SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

RNI-like alignments in Homo sapiens

These alignments are sequences aligned to the 0045711 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1a4ya_                             sld.............................................................
gi|21955154|ref|NP_653288.1|      s...............................................................
gi|33519450|ref|NP_789790.2|      q...............................................................
gi|28827813|ref|NP_789792.1|      ................................................................
gi|119395764|ref|NP_001073289.1|  q...............................................................
gi|34878693|ref|NP_004886.3|      q...............................................................
gi|158321897|ref|NP_703148.4|     v...............................................................
gi|194018482|ref|NP_604393.2|     d...............................................................
gi|110624785|ref|NP_789780.2|     l...............................................................
gi|21361547|ref|NP_002930.2|      q...............................................................
gi|42794608|ref|NP_976318.1|      q...............................................................
gi|42822864|ref|NP_976322.1|      q...............................................................
gi|42822866|ref|NP_976323.1|      q...............................................................
gi|42822868|ref|NP_976321.1|      q...............................................................
gi|42822870|ref|NP_976320.1|      q...............................................................
gi|42822872|ref|NP_976317.1|      q...............................................................
gi|42822874|ref|NP_976319.1|      q...............................................................
gi|291463278|ref|NP_001167553.1|  e...............................................................
gi|291463280|ref|NP_001167554.1|  e...............................................................
gi|291463275|ref|NP_001167552.1|  e...............................................................
gi|8923473|ref|NP_060322.1|       e...............................................................
gi|194018484|ref|NP_659444.2|     hh..............................................................
gi|187937176|ref|NP_001120727.1|  vl..............................................................
gi|33667040|ref|NP_789781.2|      ................................................................
gi|46049100|ref|NP_631915.2|      vl..............................................................
gi|113205085|ref|NP_079003.2|     ssmeknehfl......................................................
gi|188536116|ref|NP_001120933.1|  q...............................................................
gi|338797736|ref|NP_061994.1|     edivsg..........................................................
gi|5174617|ref|NP_006083.1|       n...............................................................
gi|188536002|ref|NP_001120934.1|  q...............................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|15193292|ref|NP_150639.1|      ................................................................
gi|118918429|ref|NP_849172.2|     vlq.............................................................
gi|289666780|ref|NP_001166250.1|  r...............................................................
gi|75709196|ref|NP_996611.2|      vl..............................................................
gi|168986655|ref|NP_919263.2|     elyleacklmgvv...................................................
gi|116268109|ref|NP_115582.3|     e...............................................................
gi|11545912|ref|NP_071445.1|      glnvg...........................................................
gi|118918429|ref|NP_849172.2|     a...............................................................
gi|289666778|ref|NP_699184.2|     vt..............................................................
gi|27734755|ref|NP_116264.2|      lllrifsfldvvtlcrcaqvsraw........................................
gi|4506411|ref|NP_002874.1|       laetlaktqvaggq..................................................
gi|284447308|ref|NP_036289.3|     llrifsfldivtlcrca...............................................
gi|289666782|ref|NP_001166251.1|  r...............................................................
gi|74271814|ref|NP_001028225.1|   h...............................................................
gi|7662386|ref|NP_055737.1|       h...............................................................
gi|14719829|ref|NP_127497.1|      h...............................................................
gi|296531375|ref|NP_001171835.1|  lrifsfldvvt.....................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|308818204|ref|NP_001184224.1|  rtiscinamltqipp.................................................
gi|4557543|ref|NP_001384.1|       rtiscinamltqipp.................................................
gi|21389431|ref|NP_653221.1|      kiekee..........................................................
gi|14719835|ref|NP_127500.1|      h...............................................................
gi|14719833|ref|NP_127499.1|      h...............................................................
gi|34878690|ref|NP_899632.1|      q...............................................................
gi|229577123|ref|NP_872345.2|     lgdl............................................................
gi|6912466|ref|NP_036436.1|       dralkvltrrlcqdtpnv..............................................
gi|156415984|ref|NP_037485.2|     tniee...........................................................
gi|7657647|ref|NP_055363.1|       nveislqqmka.....................................................
gi|7657649|ref|NP_055362.1|       tnveeslkrtkend..................................................
gi|289666746|ref|NP_699181.2|     tdaglevmleq.....................................................
gi|197333692|ref|NP_001127948.1|  vklps...........................................................
gi|21245134|ref|NP_056165.1|      vklps...........................................................
gi|161333852|ref|NP_659469.3|     k...............................................................
gi|284447314|ref|NP_001165184.1|  tlcrcaqiskawnilaldg.............................................
gi|260763922|ref|NP_001159588.1|  nstdveetl.......................................................
gi|4507553|ref|NP_003266.1|       nstdveetl.......................................................
gi|21361547|ref|NP_002930.2|      i...............................................................
gi|42794608|ref|NP_976318.1|      i...............................................................
gi|42822864|ref|NP_976322.1|      i...............................................................
gi|42822866|ref|NP_976323.1|      i...............................................................
gi|42822868|ref|NP_976321.1|      i...............................................................
gi|42822870|ref|NP_976320.1|      i...............................................................
gi|42822872|ref|NP_976317.1|      i...............................................................
gi|42822874|ref|NP_976319.1|      i...............................................................
gi|62912470|ref|NP_001017403.1|   s...............................................................
gi|38348406|ref|NP_940967.1|      slslhsch........................................................
gi|187608777|ref|NP_038460.4|     lg..............................................................
gi|16306595|ref|NP_005974.2|      sqgviafrcprsfmdqplaehfspfr......................................
gi|22748931|ref|NP_689654.1|      rslsy...........................................................
gi|150378503|ref|NP_997046.1|     nptviedaldkiksndpdt.............................................
gi|4504379|ref|NP_003658.1|       fdg.............................................................
gi|255683361|ref|NP_001156787.2|  vlafkcpgllrytayrck..............................................
gi|61175232|ref|NP_001012992.1|   iq..............................................................
gi|54607116|ref|NP_938012.2|      dldgslrrvrkn....................................................
gi|20302168|ref|NP_619542.1|      nrrlqevpqtvgk...................................................
gi|21450705|ref|NP_659436.1|      lqqlhqlprg......................................................
gi|112380630|ref|NP_036266.2|     ifdeplervknnd...................................................
gi|291190783|ref|NP_001167448.1|  lq..............................................................
gi|291190781|ref|NP_060110.4|     lq..............................................................
gi|66392157|ref|NP_001013860.1|   g...............................................................
gi|19924149|ref|NP_612564.1|      n...............................................................
gi|312433960|ref|NP_001186067.1|  gihlyqestsksalsq................................................
gi|312433962|ref|NP_001186068.1|  gihlyqestsksalsq................................................
gi|40788015|ref|NP_067032.3|      gihlyqestsksalsq................................................
gi|16306588|ref|NP_036292.2|      ywaklddts.......................................................
gi|14249170|ref|NP_116026.1|      sqgviafrcprsfmdqplaehfspfr......................................
gi|156938257|ref|NP_612369.3|     hg..............................................................
gi|161333854|ref|NP_001104508.1|  k...............................................................
gi|19718734|ref|NP_003255.2|      sipsgltea.......................................................
gi|149274651|ref|NP_115547.1|     fqlc............................................................
gi|149274621|ref|NP_001092272.1|  fqlc............................................................
gi|291190781|ref|NP_060110.4|     a...............................................................
gi|291190783|ref|NP_001167448.1|  a...............................................................
gi|163965441|ref|NP_653303.2|     sk..............................................................
gi|161333852|ref|NP_659469.3|     hawmlmtqlnslwnaidfssv...........................................
gi|190194416|ref|NP_077302.3|     ................................................................
gi|21264320|ref|NP_612202.1|      y...............................................................
gi|25777608|ref|NP_078894.2|      v...............................................................
gi|218931148|ref|NP_001136357.1|  ptnveislqqmka...................................................
gi|156938257|ref|NP_612369.3|     aa..............................................................
gi|156938336|ref|NP_000237.2|     ls..............................................................
