  ...................PITGLYAAG......EVTGGVHGanrlggn..AISDIVTYGRIAGASAAK----fakd..............
1d4dA  ...................PITGLYAAG......EVTGGVHGanrlggn..AISDIVTYGRIAGASAAK----fakd..............
1d5tA  ...................---------......--------.........----------------------kagqviriicilshpikn
1gndA  ...................---------......--------.........----------------------kagqviriicilshpikn
1lv0A  ...................---------......--------.........----------------------kagqviriicilshpikn
1dxlA  ...................NVSGVYAIG......DVIPGP-M.........LAHKAEEDGVACVEYLAGK---vghvdydkvpgvvytnpe
3c96A  ...................GRGRITLLG......DAAHLMYPmgan.....GASQAILDGIELAAALAR----nadvaaalreyeearrpt
2i0zA  vtgggvsvkeinpkemsskFTNGLYFCG......EVLDIHGYtggy.....NITSALVTGRIAG---------tta...............
1lpfA  ...................SVPGVFAIG......DVVRGA-M.........LAHKASEEGVMVAERIAG----h.................
1reoA  ...................SVDRIYFAG......EHTAEAHG.........WIDSTIKSGLRAARDV------nr................
2gmhA  ...................SIPKLTFPG......GLLIGCSPgfmnvpkikGTHTAMKSGTLAAESIFNQL--tsenlqsktiglhvteye
1qo8A  ...................PIDGLFAAG......EVTGGVHGynrlggn..AIADTVVFGRIAGDNAAK----h.................
2gqfA  ...................QVSGLYFIG......EVLDVTGWlggy.....NFQWAWSSAYACALSI------s.................
1pj5A  ...................ELDGFYVA-......-------Eav.......WVTHSAGVAKAMAELL------ttgrsetdlgecditrfe
1b5qA  ...................PVGRVYFTG......EHTSEHYNg........YVHGAYLSGIDSAEILIN----c.................
2iidA  ...................SQGRIYFAG......EYTAQAHG.........WIDSTIKSGLRAARD-------v.................
2ivdA  ...................RLPGLHLIG......--NAYKGV.........GLNDCIRNAAQLADAL------..................
1q9iA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1jryA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1p2eA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1p2hA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1y0pA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1ksuA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1jrzA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1jrxA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1kssA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1v59A  ...................KFPHIKVVG......DVTFGP-M.........LAHKAEEEGIAAVEML------..................
2b7rA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
2b7sA  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
3ladA  ...................SVPGVYAIG......DVVRGA-M.........LAHKASEEGVVVAERIAGH---ka................
1m64A  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1lj1A  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
1e39A  ...................VIPGLYGAG......EVTGGVHGanrlggn..AISDIITFGRLAGEEAAKY---skk...............
2gjcA  ...................GVDNMYFAGmevaelDGLNRMGP.........TFGAMALSGVHAAEQILK----h.................
1pn0A  ...................KDERVFIAG......DACHTHSP.........KAGQGMNTSMMDTYNLGWK---lglvltgrakrdilktye
1ykjA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1pxbA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1k0iA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1dobA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1iutA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1pxcA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1pbeA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1cj2A  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1cc4A  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1bgnA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1fohA  ...................KDERVFIAG......DACHTHSP.........KAGQGMNTSMMDTYNLGWK---lglvltgrakrdilktye
1pbdA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1pbfA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1cj3A  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1bgjA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1bf3A  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1cj4A  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1bkwA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1pxaA  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLDLAASDVSTL------yrlllkayregrgeller
1cc6A  ...................QHGRLFLAG......DAAHIVPP.........TGAKGLNLAASDVSTL------yrlllkayregrgeller
1gesA  ...................NIEGIYAVG......DNTGAV-E.........LTPVAVAAGRRLSERLFN----nkpdehldysniptvvfs
2bs3A  ...................KLKGLFSAG......EAACWDMHgfnrlggn.SVSEAVVAGMIVGEYF------aehcantqv.........
1qlbA  ...................KLKGLFSAG......EAACWDMHgfnrlggn.SVSEAVVAGMIVGEYF------aehcantqv.........