gi|54112380|ref|NP_001005366.1|   dlcvcmrvcrtwnrwccdkrlw..........................................
gi|54112382|ref|NP_115979.3|      dlcvcmrvcrtwnrwccdkrlw..........................................
gi|157168349|ref|NP_001093254.2|  elcicmrvcrtwsrwcydkrlwprmdlsrrksltppmlsgvvr.....................
gi|118442828|ref|NP_001072983.1|  gnkpvetig.......................................................
gi|4507375|ref|NP_003184.1|       gnkpvetig.......................................................
gi|116268109|ref|NP_115582.3|     s...............................................................
gi|25777610|ref|NP_733840.1|      ev..............................................................
gi|164663798|ref|NP_001106873.1|  pe..............................................................
gi|66392157|ref|NP_001013860.1|   a...............................................................
gi|161333854|ref|NP_001104508.1|  iicgqvnhawmlmtqlnsl.............................................
gi|16306580|ref|NP_036440.1|      elcecmrvcktwykwccdkrl...........................................
gi|341916269|ref|XP_003403438.1|  irpalelskasvt...................................................
gi|119393876|ref|NP_075043.1|     palelskasvtk....................................................
gi|341916267|ref|XP_003403437.1|  palelskasvtk....................................................
gi|119393878|ref|NP_004527.2|     palelskasvtk....................................................
gi|341916263|ref|XP_003403435.1|  palelskasvtk....................................................
gi|40255157|ref|NP_700356.2|      cpttcrclgdlldcsrkrlarlpeplpsw...................................
gi|16306576|ref|NP_036294.1|      ltlihwksqvhpv...................................................
gi|302129689|ref|NP_001180464.1|  pyvgtsvk........................................................
gi|302129687|ref|NP_001180463.1|  pyvgtsvk........................................................
gi|16306572|ref|NP_036293.1|      pyvgtsvk........................................................
gi|341915644|ref|XP_003403561.1|  laivncqvygrnal..................................................
gi|341913879|ref|XP_003403707.1|  laivncqvygrnal..................................................
gi|61742136|ref|NP_078831.3|      wlmpnrfsqlqrltlih...............................................
gi|38569471|ref|NP_006360.3|      qrf.............................................................
gi|16306591|ref|NP_036295.1|      psqlaslslahcsslksrpelehqasgtkdacpepqgps.........................
gi|51873034|ref|NP_001004055.1|   psqlaslslahcsslksrpelehqasgtkdacpepqgps.........................
gi|341916265|ref|XP_003403436.1|  dmqrraspdlstgy..................................................
gi|7661860|ref|NP_055480.1|       lr..............................................................
gi|122937351|ref|NP_001073947.1|  sqllhvlrlagpga..................................................
gi|46249367|ref|NP_996836.1|      klqvldlrknshqdfwtvwsgnraslysfpepeaaqpmtkkrkvdglsteaeqpfipvevlvdl
gi|46249369|ref|NP_996837.1|      klqvldlrknshqdfwtvwsgnraslysfpepeaaqpmtkkrkvdglsteaeqpfipvevlvdl
gi|46249371|ref|NP_996838.1|      klqvldlrknshqdfwtvwsgnraslysfpepeaaqpmtkkrkvdglsteaeqpfipvevlvdl
gi|46249373|ref|NP_996839.1|      klqvldlrknshqdfwtvwsgnraslysfpepeaaqpmtkkrkvdglsteaeqpfipvevlvdl
gi|5174641|ref|NP_006106.1|       klqvldlrknshqdfwtvwsgnraslysfpepeaaqpmtkkrkvdglsteaeqpfipvevlvdl
gi|88942379|ref|XP_933494.1|      hltclllwvkqrk...................................................
gi|148356236|ref|NP_001091846.1|  yltylllwvkqr....................................................
gi|61102721|ref|NP_001010890.1|   yltylllwvkqr....................................................
gi|153792112|ref|NP_001093322.1|  hlcckklkm.......................................................
gi|153945800|ref|NP_001093584.1|  hlcckklkm.......................................................
gi|61696142|ref|NP_001013425.1|   hlcckklkilgmpfr.................................................
gi|226437621|ref|NP_001139816.1|  cckklkilgmpfr...................................................
gi|59958373|ref|NP_001009611.1|   hlcckklkilgmpfr.................................................
gi|58219004|ref|NP_001010889.1|   hlcckklkilgmpfr.................................................
gi|153791443|ref|NP_001093320.1|  rsvhlcctkvvnysmnilnfrniletv.....................................
gi|310118528|ref|XP_003118894.1|  ypdsi...........................................................
gi|310118526|ref|XP_001130065.3|  hlcckklkilgmpfr.................................................
gi|55742693|ref|NP_078922.1|      fchhklveldatgvnaditi............................................
gi|194306635|ref|NP_001093260.2|  ypdsiqvleiwnmcwpcm..............................................
gi|66954681|ref|NP_001019832.1|   ylfqwvyqrrglvhl.................................................
gi|59676593|ref|NP_001012277.1|   tqevrprqsklqvldlrnvdenfcdifsgatasfpealsqkqtadncpgtgrqqpfmvfidlcl
gi|59676587|ref|NP_001012276.1|   qevrprqsklqvldlrnvdenfcdifsgatasfpealsqkqtadncpgtgrqqpfmvfidlclk
gi|12738831|ref|NP_075389.1|      eclrylfqwvyqrrglvhlc............................................
gi|194306638|ref|NP_001013714.3|  svhlcctkvvnysmsilnfrniletv......................................
gi|8923179|ref|NP_060173.1|       vchrwkrlvddrwlwrhvdltlytmrpkvmwh................................
gi|124249372|ref|NP_001074299.1|  cprpggqqplmvildlcfkngmldeclthflewgkqrkgllhvcckelqifgiaihriievlnt
gi|154800493|ref|NP_001094101.1|  hlcctkvvnysmsilnfrniletvyp......................................
gi|29789255|ref|NP_085132.1|      l...............................................................
gi|194018550|ref|NP_938204.2|     l...............................................................
gi|157426875|ref|NP_079239.3|     igre............................................................
gi|33589814|ref|NP_006327.2|      rst.............................................................
gi|12738834|ref|NP_075390.1|      vyqrrglvhlccs...................................................
gi|341915238|ref|XP_938952.6|     lmtiqdehyt......................................................
gi|153792140|ref|NP_001093324.1|  eclrylfqwvyqrrglvhlccsklvny.....................................
gi|16506299|ref|NP_443172.1|      lcslclrnrylvisekle..............................................
gi|194018546|ref|NP_001034450.2|  stlde...........................................................
gi|226437632|ref|NP_001004339.2|  nqmklklvniqkakistaafikafcrhklielnatavha.........................
gi|113865933|ref|NP_001038945.1|  dec.............................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|157426839|ref|NP_001093321.1|  dec.............................................................
gi|268832194|ref|NP_001161343.1|  c...............................................................
gi|268832172|ref|NP_060505.2|     c...............................................................
gi|268830752|ref|NP_001161339.1|  c...............................................................
gi|165932385|ref|NP_001107039.1|  vkrkpqa.........................................................
gi|134288867|ref|NP_997527.2|     t...............................................................
gi|23397500|ref|NP_694962.1|      lehlevkfmnpynavltkkfqvt.........................................
gi|148922963|ref|NP_036291.2|     vs..............................................................
gi|16306584|ref|NP_036290.1|      likqiikrhsnhlqyvsfkvdsskesaeaa..................................
gi|45505155|ref|NP_110420.3|      pcipm...........................................................
gi|45545409|ref|NP_995308.1|      ipcipm..........................................................
gi|22547146|ref|NP_060848.2|      havcgaas........................................................
gi|51558774|ref|NP_001003803.1|   fdhmegle........................................................
gi|289803020|ref|NP_001073879.2|  llkaagg.........................................................
gi|158321897|ref|NP_703148.4|     ed..............................................................
gi|28827813|ref|NP_789792.1|      c...............................................................


                                                                                               10   
                                                                                                |   
d1a4ya_                             ...................................................---IQSLDIQCEE
gi|21955154|ref|NP_653288.1|      ...................................................------LEFFSCL
gi|33519450|ref|NP_789790.2|      ...................................................-------ELFIGL
gi|28827813|ref|NP_789792.1|      ...................................................-------------
gi|119395764|ref|NP_001073289.1|  ...................................................------LELFYCL
gi|34878693|ref|NP_004886.3|      ...................................................------LELFYCL
gi|158321897|ref|NP_703148.4|     ...................................................-------------
gi|194018482|ref|NP_604393.2|     ...................................................-----SLAIFYCL
gi|110624785|ref|NP_789780.2|     ...................................................-------RLFHCL
gi|21361547|ref|NP_002930.2|      ...................................................-------------
gi|42794608|ref|NP_976318.1|      ...................................................-------------
gi|42822864|ref|NP_976322.1|      ...................................................-------------
gi|42822866|ref|NP_976323.1|      ...................................................-------------
gi|42822868|ref|NP_976321.1|      ...................................................-------------
gi|42822870|ref|NP_976320.1|      ...................................................-------------
gi|42822872|ref|NP_976317.1|      ...................................................-------------
gi|42822874|ref|NP_976319.1|      ...................................................-------------
gi|291463278|ref|NP_001167553.1|  ...................................................--------LLGCL
gi|291463280|ref|NP_001167554.1|  ...................................................--------LLGCL
gi|291463275|ref|NP_001167552.1|  ...................................................--------LLGCL
gi|8923473|ref|NP_060322.1|       ...................................................--------LLGCL
gi|194018484|ref|NP_659444.2|     ...................................................------MPLFYCL
gi|187937176|ref|NP_001120727.1|  ...................................................----------GCL
gi|33667040|ref|NP_789781.2|      ...................................................--------LFYCL
gi|46049100|ref|NP_631915.2|      ...................................................----------GCL
gi|113205085|ref|NP_079003.2|     ...................................................-------------
gi|188536116|ref|NP_001120933.1|  ...................................................------LELFYCL
gi|338797736|ref|NP_061994.1|     ...................................................------------A
gi|5174617|ref|NP_006083.1|       ...................................................-------------
gi|188536002|ref|NP_001120934.1|  ...................................................------LELFYCL
gi|116268109|ref|NP_115582.3|     ...................................................-------------
gi|15193292|ref|NP_150639.1|      ...................................................-------------
gi|118918429|ref|NP_849172.2|     ...................................................-------------
gi|289666780|ref|NP_001166250.1|  ...................................................-------------
gi|75709196|ref|NP_996611.2|      ...................................................----------GCL
gi|168986655|ref|NP_919263.2|     ...................................................-------------
gi|116268109|ref|NP_115582.3|     ...................................................--------LCHCV
gi|11545912|ref|NP_071445.1|      ...................................................-------------
gi|118918429|ref|NP_849172.2|     ...................................................-------------
gi|289666778|ref|NP_699184.2|     ...................................................-------------
gi|27734755|ref|NP_116264.2|      ...................................................-------------
gi|4506411|ref|NP_002874.1|       ...................................................-------------
gi|284447308|ref|NP_036289.3|     ...................................................-------------
gi|289666782|ref|NP_001166251.1|  ...................................................-------------
gi|74271814|ref|NP_001028225.1|   ...................................................-----SLESLHCL
gi|7662386|ref|NP_055737.1|       ...................................................-----SLESLHCL
gi|14719829|ref|NP_127497.1|      ...................................................-----SLESLHCL
gi|296531375|ref|NP_001171835.1|  ...................................................-------------
gi|226342931|ref|NP_079101.3|     ...................................................-------------
gi|308818204|ref|NP_001184224.1|  ...................................................-------------
gi|4557543|ref|NP_001384.1|       ...................................................-------------
gi|21389431|ref|NP_653221.1|      ...................................................-------------
gi|14719835|ref|NP_127500.1|      ...................................................-----SLESLHCL
gi|14719833|ref|NP_127499.1|      ...................................................-----SLESLHCL
gi|34878690|ref|NP_899632.1|      ...................................................------LELFYCL
gi|229577123|ref|NP_872345.2|     ...................................................-------------
gi|6912466|ref|NP_036436.1|       ...................................................-------------
gi|156415984|ref|NP_037485.2|     ...................................................-------------
gi|7657647|ref|NP_055363.1|       ...................................................-------------
gi|7657649|ref|NP_055362.1|       ...................................................-------------
gi|289666746|ref|NP_699181.2|     ...................................................-------------
gi|197333692|ref|NP_001127948.1|  ...................................................-------------
gi|21245134|ref|NP_056165.1|      ...................................................-------------
gi|161333852|ref|NP_659469.3|     ...................................................-------------
gi|284447314|ref|NP_001165184.1|  ...................................................-------------
gi|260763922|ref|NP_001159588.1|  ...................................................-------------
gi|4507553|ref|NP_003266.1|       ...................................................-------------
gi|21361547|ref|NP_002930.2|      ...................................................-------------
gi|42794608|ref|NP_976318.1|      ...................................................-------------
gi|42822864|ref|NP_976322.1|      ...................................................-------------
gi|42822866|ref|NP_976323.1|      ...................................................-------------
gi|42822868|ref|NP_976321.1|      ...................................................-------------
gi|42822870|ref|NP_976320.1|      ...................................................-------------
gi|42822872|ref|NP_976317.1|      ...................................................-------------
gi|42822874|ref|NP_976319.1|      ...................................................-------------
gi|62912470|ref|NP_001017403.1|   ...................................................-------------
gi|38348406|ref|NP_940967.1|      ...................................................-------------
gi|187608777|ref|NP_038460.4|     ...................................................-------------
gi|16306595|ref|NP_005974.2|      ...................................................-------------
gi|22748931|ref|NP_689654.1|      ...................................................-------------
gi|150378503|ref|NP_997046.1|     ...................................................-------------
gi|4504379|ref|NP_003658.1|       ...................................................-------------
gi|255683361|ref|NP_001156787.2|  ...................................................-------------
gi|61175232|ref|NP_001012992.1|   ...................................................-------------
gi|54607116|ref|NP_938012.2|      ...................................................-------------
gi|20302168|ref|NP_619542.1|      ...................................................-------------
gi|21450705|ref|NP_659436.1|      ...................................................-------------
gi|112380630|ref|NP_036266.2|     ...................................................-------------
gi|291190783|ref|NP_001167448.1|  ...................................................-------------
gi|291190781|ref|NP_060110.4|     ...................................................-------------
gi|66392157|ref|NP_001013860.1|   ...................................................-------------
gi|19924149|ref|NP_612564.1|      ...................................................-------------
gi|312433960|ref|NP_001186067.1|  ...................................................-------------
gi|312433962|ref|NP_001186068.1|  ...................................................-------------
gi|40788015|ref|NP_067032.3|      ...................................................-------------
gi|16306588|ref|NP_036292.2|      ...................................................-------------
gi|14249170|ref|NP_116026.1|      ...................................................-------------
gi|156938257|ref|NP_612369.3|     ...................................................-------------
gi|161333854|ref|NP_001104508.1|  ...................................................-------------
gi|19718734|ref|NP_003255.2|      ...................................................-------------
gi|149274651|ref|NP_115547.1|     ...................................................-------------
gi|149274621|ref|NP_001092272.1|  ...................................................-------------
gi|291190781|ref|NP_060110.4|     ...................................................--CVCDWLGFSYR