2bs2A  ...................KLKGLFSAG......EAACWDMHgfnrlggn.SVSEAVVAGMIVGEYF------aehcantqv.........
1bhyA  ...................NVPHIYAIG......DIVGQP-M.........LAHKAVHEGHVAAENCAG----h.................
1ojtA  ...................NVPHIYAIG......DIVGQP-M.........LAHKAVHEGHVAAENCAG----h.................
1cjcA  ...................---------......--------.........----------------------eeaarrasasrawglrff
1gerA  ...................NIEGIYAVG......DNTGAV-E.........LTPVAVAAGRRLSERLFN----nkpdehldysniptvvfs
1lvlA  ...................SMHNVWAIG......DVAGEP-M.........LAHRAMAQGEMVAEIIAG----k.................
1kdgA  ...................GTNNLFIVD......AGIIPHLPtgn......PQGTLMSAAEQAAAKI------la................
1naaA  ...................GTNNLFIVD......AGIIPHLPtgn......PQGTLMSAAEQAAAKI------la................
1w4xA  ...................---------......--------.........----------------------f.................
1tdeA  ...................SIPGVFAAG......DVMDHIYR.........QAITSAGTGCMAALDAERYL--d.................
1cl0A  ...................SIPGVFAAG......DVMDHIYR.........QAITSAGTGCMAALDAERYL--d.................
1f6mA  ...................SIPGVFAAG......DVMDHIYR.........QAITSAGTGCMAALDAERYL--d.................
1typA  ...................NVDNIYAIG......DVTDRV-M.........LTPVAINEGAAFVDTV------fan...............
1tytA  ...................NVDNIYAIG......DVTDRV-M.........LTPVAINEGAAFVDTV------fan...............
1fecA  ...................NVDNIYAIG......DVTDRV-M.........LTPVAINEGAAFVDTV------fan...............
2tprA  ...................NVDNIYAIG......DVTDRV-M.........LTPVAINEGAAFVDTV------fan...............
1ju2A  ...................---------......--------.........----------------------sylsslnipvvlshpyvg
1tdfA  ...................SIPGVFAAG......DVMDHIYR.........QAITSAGTGCMAALDAERYL--d.................
1trbA  ...................SIPGVFAAG......DVMDHIYR.........QAITSAGTGCMAALDAERYL--d.................
1gxfA  ...................NVSNIYAIG......DVTNRV-M.........LTPVAINEAAALVDTVFG----tt................
1bzlA  ...................NVSNIYAIG......DVTNRV-M.........LTPVAINEAAALVDTVFG----tt................
1ndaA  ...................NVSNIYAIG......DVTNRV-M.........LTPVAINEAAALVDTVFG----tn................
1aogA  ...................NVSNIYAIG......DVTNRV-M.........LTPVAINEAAALVDTVFG----tt................
1onfA  ...................SVNNIYAVG......DCC-----.........----------------------..................
1xanA  ...................NVKGIYAVG......DVCGKA-L.........LTPVAIAAGRKLAHRLFEY---k.................
3grsA  ...................NVKGIYAVG......DVCGKA-L.........LTPVAIAAGRKLAHRLFEY---k.................
1fl2A  ...................NVKGVFAAG......DCTTVPYK.........QIIIATGEGAKASLSAF-----dy................
1l9cA  ...................EHSNVVIA-......--AGFSGH.........GFKFSSGVGEVLSQLA------ltgktehdisifsinrp.
2gf3A  ...................EHSNVVIA-......--AGFSGH.........GFKFSSGVGEVLSQLA------ltgktehdisifsinrp.
3bhkA  ...................EHSNVVIA-......--AGFSGH.........GFKFSSGVGEVLSQLA------ltgktehdisifsinrp.
3grtA  ...................NVKGIYAVG......DVCGKA-L.........LTPVAIAAGRKLAHRLFEY---k.................
1grtA  ...................NVKGIYAVG......DVCGKA-L.........LTPVAIAAGRKLAHRLFEY---k.................
1hyuA  ...................SVKGVFAAG......DCTTVPYK.........QIIIATGEGAKASLSAF-----dy................