gi|291190783|ref|NP_001167448.1|  ...................................................--CVCDWLGFSYR
gi|163965441|ref|NP_653303.2|     ...................................................-------------
gi|161333852|ref|NP_659469.3|     ...................................................-------------
gi|190194416|ref|NP_077302.3|     ...................................................-------------
gi|21264320|ref|NP_612202.1|      ...................................................-----PLELLYCL
gi|25777608|ref|NP_078894.2|      ...................................................-------------
gi|218931148|ref|NP_001136357.1|  ...................................................-------------
gi|156938257|ref|NP_612369.3|     ...................................................---LCDYNGLHCR
gi|156938336|ref|NP_000237.2|     ...................................................-------------
gi|54112380|ref|NP_001005366.1|   ...................................................-------------
gi|54112382|ref|NP_115979.3|      ...................................................-------------
gi|157168349|ref|NP_001093254.2|  ...................................................-------------
gi|118442828|ref|NP_001072983.1|  ...................................................-------------
gi|4507375|ref|NP_003184.1|       ...................................................-------------
gi|116268109|ref|NP_115582.3|     ...................................................-------------
gi|25777610|ref|NP_733840.1|      ...................................................-------------
gi|164663798|ref|NP_001106873.1|  ...................................................-------------
gi|66392157|ref|NP_001013860.1|   ...................................................---LCDYNGFPFR
gi|161333854|ref|NP_001104508.1|  ...................................................-------------
gi|16306580|ref|NP_036440.1|      ...................................................-------------
gi|341916269|ref|XP_003403438.1|  ...................................................-------------
gi|119393876|ref|NP_075043.1|     ...................................................-------------
gi|341916267|ref|XP_003403437.1|  ...................................................-------------
gi|119393878|ref|NP_004527.2|     ...................................................-------------
gi|341916263|ref|XP_003403435.1|  ...................................................-------------
gi|40255157|ref|NP_700356.2|      ...................................................-------------
gi|16306576|ref|NP_036294.1|      ...................................................-------------
gi|302129689|ref|NP_001180464.1|  ...................................................-------------
gi|302129687|ref|NP_001180463.1|  ...................................................-------------
gi|16306572|ref|NP_036293.1|      ...................................................-------------
gi|341915644|ref|XP_003403561.1|  ...................................................-------------
gi|341913879|ref|XP_003403707.1|  ...................................................-------------
gi|61742136|ref|NP_078831.3|      ...................................................-------------
gi|38569471|ref|NP_006360.3|      ...................................................-------------
gi|16306591|ref|NP_036295.1|      ...................................................-------------
gi|51873034|ref|NP_001004055.1|   ...................................................-------------
gi|341916265|ref|XP_003403436.1|  ...................................................-------------
gi|7661860|ref|NP_055480.1|       ...................................................-------------
gi|122937351|ref|NP_001073947.1|  ...................................................-------------
gi|46249367|ref|NP_996836.1|      .....................................flkegacdelfsyl-------------
gi|46249369|ref|NP_996837.1|      .....................................flkegacdelfsyl-------------
gi|46249371|ref|NP_996838.1|      .....................................flkegacdelfsyl-------------
gi|46249373|ref|NP_996839.1|      .....................................flkegacdelfsyl-------------
gi|5174641|ref|NP_006106.1|       .....................................flkegacdelfsyl-------------
gi|88942379|ref|XP_933494.1|      ...................................................-------------
gi|148356236|ref|NP_001091846.1|  ...................................................-------------
gi|61102721|ref|NP_001010890.1|   ...................................................-------------
gi|153792112|ref|NP_001093322.1|  ...................................................-------------
gi|153945800|ref|NP_001093584.1|  ...................................................-------------
gi|61696142|ref|NP_001013425.1|   ...................................................-------------
gi|226437621|ref|NP_001139816.1|  ...................................................-------------
gi|59958373|ref|NP_001009611.1|   ...................................................-------------
gi|58219004|ref|NP_001010889.1|   ...................................................-------------
gi|153791443|ref|NP_001093320.1|  ...................................................-------------
gi|310118528|ref|XP_003118894.1|  ...................................................-------------
gi|310118526|ref|XP_001130065.3|  ...................................................-------------
gi|55742693|ref|NP_078922.1|      ...................................................-------------
gi|194306635|ref|NP_001093260.2|  ...................................................-------------
gi|66954681|ref|NP_001019832.1|   ...................................................----------CCS
gi|59676593|ref|NP_001012277.1|   knrtldeclthllewgkqrkgllhvcckelqvfgmpihsiievlnmveldc-------------
gi|59676587|ref|NP_001012276.1|   .nrtldeclthllewgkqrkgllhvccqelqvfgmpihsiievlnmveldc-------------
gi|12738831|ref|NP_075389.1|      ...................................................-----------CS
gi|194306638|ref|NP_001013714.3|  ...................................................-------------
gi|8923179|ref|NP_060173.1|       ...................................................-------------
gi|124249372|ref|NP_001074299.1|  ..............................................veldc-------------
gi|154800493|ref|NP_001094101.1|  ...................................................-------------
gi|29789255|ref|NP_085132.1|      ...................................................-------------
gi|194018550|ref|NP_938204.2|     ...................................................-------------
gi|157426875|ref|NP_079239.3|     ...................................................-------------
gi|33589814|ref|NP_006327.2|      ...................................................-------------
gi|12738834|ref|NP_075390.1|      ...................................................-------------
gi|341915238|ref|XP_938952.6|     ...................................................-------------
gi|153792140|ref|NP_001093324.1|  ...................................................-------------
gi|16506299|ref|NP_443172.1|      ...................................................-------------
gi|194018546|ref|NP_001034450.2|  ...................................................-------------
gi|226437632|ref|NP_001004339.2|  ...................................................-------------
gi|113865933|ref|NP_001038945.1|  ...................................................-------------
gi|116268109|ref|NP_115582.3|     ...................................................-------------
gi|157426839|ref|NP_001093321.1|  ...................................................-------------
gi|268832194|ref|NP_001161343.1|  ...................................................-------------
gi|268832172|ref|NP_060505.2|     ...................................................-------------
gi|268830752|ref|NP_001161339.1|  ...................................................-------------
gi|165932385|ref|NP_001107039.1|  ...................................................-------------
gi|134288867|ref|NP_997527.2|     ...................................................-------------
gi|23397500|ref|NP_694962.1|      ...................................................-------------
gi|148922963|ref|NP_036291.2|     ...................................................-------------
gi|16306584|ref|NP_036290.1|      ...................................................-------------
gi|45505155|ref|NP_110420.3|      ...................................................-------------
gi|45545409|ref|NP_995308.1|      ...................................................-------------
gi|22547146|ref|NP_060848.2|      ...................................................-------------
gi|51558774|ref|NP_001003803.1|   ...................................................-------------
gi|289803020|ref|NP_001073879.2|  ...................................................-------------
gi|158321897|ref|NP_703148.4|     ...................................................-------------
gi|28827813|ref|NP_789792.1|      ...................................................-------------


                                         20        30            40              50                 
                                          |         |             |               |                 
d1a4ya_                             LSDARWAELLPLLQQCQ.VVRLDDCG...LTEAR......CKDISSALR..VNPA....LA...
gi|21955154|ref|NP_653288.1|      YEIQEEEFIQQALSHFQ.VIVVSNIA...SKM-E......HMVSSFCLK..RCRS....AQ...
gi|33519450|ref|NP_789790.2|      FETQEKEFVTKVMNFFE.EVFIYIGN...IEH--......LVIASFCLK..HCQH....LT...
gi|28827813|ref|NP_789792.1|      -----------------.--------...-----......---------..----....--...
gi|119395764|ref|NP_001073289.1|  YEMQEEDFVQRAMDYFP.KIEINLS-...-TRMD......HMVSSFCIE..NCHR....VE...
gi|34878693|ref|NP_004886.3|      YEMQEEDFVQRAMDYFP.KIEINLS-...-TRMD......HMVSSFCIE..NCHR....VE...
gi|158321897|ref|NP_703148.4|     -----------------.--------...-----......---------..----....--...
gi|194018482|ref|NP_604393.2|     FEMQDPAFVKQAVNLLQ.EANFHII-...-DNVD......LVVSAYCLK..YCSS....LR...
gi|110624785|ref|NP_789780.2|     HESQEEDFTKKMLGRIF.EVDLNILE...DEE--......LQASSFCLK..HCKR....LN...
gi|21361547|ref|NP_002930.2|      -----------------.--------...-----......---------..----....--...
gi|42794608|ref|NP_976318.1|      -----------------.--------...-----......---------..----....--...
gi|42822864|ref|NP_976322.1|      -----------------.--------...-----......---------..----....--...
gi|42822866|ref|NP_976323.1|      -----------------.--------...-----......---------..----....--...
gi|42822868|ref|NP_976321.1|      -----------------.--------...-----......---------..----....--...
gi|42822870|ref|NP_976320.1|      -----------------.--------...-----......---------..----....--...
gi|42822872|ref|NP_976317.1|      -----------------.--------...-----......---------..----....--...
gi|42822874|ref|NP_976319.1|      -----------------.--------...-----......---------..----....--...
gi|291463278|ref|NP_001167553.1|  YESQEEELVKEVMAQFK.EISLHLNA...VDVVP......---SSFCVK..HCRN....LQ...
gi|291463280|ref|NP_001167554.1|  YESQEEELVKEVMAQFK.EISLHLNA...VDVVP......---SSFCVK..HCRN....LQ...
gi|291463275|ref|NP_001167552.1|  YESQEEELVKEVMAQFK.EISLHLNA...VDVVP......---SSFCVK..HCRN....LQ...
gi|8923473|ref|NP_060322.1|       YESQEEELVKEVMAQFK.EISLHLNA...VDVVP......---SSFCVK..HCRN....LQ...
gi|194018484|ref|NP_659444.2|     YENREEEFVKTIVDALM.EVTVYLQ-...-SDKD......MMVSLYCLD..YCCH....LR...
gi|187937176|ref|NP_001120727.1|  YESQEEELAKVVVAPFK.EISIHLTN...TSE--......VMHCSFSLK..HCQD....LQ...
gi|33667040|ref|NP_789781.2|      HEIREEAFVSQALNDYH.KVVLRIGN...NKE--......VQVSAFCLK..RCQY....LH...
gi|46049100|ref|NP_631915.2|      YESQEEELAKVVVAPFK.EISIHLTN...TSE--......VMHCSFSLK..HCQD....LQ...
gi|113205085|ref|NP_079003.2|     -------QKLGKKAVNK.CLDLNNCG...LTTAD......MKEMVALLP..FLPD....LE...
gi|188536116|ref|NP_001120933.1|  YEMQEEDFVQRAMDYFP.KIEINLS-...-TRMD......HMVSSFCIE..NCHR....VE...
gi|338797736|ref|NP_061994.1|     VEPKDPWRHAQNVTVDE.VIGAYKQA...CQKLN......CRQIPKLLR..QLQE....FTdlg
gi|5174617|ref|NP_006083.1|       -----------------.--------...-----......---------..----....--...
gi|188536002|ref|NP_001120934.1|  YEMQEEDFVQRAMDYFP.KIEINLS-...-TRMD......HMVSSFCIE..NCHR....VE...
gi|116268109|ref|NP_115582.3|     -----------------.--------...-----......---------..----....--...
gi|15193292|ref|NP_150639.1|      -----------------.--------...-----......---------..----....--...
gi|118918429|ref|NP_849172.2|     -----------------.--------...-----......---------..----....--...
gi|289666780|ref|NP_001166250.1|  -----------------.--------...-----......---------..----....--...
gi|75709196|ref|NP_996611.2|      YESQEEELAKVVVAPFK.EISIHLTN...TSE--......VMHCSFSLK..HCQD....LQ...
gi|168986655|ref|NP_919263.2|     -----------------.--------...-----......---------..----....--...
gi|116268109|ref|NP_115582.3|     DETQEPELASLTAQSLPyQLPFHNFP...LTCTD......LATLTNILE..HREA....PI...
gi|11545912|ref|NP_071445.1|      -----------------.--------...-----......---------..----....--...
gi|118918429|ref|NP_849172.2|     -----------------.--------...-----......---------..----....--...
gi|289666778|ref|NP_699184.2|     -----------------.--------...-----......---------..----....--...
gi|27734755|ref|NP_116264.2|      ------NVLALDG----.--------...-----......---------..--SN....WQ...
gi|4506411|ref|NP_002874.1|       -----------------.--------...-----......---------..----....--...
gi|284447308|ref|NP_036289.3|     QISKAWNILALDGSN--.--------...-----......---------..----....WQ...
gi|289666782|ref|NP_001166251.1|  -----------------.--------...-----......---------..----....--...
gi|74271814|ref|NP_001028225.1|   YETRNKTFLTQVMAHFE.EMGMCVE-...-TDME......LLVCTFCIK..FSRH....VK...
gi|7662386|ref|NP_055737.1|       YETRNKTFLTQVMAHFE.EMGMCVE-...-TDME......LLVCTFCIK..FSRH....VK...
gi|14719829|ref|NP_127497.1|      YETRNKTFLTQVMAHFE.EMGMCVE-...-TDME......LLVCTFCIK..FSRH....VK...
gi|296531375|ref|NP_001171835.1|  -----------------.--------...-----......---LCRCAQ..VSRA....WN...
gi|226342931|ref|NP_079101.3|     -----------------.--------...-----......---------..----....--...
gi|308818204|ref|NP_001184224.1|  -----------------.--------...-----......--------L..TAPQ....IT...
gi|4557543|ref|NP_001384.1|       -----------------.--------...-----......--------L..TAPQ....IT...
gi|21389431|ref|NP_653221.1|      -----------------.--------...-----......---------..----....--...
gi|14719835|ref|NP_127500.1|      YETRNKTFLTQVMAHFE.EMGMCVE-...-TDME......LLVCTFCIK..FSRH....VK...
gi|14719833|ref|NP_127499.1|      YETRNKTFLTQVMAHFE.EMGMCVE-...-TDME......LLVCTFCIK..FSRH....VK...
gi|34878690|ref|NP_899632.1|      YEMQEEDFVQRAMDYFP.KIEINLS-...-TRMD......HMVSSFCIE..NCHR....VE...
gi|229577123|ref|NP_872345.2|     -----------------.--------...-----......---------..----....--...
gi|6912466|ref|NP_036436.1|       -----------------.--------...-----......---------..----....--...
gi|156415984|ref|NP_037485.2|     -----------------.--------...-----......---------..----....--...
gi|7657647|ref|NP_055363.1|       -----------------.--------...-----......---------..----....--...
gi|7657649|ref|NP_055362.1|       -----------------.--------...-----......---------..----....--...
gi|289666746|ref|NP_699181.2|     -----------------.--------...-----......---------..----....--...
gi|197333692|ref|NP_001127948.1|  -----------------.--------...-----......------AVS..QLVN....LK...
gi|21245134|ref|NP_056165.1|      -----------------.--------...-----......------AVS..QLVN....LK...
gi|161333852|ref|NP_659469.3|     -----------------.--------...-----......---------..-CSR....IT...
gi|284447314|ref|NP_001165184.1|  -------------SNWQ.RIDLFNFQ...TDVEG......---------..----....--...
gi|260763922|ref|NP_001159588.1|  -----------------.--------...-----......---------..----....--...
gi|4507553|ref|NP_003266.1|       -----------------.--------...-----......---------..----....--...
gi|21361547|ref|NP_002930.2|      -----------------.--------...-----......---------..----....--...
gi|42794608|ref|NP_976318.1|      -----------------.--------...-----......---------..----....--...
gi|42822864|ref|NP_976322.1|      -----------------.--------...-----......---------..----....--...
gi|42822866|ref|NP_976323.1|      -----------------.--------...-----......---------..----....--...
gi|42822868|ref|NP_976321.1|      -----------------.--------...-----......---------..----....--...
gi|42822870|ref|NP_976320.1|      -----------------.--------...-----......---------..----....--...
gi|42822872|ref|NP_976317.1|      -----------------.--------...-----......---------..----....--...
gi|42822874|ref|NP_976319.1|      -----------------.--------...-----......---------..----....--...
gi|62912470|ref|NP_001017403.1|   -----------------.--------...-----......---------..----....--...
gi|38348406|ref|NP_940967.1|      -LERISRGAFQEQGHLR.SLVLGDNC...LSE-N......YEETAAALH..ALPG....LR...