1w4xA  ...................GFPNLFFI-......--AGPGSP.........SAL-------------------snmlvsieqhvewvtdhi
1sezA  ...................NLPGLFYAG......--NHRGGL.........SVGKALSSGCNAADLVISY---l.................
1h6vA  ...................NVPYIYAIG......DILEGKLE.........LTPVAIQAGRLLAQRLYG----gstvkcdydnvpttvftp
1rp0A  ...................VVPGMIVTGmevaeiDGAPRMGP.........TFGAMMISGQKAGQL-------a.................
2f5vA  ...................---------......--------.........----------------------pipfedpepqvttlfqps
2f6cA  ...................---------......--------.........----------------------qvttlfqpshpwhtqihr
1tzlA  ...................---------......--------.........----------------------pipfedpepqvttlfqps
2gv8A  ...................---------......--------.........----------------------akh...............
1vqwA  ...................---------......--------.........----------------------akh...............
2ignA  ...................---------......--------.........----------------------plpipfedpepqvttlfq
1vdcA  ...................SVPGVFAAG......DVQDKKYR.........QAITAAGTGCMAALDAEHY---l.................
1ng4A  ...................EDSRILFA-......--AGHFRN.........GILLAPATGALISDLIMNK---evnqdwlhafridrk...
1ryiA  ...................EDSRILFA-......--AGHFRN.........GILLAPATGALISDLIMNK---evnqdwlhafridrk...
1xdiA  ...................LATGIYAAG......DCTGLL-P.........LASVAAMQGRIAMYHALG----..................
2vouA  ...................VHGRVLLIG......DAAVTPRP.........HAAAGGAKASDDARTLAE----vftknhdlrgslqswetr
1xhcA  ...................SAKDVYAIG......DCAEYSGIiag......TAKAAMEQARVLADILKG----e.................
1b8sA  ...................---------......--------.........----------------------awdnsdssvfaqiapmpa
1n4wA  ...................---------......--------.........----------------------awdnsdssvfaeiapmpa
3cnjA  ...................---------......--------.........----------------------awdnsdssvwaeiapmpa
1q1rA  ...................SDPLIMAVG......DCARFHSQlydrwvrieSVPNALEQARKIAAILCGK---vprdeaapwfwsdqyeig
1f8wA  ...................SEPDVFAVG......DATLIKYNpadtevniaLATNAMKQGRFAVKNL------e.................
1nhqA  ...................SEPDVFAVG......DATLIKYNpadtevniaLATNARKQGRFAVKNL------e.................
1nhrA  ...................SEPDVFAVG......DATLIKYNpadtevniaLATNARKQGRFAVKNL------e.................
1ijhA  ...................---------......--------.........----------------------nsdssvfaeiapmpagle
3b6dA  ...................---------......--------.........----------------------gidawdnsdssvfaqiap
1cc2A  ...................---------......--------.........----------------------gidawdnsdssvfaeiap
3b3rA  ...................---------......--------.........----------------------gidawdnsdssvfaqiap
1npxA  ...................SEPDVFAVG......DATLIKYNpadtevniaLATNARKQGRFAVKNL------..................
1cboA  ...................---------......--------.........----------------------algidawdnsdssvfaei
1nhsA  ...................SEPDVFAVG......DATLIKYNpadtevniaLATNARKQGRFAVKNL------..................
1nhpA  ...................SEPDVFAVG......DATLIKYNpadtevniaLATNARKQGRFAVKNL------..................
1mo9A  ...................SVPNVYAVG......DLIGGP-M.........EMFKARKSGCYAARNVMG----ekisytpknypdflhthy
1fcdA  ...................---------......--------.........----------------------fskqsqfskgwerlygfg
1m6iA  ...................---------......--------.........----------------------fpekgnmgkilpeyl...
1gv4A  ...................---------......--------.........----------------------fpekgnmgkilpq.....
3coxA  ...................EYPGLYVV-......--------.........----------------------dgslvpgnvgvnpfvtit
1d7yA  ...................---------......--------.........----------------------aap...............
1d7yA  ...................TCPDVYALG......DVTRQRNPlsgrferieTWSNAQNQGIAVARHL------v.................
1fcdA  ...................---------......--------.........----------------------eaaaklphawkageqtai
1ps9A  ...................---------......--------.........----------------------q.................
1djnA  ...................DIKGIYLIG......DA------.........----------------------..................
1djqA  ...................DIKGIYLIG......DA------.........----------------------..................
2culA  ...................---------......--------.........----------------------asypdlledlsrlgfrfv
1gv4A  ...................ARSNIWVAG......DAACFYDIklgrrrve.HHDHAVVSGRLAGENMTG----aakp..............
1m6iA  ...................ARSNIWVAG......DAACFYDIklgrrrve.HHDHAVVSGRLAGENMTG----aakp..............
1nhrA  ...................---------......--------.........----------------------..................
1nhqA  ...................---------......--------.........----------------------..................
2gv8A  ...................PDPTLAFVG......LALHV--V.........PFPTSQAQAAFLAR--------vwsgrlklpskeeqlkwq
1vqwA  ...................PDPTLAFVG......LALHV--V.........PFPTSQAQAAFLAR--------vwsgrlklpskeeqlkwq
1gndA  ...................---------......--------.........----------------------tcndikdiykrmagsafd
1lv0A  ...................---------......--------.........----------------------tcndikdiykrmagsafd
1d5tA  ...................---------......--------.........----------------------ttcndikdiykrmagsaf
3cpiG  ...................---------......--------.........----------------------frvtghplvlkqr.....
2bcgG  ...................---------......--------.........----------------------frvtghplvlkqr.....
1fcdA  ...................IHKGIHVIG......DASIANPMpk.......SGYSANSQGKVAAAAV------vvllkg............


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  wqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqknhasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpg
1vg0A  wqeqileneeaiplsskdktiqhvevfcyasqdlhkdveeagalqknhasvtsaqsaeaaeaaetsclptaveplsmgsceipaeqsqcpg
1jnrA  lkkkayapmerfmqy............................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  eas........................................................................................
1chuA  enpdervviqhnwhelrlfm.......................................................................
1cf3A  hnvayselfldtagvasfdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgamqtyfagetipgdnlay
1knrA  enpdervviqhnwhelrlfm.......................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  hgtngtvqsgardngqpwspimkalmntvsalgvpvqqdflcghprgvsmimnnldenqvrvdaarawllpnyqrsnleiltgqmvgkvlf
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  tndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiast..............................................
1gndA  tndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiast..............................................
1lv0A  tndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyiaiast..............................................
1dxlA  vasvgkteeqvke..............................................................................
3c96A  ankiilanr..................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  dnlknswvwkelysvrnirpschgilgvyggmiytgifywifrgmepwtlkhkgsdsdqlkpakdctpieypkpdgqi.............
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  dvqltpeyvsetsqqnfveiydvlhpl................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  eerqpfaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyde...............................
1ykjA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1pxbA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1k0iA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1dobA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1iutA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1pxcA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenfvglp.............................
1pbeA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1cj2A  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1cc4A  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1bgnA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1fohA  eerhafaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyde...............................
1pbdA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1pbfA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1cj3A  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1bgjA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1bf3A  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1cj4A  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1bkwA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1pxaA  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1cc6A  ysaiclrriwkaerfswwmtsvlhrfpdtdafsqriqqteleyylgseaglatiaenyvglp.............................
1gesA  hppigtvgltepqareqygd.......................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  rspqqvlpspdgrraagirlavtrlegigeatravptgdvedlpcglvlssigy.....................................
1gerA  hppigtvgltepqareqygd.......................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  qflhdnprnfinilppnpieptivtvlgisndfyqcsfsslpftt..............................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  aymfkngltrseavlekedewvehvneiadetlypmtaswytganvpg...........................................
1sezA  ...........................................................................................
1h6vA  leygccglseeka..............................................................................
1rp0A  ...........................................................................................