gi|187608777|ref|NP_038460.4|     -----------------.--------...-----......---------..----....--...
gi|16306595|ref|NP_005974.2|      -----------------.--------...-----......---------..----....--...
gi|22748931|ref|NP_689654.1|      -----------------.--------...-----......---------..----....--...
gi|150378503|ref|NP_997046.1|     -----------------.--------...-----......---------..----....--...
gi|4504379|ref|NP_003658.1|       -----------------.--------...-----......---------..----....--...
gi|255683361|ref|NP_001156787.2|  -----------------.--------...-----......---------..----....--...
gi|61175232|ref|NP_001012992.1|   -----------------.--------...-----......---------..----....--...
gi|54607116|ref|NP_938012.2|      -----------------.--------...-----......---------..----....--...
gi|20302168|ref|NP_619542.1|      -----------------.--------...-----......---------..---Y....VT...
gi|21450705|ref|NP_659436.1|      -----------------.--------...-----......---------..----....--...
gi|112380630|ref|NP_036266.2|     -----------------.--------...-----......---------..----....--...
gi|291190783|ref|NP_001167448.1|  -----------------.--------...-----......---------..----....--...
gi|291190781|ref|NP_060110.4|     -----------------.--------...-----......---------..----....--...
gi|66392157|ref|NP_001013860.1|   -----------------.--------...-----......---------..----....--...
gi|19924149|ref|NP_612564.1|      -----------------.-LDLSFNP...LRHLG......----SYSFF..SFPE....LQ...
gi|312433960|ref|NP_001186067.1|  --------EFEAFFQGK.SLYINSGN...IPD--......--YLFDFFE..HLPNc...AS...
gi|312433962|ref|NP_001186068.1|  --------EFEAFFQGK.SLYINSGN...IPD--......--YLFDFFE..HLPNc...AS...
gi|40788015|ref|NP_067032.3|      --------EFEAFFQGK.SLYINSGN...IPD--......--YLFDFFE..HLPNc...AS...
gi|16306588|ref|NP_036292.2|      -----------------.--------...-----......---LEFLQS..RCTL....VQ...
gi|14249170|ref|NP_116026.1|      -----------------.--------...-----......---------..----....--...
gi|156938257|ref|NP_612369.3|     -----------------.--------...-----......---------..----....--...
gi|161333854|ref|NP_001104508.1|  -----------------.--------...-----......---------..----....--...
gi|19718734|ref|NP_003255.2|      -----------------.--------...-----......---------..----....VK...
gi|149274651|ref|NP_115547.1|     -----------------.--------...-----......---------..----....--...
gi|149274621|ref|NP_001092272.1|  -----------------.--------...-----......---------..----....--...
gi|291190781|ref|NP_060110.4|     EEVQWDVDTIYLTQDTR.ELNLQDFSh..LDHRD......LIPIIAALE..YNQW....FT...
gi|291190783|ref|NP_001167448.1|  EEVQWDVDTIYLTQDTR.ELNLQDFSh..LDHRD......LIPIIAALE..YNQW....FT...
gi|163965441|ref|NP_653303.2|     -----------------.--------...-----......---------..----....--...
gi|161333852|ref|NP_659469.3|     -----------------.--------...-----......---------..----....--...
gi|190194416|ref|NP_077302.3|     -----------------.--------...-----......---------..----....--...
gi|21264320|ref|NP_612202.1|      YETQEDAFVRQALCRFP.ELALQRVR...FCRMD......VAVLSYCVR..CCPA....GQ...
gi|25777608|ref|NP_078894.2|      -----------------.--------...-----......---------..----....--...
gi|218931148|ref|NP_001136357.1|  -----------------.--------...-----......---------..----....--...
gi|156938257|ref|NP_612369.3|     EEVQWDVDTIYHAEDNR.EFNLLDFSh..LESRD......LALMVAALA..YNQW....FT...
gi|156938336|ref|NP_000237.2|     -----------------.--------...-----......---------..----....--...
gi|54112380|ref|NP_001005366.1|   -----------------.--------...-----......---TRIDLN..HCKS....IT...
gi|54112382|ref|NP_115979.3|      -----------------.--------...-----......---TRIDLN..HCKS....IT...
gi|157168349|ref|NP_001093254.2|  -----------------.--------...-----......---------..----....--...
gi|118442828|ref|NP_001072983.1|  -----------------.--------...-----......---------..----....--...
gi|4507375|ref|NP_003184.1|       -----------------.--------...-----......---------..----....--...
gi|116268109|ref|NP_115582.3|     -----------------.--------...-----......---------..----....--...
gi|25777610|ref|NP_733840.1|      -----------------.--------...-----......---------..----....--...
gi|164663798|ref|NP_001106873.1|  -----------------.--------...-----......---------..----....--...
gi|66392157|ref|NP_001013860.1|   EEIQWDVDTIYHRQGCR.HFSLGDFSh..LGSRD......LALSVAALS..YNLW....FR...
gi|161333854|ref|NP_001104508.1|  -----------------.--------...-----......---------..--WN....AI...
gi|16306580|ref|NP_036440.1|      -----------------.--------...-----......---------..----....--...
gi|341916269|ref|XP_003403438.1|  -----------------.--------...-----......---------..----....--...
gi|119393876|ref|NP_075043.1|     -----------------.--------...-----......---------..----....--...
gi|341916267|ref|XP_003403437.1|  -----------------.--------...-----......---------..----....--...
gi|119393878|ref|NP_004527.2|     -----------------.--------...-----......---------..----....--...
gi|341916263|ref|XP_003403435.1|  -----------------.--------...-----......---------..----....--...
gi|40255157|ref|NP_700356.2|      -----------------.--------...-----......---------..----....--...
gi|16306576|ref|NP_036294.1|      -----------------.--------...-----......---------..----....--...
gi|302129689|ref|NP_001180464.1|  -----------------.--------...-----......---------..----....--...
gi|302129687|ref|NP_001180463.1|  -----------------.--------...-----......---------..----....--...
gi|16306572|ref|NP_036293.1|      -----------------.--------...-----......---------..----....--...
gi|341915644|ref|XP_003403561.1|  -----------------.--------...-----......---------..----....--...
gi|341913879|ref|XP_003403707.1|  -----------------.--------...-----......---------..----....--...
gi|61742136|ref|NP_078831.3|      -----------------.--------...-----......---------..----....--...
gi|38569471|ref|NP_006360.3|      -----------------.--------...-----......---------..----....--...
gi|16306591|ref|NP_036295.1|      -----------------.--------...-----......---------..----....--...
gi|51873034|ref|NP_001004055.1|   -----------------.--------...-----......---------..----....--...
gi|341916265|ref|XP_003403436.1|  ------WKLSPKQYKIP.CLEVDVND...IDVVG......QDMLEILMT..VFSA....SQ...
gi|7661860|ref|NP_055480.1|       -----------------.-LCCRDLR...AEDLP......MRNTVALLQ..LLDAgc..LR...
gi|122937351|ref|NP_001073947.1|  -----------------.--------...-----......---------..----....LR...
gi|46249367|ref|NP_996836.1|      ------IEKVKRKKNVL.RLCCKKLK...IFAMP......MQDIKMILKmvQLDS....IE...
gi|46249369|ref|NP_996837.1|      ------IEKVKRKKNVL.RLCCKKLK...IFAMP......MQDIKMILKmvQLDS....IE...
gi|46249371|ref|NP_996838.1|      ------IEKVKRKKNVL.RLCCKKLK...IFAMP......MQDIKMILKmvQLDS....IE...
gi|46249373|ref|NP_996839.1|      ------IEKVKRKKNVL.RLCCKKLK...IFAMP......MQDIKMILKmvQLDS....IE...
gi|5174641|ref|NP_006106.1|       ------IEKVKRKKNVL.RLCCKKLK...IFAMP......MQDIKMILKmvQLDS....IE...
gi|88942379|ref|XP_933494.1|      ----------------D.LLHLCCKK...LKILG......-----MPFR..NIRSi...LK...