2f5vA  hpwhtqihrdafsygavqqsidsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggfl
2f6cA  dafsygavqqsidsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggflpgslpqfmk
1tzlA  hpwhtqihrdafsygavqqsidsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakiggfl
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  pshpwhtqihrdafsygavqqsidsrlivdwrffgrtepkeenklwfsdkitdaynmpqptfdfrfpagrtskeaedmmtdmcvmsakigg
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  qlqqghaylnkvkkmasrlqh......................................................................
1xhcA  ...........................................................................................
1b8sA  gletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyhplggcvlgkat
1n4wA  gletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyhplggcvlgkat
3cnjA  gletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyhplggcvlgkat
1q1rA  lkmvglse...................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  twvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyhplggcvlgkatddy
3b6dA  mpagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyqplggcvlg
1cc2A  mpagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyqplggcvlg
3b3rA  mpagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcyqplggcvlg
1npxA  ...........................................................................................
1cboA  apmpagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlkafaddfcynplggcv
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  evsflgmgeeea...............................................................................
1fcdA  tenamiewhpgpdsavvkvdggemmvetafgdefkadvinlipp...............................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  alaernmdkii................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  lrkqledmadggtvvi...........................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  eregevpetpstpgyrvrylafhpe..................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  delmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspywgekersirenm...............................
1vqwA  delmfslsgannmyhsldypkdatyinklhdwckqatpvleeefpspywgekersirenm...............................
1gndA  fenm.......................................................................................
1lv0A  fenm.......................................................................................
1d5tA  df.........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  pesspevndaeatgkkensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrgllidlliksnvsryaefkn
1vg0A  pesspevndaeatgkkensdakssteepsenvpkvqdntetpkknritysqiikegrrfnidlvskllysrgllidlliksnvsryaefkn
1jnrA  ...........................................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  dadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvygvqglrvidgsipptqmsshvmtvfyamalkisdailedy........
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  kqtasgpqavgvnfgtnkavnfdvfakhevllaagsaisplileysgiglksvldqanvtqlldlpvginmqdqttttvssrassagagqg
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  ...........................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  pgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamslaiksceyikqn............
2f6cA  pglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamslaiksceyikqn.....................
1tzlA  pgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamslaiksceyikqn............
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  flpgslpqfmepglvlhlggthrmgfdekednccvntdsrvfgfknlflggcgniptayganptltamslaiksceyikqn..........
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd............................................
1n4wA  ddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd............................................
3cnjA  ddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd............................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  grvagyknlyvtdgslipgsvgvlpfvtitalaernveriikqd...............................................
3b6dA  katddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd.........................................
1cc2A  katddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd.........................................
3b3rA  katddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd.........................................
1npxA  ...........................................................................................
1cboA  lgkatddygrvagyknlyvtdgslipgsvgvnpfvtitalaernveriikqd.......................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  itrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcveyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsc
1vg0A  itrilafregtveqvpcsradvfnskqltmvekrmlmkfltfcveyeehpdeyrayegttfseylktqkltpnlqyfvlhsiamtsettsc
1jnrA  ...........................................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  ...........................................................................................
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  qavffanftetfgdyapqardllntkldqwaeetvarggfhnvtalkvqyenyrnwlldedvafaelfmdtegkinfdlwdlipftrgsvh
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  ...........................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  ...........................................................................................
2f6cA  ...........................................................................................
1tzlA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  ...........................................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  tvdglkatkkflqclgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqfgqriiskhfiiedsylse
1vg0A  tvdglkatkkflqclgrygntpflfplygqgelpqcfcrmcavfggiyclrhsvqclvvdkesrkckavidqfgqriiskhfiiedsylse
1jnrA  ...........................................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  ...........................................................................................
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  ilssdpylwqfandpkfflnefdllgqaaasklardltsqgamkeyfagetlpgynlvqnatlsqwsdyvlqnfrpnwhavsscsmmsrel
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  ...........................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  ...........................................................................................
2f6cA  ...........................................................................................
1tzlA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  ...........................................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                                                    
                                                                                                    
d1f8ra1  ...........................................................................................
2dw4A  ...........................................................................................
2h94A  ...........................................................................................
2iw5A  ...........................................................................................
2z3yA  ...........................................................................................
1ltxR  ntcsrvqyrqisravlitdgsvlktdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyt
1vg0A  ntcsrvqyrqisravlitdgsvlrtdadqqvsiltvpaeepgsfavrvielcsstmtcmkgtylvhltcmssktaredlervvqklftpyt
1jnrA  ...........................................................................................
2c76A  ...........................................................................................
2v5zA  ...........................................................................................
2bk5A  ...........................................................................................
2c73A  ...........................................................................................
2c75A  ...........................................................................................
2c72A  ...........................................................................................
1o5wA  ...........................................................................................
1nekA  ...........................................................................................
1chuA  ...........................................................................................
1cf3A  ...........................................................................................
1knrA  ...........................................................................................
2b76A  ...........................................................................................
1kf6A  ...........................................................................................
3cirA  ...........................................................................................
1ebdA  ...........................................................................................
1gpeA  ggvvdatakvygtqglrvidgsipptqvsshvmtifygmalkvadailddya.......................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1d4cA  ...........................................................................................
1d4dA  ...........................................................................................
1d5tA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1dxlA  ...........................................................................................
3c96A  ...........................................................................................
2i0zA  ...........................................................................................
1lpfA  ...........................................................................................
1reoA  ...........................................................................................
2gmhA  ...........................................................................................
1qo8A  ...........................................................................................
2gqfA  ...........................................................................................
1pj5A  ...........................................................................................
1b5qA  ...........................................................................................
2iidA  ...........................................................................................
2ivdA  ...........................................................................................
1q9iA  ...........................................................................................
1jryA  ...........................................................................................
1p2eA  ...........................................................................................
1p2hA  ...........................................................................................
1y0pA  ...........................................................................................
1ksuA  ...........................................................................................
1jrzA  ...........................................................................................
1jrxA  ...........................................................................................
1kssA  ...........................................................................................
1v59A  ...........................................................................................
2b7rA  ...........................................................................................
2b7sA  ...........................................................................................
3ladA  ...........................................................................................
1m64A  ...........................................................................................
1lj1A  ...........................................................................................
1e39A  ...........................................................................................
2gjcA  ...........................................................................................
1pn0A  ...........................................................................................
1ykjA  ...........................................................................................
1pxbA  ...........................................................................................
1k0iA  ...........................................................................................
1dobA  ...........................................................................................
1iutA  ...........................................................................................
1pxcA  ...........................................................................................
1pbeA  ...........................................................................................
1cj2A  ...........................................................................................
1cc4A  ...........................................................................................
1bgnA  ...........................................................................................
1fohA  ...........................................................................................
1pbdA  ...........................................................................................
1pbfA  ...........................................................................................
1cj3A  ...........................................................................................
1bgjA  ...........................................................................................
1bf3A  ...........................................................................................
1cj4A  ...........................................................................................
1bkwA  ...........................................................................................
1pxaA  ...........................................................................................
1cc6A  ...........................................................................................
1gesA  ...........................................................................................
2bs3A  ...........................................................................................
1qlbA  ...........................................................................................
2bs2A  ...........................................................................................
1bhyA  ...........................................................................................
1ojtA  ...........................................................................................
1cjcA  ...........................................................................................
1gerA  ...........................................................................................
1lvlA  ...........................................................................................
1kdgA  ...........................................................................................
1naaA  ...........................................................................................
1w4xA  ...........................................................................................
1tdeA  ...........................................................................................
1cl0A  ...........................................................................................
1f6mA  ...........................................................................................
1typA  ...........................................................................................
1tytA  ...........................................................................................
1fecA  ...........................................................................................
2tprA  ...........................................................................................
1ju2A  ...........................................................................................
1tdfA  ...........................................................................................
1trbA  ...........................................................................................
1gxfA  ...........................................................................................
1bzlA  ...........................................................................................
1ndaA  ...........................................................................................
1aogA  ...........................................................................................
1onfA  ...........................................................................................
1xanA  ...........................................................................................
3grsA  ...........................................................................................
1fl2A  ...........................................................................................
1l9cA  ...........................................................................................
2gf3A  ...........................................................................................
3bhkA  ...........................................................................................