gi|148356236|ref|NP_001091846.1|  ---------------KD.LLHLCCKK...LKILG......-----MPFR..NIRSi...LK...
gi|61102721|ref|NP_001010890.1|   ---------------KD.LLHLCCKK...LKILG......-----MPFR..NIRSi...LK...
gi|153792112|ref|NP_001093322.1|  -----------------.--------...-----......---LGMLFH..NIRNi...LK...
gi|153945800|ref|NP_001093584.1|  -----------------.--------...-----......---LGMLFH..NIRNi...LK...
gi|61696142|ref|NP_001013425.1|   ----------NIRSILK.MVNLDCIQ...EVEV-......---------..----....--...
gi|226437621|ref|NP_001139816.1|  ----------NIRSILK.MVNLDCIQ...EVEVN......CKWIL----..----....--...
gi|59958373|ref|NP_001009611.1|   ----------NIRSILK.MVNLDCIQ...EVEV-......---------..----....--...
gi|58219004|ref|NP_001010889.1|   ----------NIRSILK.MVNLDCIQ...EVEV-......---------..----....--...
gi|153791443|ref|NP_001093320.1|  -----------------.--------...-----......---------..YPDS....IQ...
gi|310118528|ref|XP_003118894.1|  -----------------.--------...-----......---------..----....-Q...
gi|310118526|ref|XP_001130065.3|  ----------NIRSILK.MVNLDCIQ...EVEV-......---------..----....--...
gi|55742693|ref|NP_078922.1|      -----------------.--------...-----......---------..----....--...
gi|194306635|ref|NP_001093260.2|  -----------------.--------...-----......---------..----....--...
gi|66954681|ref|NP_001019832.1|   KLVNYLTPIKHLRKSLK.IIYLNSIQqleIRNMSwprl..IRKLRCYLK..EMKN....LR...
gi|59676593|ref|NP_001012277.1|   -----------------.--------...-----......---------..----....--...
gi|59676587|ref|NP_001012276.1|   -----------------.--------...-----......---------..----....--...
gi|12738831|ref|NP_075389.1|      KLVNYLTPIKYLRKSLK.II------...-----......---------..YLNS....IQ...
gi|194306638|ref|NP_001013714.3|  -----------------.--------...-----......---------..YPDS....IQ...
gi|8923179|ref|NP_060173.1|       -----------------.--------...-----......---------..----....--...
gi|124249372|ref|NP_001074299.1|  -----------------.--------...-----......---------..----....--...
gi|154800493|ref|NP_001094101.1|  -----------------.--------...-----......---------..--DS....IQ...
gi|29789255|ref|NP_085132.1|      -----------------.--------...-----......---------..----....--...
gi|194018550|ref|NP_938204.2|     -----------------.--------...-----......---------..----....--...
gi|157426875|ref|NP_079239.3|     -----------------.--------...-----......---------..----....IQ...
gi|33589814|ref|NP_006327.2|      -----------------.--------...-----......---------..---R....LT...
gi|12738834|ref|NP_075390.1|      KLVNYLTPIKYLRKSLK.IIYINSIGe..LEIHNtcwphlIRKLYCYLK..EMKT....LC...
gi|341915238|ref|XP_938952.6|     --------------LAK.EICIWGLQ...LSNPE......IARLALLLE..LKGHttcpFT...
gi|153792140|ref|NP_001093324.1|  -----------------.--------...LTPIK......HLRKSLKII..YLNS....IQ...
gi|16506299|ref|NP_443172.1|      -----------------.--------...-----......---------..----....--...
gi|194018546|ref|NP_001034450.2|  -----------------.--------...----C......LSYLFGWIH..YRRG....LV...
gi|226437632|ref|NP_001004339.2|  -----------------.--------...-----......---------..----....--...
gi|113865933|ref|NP_001038945.1|  -----------------.--------...-----......LSYLCRWIH..YRRG....LV...
gi|116268109|ref|NP_115582.3|     -----------------.--------...-----......---------..----....--...
gi|157426839|ref|NP_001093321.1|  -----------------.--------...-----......LSYLCRWIH..YRRG....LV...
gi|268832194|ref|NP_001161343.1|  -----------------.--------...-----......---------..----....--...
gi|268832172|ref|NP_060505.2|     -----------------.--------...-----......---------..----....--...
gi|268830752|ref|NP_001161339.1|  -----------------.--------...-----......---------..----....--...
gi|165932385|ref|NP_001107039.1|  -----------------.--------...-----......--CLKAVLA..GSPP....DN...
gi|134288867|ref|NP_997527.2|     -----------------.--------...-----......---------..----....--...
gi|23397500|ref|NP_694962.1|      -----------------.--------...-----......---------..----....--...
gi|148922963|ref|NP_036291.2|     -----------------.--------...-----......---------..----....--...
gi|16306584|ref|NP_036290.1|      -----------------.--------...-----......---------..----....--...
gi|45505155|ref|NP_110420.3|      -----------------.--------...-----......---------..----....--...
gi|45545409|ref|NP_995308.1|      -----------------.--------...-----......---------..----....--...
gi|22547146|ref|NP_060848.2|      -----------------.--------...-----......---------..----....--...
gi|51558774|ref|NP_001003803.1|   -----------------.--------...-----......---------..----....--...
gi|289803020|ref|NP_001073879.2|  -----------------.--------...-----......---------..----....--...
gi|158321897|ref|NP_703148.4|     -----------------.--------...-----......---------..----....--...
gi|28827813|ref|NP_789792.1|      -----------------.--------...-----......---------..----....--...


                                        60                                                 70       
                                         |                                                  |       
d1a4ya_                             ....ELNLR.......SN..EL................................GDVGVHCVLQ
gi|21955154|ref|NP_653288.1|      ....VLHLY.......GAtySA................................DGEDRARCSA
gi|33519450|ref|NP_789790.2|      ....TLRMC.......VE..NI................................FPDDSGCISD
gi|28827813|ref|NP_789792.1|      ....-----.......--..--................................----------
gi|119395764|ref|NP_001073289.1|  ....SLSLG.......FL..HNmpkeeeeeekegrhl.................D-----MVQC
gi|34878693|ref|NP_004886.3|      ....SLSLG.......FL..HNmpkeeeeeekegrhl.................D-----MVQC
gi|158321897|ref|NP_703148.4|     ....-----.......--..--................................----------
gi|194018482|ref|NP_604393.2|     ....KLCFSvq.....NV..FK................................KEDEHSSTSD
gi|110624785|ref|NP_789780.2|     ....KLRLS.......VSs.HI................................LE--------
gi|21361547|ref|NP_002930.2|      ....-----.......--..--................................----------
gi|42794608|ref|NP_976318.1|      ....-----.......--..--................................----------
gi|42822864|ref|NP_976322.1|      ....-----.......--..--................................----------
gi|42822866|ref|NP_976323.1|      ....-----.......--..--................................----------
gi|42822868|ref|NP_976321.1|      ....-----.......--..--................................----------
gi|42822870|ref|NP_976320.1|      ....-----.......--..--................................----------
gi|42822872|ref|NP_976317.1|      ....-----.......--..--................................----------
gi|42822874|ref|NP_976319.1|      ....-----.......--..--................................----------
gi|291463278|ref|NP_001167553.1|  ....KMSLQvik....E-..NLpenvtasesdaeversq...............D---DQHML-
gi|291463280|ref|NP_001167554.1|  ....KMSLQvik....E-..NLpenvtasesdaeversq...............D---DQHML-
gi|291463275|ref|NP_001167552.1|  ....KMSLQvik....E-..NLpenvtasesdaeversq...............D---DQHML-
gi|8923473|ref|NP_060322.1|       ....KMSLQvik....E-..NLpenvtasesdaeversq...............D---DQHML-
gi|194018484|ref|NP_659444.2|     ....TLKLS.......VQ..RI................................FQNKEPLIRP
gi|187937176|ref|NP_001120727.1|  ....KLSLQvakgvflEN..YM................................DFELDIEFER
gi|33667040|ref|NP_789781.2|      ....EVELTvt.....L-..--................................----------
gi|46049100|ref|NP_631915.2|      ....KLSLQvakgvflEN..YM................................DFELDIEFE-
gi|113205085|ref|NP_079003.2|     ....ELDIS.......WN..GF................................VGGTLLSITQ
gi|188536116|ref|NP_001120933.1|  ....SLSLG.......FLh.NM................................PKEEEEEEKE