3grtA  ...........................................................................................
1grtA  ...........................................................................................
1hyuA  ...........................................................................................
1w4xA  ...........................................................................................
1sezA  ...........................................................................................
1h6vA  ...........................................................................................
1rp0A  ...........................................................................................
2f5vA  ...........................................................................................
2f6cA  ...........................................................................................
1tzlA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
2ignA  ...........................................................................................
1vdcA  ...........................................................................................
1ng4A  ...........................................................................................
1ryiA  ...........................................................................................
1xdiA  ...........................................................................................
2vouA  ...........................................................................................
1xhcA  ...........................................................................................
1b8sA  ...........................................................................................
1n4wA  ...........................................................................................
3cnjA  ...........................................................................................
1q1rA  ...........................................................................................
1f8wA  ...........................................................................................
1nhqA  ...........................................................................................
1nhrA  ...........................................................................................
1ijhA  ...........................................................................................
3b6dA  ...........................................................................................
1cc2A  ...........................................................................................
3b3rA  ...........................................................................................
1npxA  ...........................................................................................
1cboA  ...........................................................................................
1nhsA  ...........................................................................................
1nhpA  ...........................................................................................
1mo9A  ...........................................................................................
1fcdA  ...........................................................................................
1m6iA  ...........................................................................................
1gv4A  ...........................................................................................
3coxA  ...........................................................................................
1d7yA  ...........................................................................................
1d7yA  ...........................................................................................
1fcdA  ...........................................................................................
1ps9A  ...........................................................................................
1djnA  ...........................................................................................
1djqA  ...........................................................................................
2culA  ...........................................................................................
1gv4A  ...........................................................................................
1m6iA  ...........................................................................................
1nhrA  ...........................................................................................
1nhqA  ...........................................................................................
2gv8A  ...........................................................................................
1vqwA  ...........................................................................................
1gndA  ...........................................................................................
1lv0A  ...........................................................................................
1d5tA  ...........................................................................................
3cpiG  ...........................................................................................
2bcgG  ...........................................................................................
1fcdA  ...........................................................................................


                                                                                         
                                                                                         
d1f8ra1  ................................................................................
2dw4A  ................................................................................
2h94A  ................................................................................
2iw5A  ................................................................................
2z3yA  ................................................................................
1ltxR  eieaeneqvekprllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpnedfcpappnpe
1vg0A  eieaeneqvekprllwalyfnmrdssdisrdcyndlpsnvyvcsgpdsglgndnavkqaetlfqqicpnedfcpappnpe
1jnrA  ................................................................................
2c76A  ................................................................................
2v5zA  ................................................................................
2bk5A  ................................................................................
2c73A  ................................................................................
2c75A  ................................................................................
2c72A  ................................................................................
1o5wA  ................................................................................
1nekA  ................................................................................
1chuA  ................................................................................
1cf3A  ................................................................................
1knrA  ................................................................................
2b76A  ................................................................................
1kf6A  ................................................................................
3cirA  ................................................................................
1ebdA  ................................................................................
1gpeA  ................................................................................
3cpiG  ................................................................................
2bcgG  ................................................................................
1d4cA  ................................................................................
1d4dA  ................................................................................
1d5tA  ................................................................................
1gndA  ................................................................................
1lv0A  ................................................................................
1dxlA  ................................................................................
3c96A  ................................................................................
2i0zA  ................................................................................
1lpfA  ................................................................................
1reoA  ................................................................................
2gmhA  ................................................................................
1qo8A  ................................................................................
2gqfA  ................................................................................
1pj5A  ................................................................................
1b5qA  ................................................................................
2iidA  ................................................................................
2ivdA  ................................................................................
1q9iA  ................................................................................
1jryA  ................................................................................
1p2eA  ................................................................................
1p2hA  ................................................................................
1y0pA  ................................................................................
1ksuA  ................................................................................
1jrzA  ................................................................................
1jrxA  ................................................................................
1kssA  ................................................................................
1v59A  ................................................................................
2b7rA  ................................................................................
2b7sA  ................................................................................
3ladA  ................................................................................
1m64A  ................................................................................