gi|338797736|ref|NP_061994.1|     hrldCLDLK.......GE..KL................................DYKTCEALEE
gi|5174617|ref|NP_006083.1|       ....-----.......--..--................................----------
gi|188536002|ref|NP_001120934.1|  ....SLSLG.......FLh.NM................................PKEEEEEEKE
gi|116268109|ref|NP_115582.3|     ....-----.......--..--................................----------
gi|15193292|ref|NP_150639.1|      ....-----.......--..--................................----------
gi|118918429|ref|NP_849172.2|     ....-----.......--..--................................----------
gi|289666780|ref|NP_001166250.1|  ....-----.......--..--................................----------
gi|75709196|ref|NP_996611.2|      ....KLSLQvakgvflEN..YM................................DFELDIEFER
gi|168986655|ref|NP_919263.2|     ....-----.......--..--................................----------
gi|116268109|ref|NP_115582.3|     ....HLDFD.......GC..PL................................EPHCPEALVG
gi|11545912|ref|NP_071445.1|      ....-----.......--..--................................----------
gi|118918429|ref|NP_849172.2|     ....-----.......--..--................................----------
gi|289666778|ref|NP_699184.2|     ....-----.......--..--................................----------
gi|27734755|ref|NP_116264.2|      ....RIDLF.......DF..QR................................DIEG-RVVEN
gi|4506411|ref|NP_002874.1|       ....-----.......--..--................................----------
gi|284447308|ref|NP_036289.3|     ....RIDLF.......NF..QT................................DVEG-RVVEN
gi|289666782|ref|NP_001166251.1|  ....-----.......--..--................................----------
gi|74271814|ref|NP_001028225.1|   ....KLQLI.......EG..RQ................................HRSTWSPTMV
gi|7662386|ref|NP_055737.1|       ....KLQLI.......EG..RQ................................HRSTWSPTMV
gi|14719829|ref|NP_127497.1|      ....KLQLI.......EG..RQ................................HRSTWSPTMV
gi|296531375|ref|NP_001171835.1|  ....VLALD.......G-..--................................----------
gi|226342931|ref|NP_079101.3|     ....HLSLQ.......NN..QL................................QELPYNELSR
gi|308818204|ref|NP_001184224.1|  ....SLELT.......GN..SI................................ASIPDEAFNG
gi|4557543|ref|NP_001384.1|       ....SLELT.......GN..SI................................ASIPDEAFNG
gi|21389431|ref|NP_653221.1|      ....-----.......--..--................................----------
gi|14719835|ref|NP_127500.1|      ....KLQLI.......EG..RQ................................HRSTWSPTMV
gi|14719833|ref|NP_127499.1|      ....KLQLI.......EG..RQ................................HRSTWSPTMV
gi|34878690|ref|NP_899632.1|      ....SLSLG.......FLh.NM................................PKEEEEEEKE
gi|229577123|ref|NP_872345.2|     ....-----.......--..--................................----------
gi|6912466|ref|NP_036436.1|       ....-----.......--..--................................----------
gi|156415984|ref|NP_037485.2|     ....-----.......--..--................................-------ILK
gi|7657647|ref|NP_055363.1|       ....-----.......--..--................................----------
gi|7657649|ref|NP_055362.1|       ....-----.......--..--................................----------
gi|289666746|ref|NP_699181.2|     ....-----.......--..--................................----------
gi|197333692|ref|NP_001127948.1|  ....ELRVY.......HS..SL................................-----VVDHP
gi|21245134|ref|NP_056165.1|      ....ELRVY.......HS..SL................................-----VVDHP
gi|161333852|ref|NP_659469.3|     ....SLVFT.......GAp.HI................................SDCTFRALSA
gi|284447314|ref|NP_001165184.1|  ....-----.......--..--................................-----RVVEN
gi|260763922|ref|NP_001159588.1|  ....-----.......--..--................................----------
gi|4507553|ref|NP_003266.1|       ....-----.......--..--................................----------
gi|21361547|ref|NP_002930.2|      ....-----.......--..--................................----------
gi|42794608|ref|NP_976318.1|      ....-----.......--..--................................----------
gi|42822864|ref|NP_976322.1|      ....-----.......--..--................................----------
gi|42822866|ref|NP_976323.1|      ....-----.......--..--................................----------
gi|42822868|ref|NP_976321.1|      ....-----.......--..--................................----------
gi|42822870|ref|NP_976320.1|      ....-----.......--..--................................----------
gi|42822872|ref|NP_976317.1|      ....-----.......--..--................................----------
gi|42822874|ref|NP_976319.1|      ....-----.......--..--................................----------
gi|62912470|ref|NP_001017403.1|   ....-----.......--..--................................----------
gi|38348406|ref|NP_940967.1|      ....RLDLS.......GNa.LT................................EDMAALMLQN
gi|187608777|ref|NP_038460.4|     ....-----.......--..--................................----------
gi|16306595|ref|NP_005974.2|      ....-----.......--..--................................----------
gi|22748931|ref|NP_689654.1|      ....-----.......--..--................................----------
gi|150378503|ref|NP_997046.1|     ....-----.......--..--................................----------
gi|4504379|ref|NP_003658.1|       ....-----.......--..--................................----------
gi|255683361|ref|NP_001156787.2|  ....-----.......--..--................................----------
gi|61175232|ref|NP_001012992.1|   ....-----.......--..--................................----------
gi|54607116|ref|NP_938012.2|      ....-----.......--..--................................----------
gi|20302168|ref|NP_619542.1|      ....ELDLS.......DN..FI................................THITNESFQG
gi|21450705|ref|NP_659436.1|      ....-----.......--..--................................----------
gi|112380630|ref|NP_036266.2|     ....-----.......--..--................................----------
gi|291190783|ref|NP_001167448.1|  ....-----.......--..--................................----------
gi|291190781|ref|NP_060110.4|     ....-----.......--..--................................----------
gi|66392157|ref|NP_001013860.1|   ....-----.......--..--................................----------
gi|19924149|ref|NP_612564.1|      ....VLDLS.......RC..EI................................-----QTIED
gi|312433960|ref|NP_001186067.1|  ....ALDFI.......KL..DFyggamaswekaaedtggihmeeap........ETYIPSRAVS
gi|312433962|ref|NP_001186068.1|  ....ALDFI.......KL..DFyggamaswekaaedtggihmeeap........ETYIPSRAVS
gi|40788015|ref|NP_067032.3|      ....ALDFI.......KL..DFyggamaswekaaedtggihmeeap........ETYIPSRAVS
gi|16306588|ref|NP_036292.2|      ....WLNLS.......WTg.NR................................GFISVAGFSR
gi|14249170|ref|NP_116026.1|      ....-----.......--..--................................----------
gi|156938257|ref|NP_612369.3|     ....-----.......--..--................................----------
gi|161333854|ref|NP_001104508.1|  ....-----.......--..--................................----------
gi|19718734|ref|NP_003255.2|      ....SLDLS.......NN..RI................................TYISNSDLQR
gi|149274651|ref|NP_115547.1|     ....-----.......--..--................................----------
gi|149274621|ref|NP_001092272.1|  ....-----.......--..--................................----------
gi|291190781|ref|NP_060110.4|     ....KLSSK.......DL..KL................................STDVCEQILR
gi|291190783|ref|NP_001167448.1|  ....KLSSK.......DL..KL................................STDVCEQILR
gi|163965441|ref|NP_653303.2|     ....-----.......--..--................................----------
gi|161333852|ref|NP_659469.3|     ....-----.......KN..VI................................PD---KYIVS
gi