1lj1A  ................................................................................
1e39A  ................................................................................
2gjcA  ................................................................................
1pn0A  ................................................................................
1ykjA  ................................................................................
1pxbA  ................................................................................
1k0iA  ................................................................................
1dobA  ................................................................................
1iutA  ................................................................................
1pxcA  ................................................................................
1pbeA  ................................................................................
1cj2A  ................................................................................
1cc4A  ................................................................................
1bgnA  ................................................................................
1fohA  ................................................................................
1pbdA  ................................................................................
1pbfA  ................................................................................
1cj3A  ................................................................................
1bgjA  ................................................................................
1bf3A  ................................................................................
1cj4A  ................................................................................
1bkwA  ................................................................................
1pxaA  ................................................................................
1cc6A  ................................................................................
1gesA  ................................................................................
2bs3A  ................................................................................
1qlbA  ................................................................................
2bs2A  ................................................................................
1bhyA  ................................................................................
1ojtA  ................................................................................
1cjcA  ................................................................................
1gerA  ................................................................................
1lvlA  ................................................................................
1kdgA  ................................................................................
1naaA  ................................................................................
1w4xA  ................................................................................
1tdeA  ................................................................................
1cl0A  ................................................................................
1f6mA  ................................................................................
1typA  ................................................................................
1tytA  ................................................................................
1fecA  ................................................................................
2tprA  ................................................................................
1ju2A  ................................................................................
1tdfA  ................................................................................
1trbA  ................................................................................
1gxfA  ................................................................................
1bzlA  ................................................................................
1ndaA  ................................................................................
1aogA  ................................................................................
1onfA  ................................................................................
1xanA  ................................................................................
3grsA  ................................................................................
1fl2A  ................................................................................
1l9cA  ................................................................................
2gf3A  ................................................................................
3bhkA  ................................................................................
3grtA  ................................................................................
1grtA  ................................................................................
1hyuA  ................................................................................
1w4xA  ................................................................................
1sezA  ................................................................................
1h6vA  ................................................................................
1rp0A  ................................................................................
2f5vA  ................................................................................
2f6cA  ................................................................................
1tzlA  ................................................................................
2gv8A  ................................................................................
1vqwA  ................................................................................
2ignA  ................................................................................
1vdcA  ................................................................................
1ng4A  ................................................................................
1ryiA  ................................................................................
1xdiA  ................................................................................
2vouA  ................................................................................
1xhcA  ................................................................................
1b8sA  ................................................................................
1n4wA  ................................................................................
3cnjA  ................................................................................
1q1rA  ................................................................................
1f8wA  ................................................................................
1nhqA  ................................................................................
1nhrA  ................................................................................
1ijhA  ................................................................................
3b6dA  ................................................................................
1cc2A  ................................................................................
3b3rA  ................................................................................
1npxA  ................................................................................
1cboA  ................................................................................
1nhsA  ................................................................................
1nhpA  ................................................................................
1mo9A  ................................................................................
1fcdA  ................................................................................
1m6iA  ................................................................................
1gv4A  ................................................................................
3coxA  ................................................................................
1d7yA  ................................................................................
1d7yA  ................................................................................
1fcdA  ................................................................................
1ps9A  ................................................................................
1djnA  ................................................................................
1djqA  ................................................................................
2culA  ................................................................................
1gv4A  ................................................................................
1m6iA  ................................................................................
1nhrA  ................................................................................
1nhqA  ................................................................................
2gv8A  ................................................................................
1vqwA  ................................................................................
1gndA  ................................................................................
1lv0A  ................................................................................
1d5tA  ................................................................................
3cpiG  ................................................................................
2bcgG  ................................................................................
1fcdA  ................................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0037441 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Aster yellows witches'-broom phytoplasma AYWB
NoYes   Onion yellows phytoplasma OY-M
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma haemocanis str. Illinois
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Mycoplasma suis KI3806
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma haemofelis Ohio2
NoYes   Mycoplasma bovis HB0801
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma putrefaciens KS1
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma arthritidis 158L3-1
NoYes   Mycoplasma agalactiae PG2
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes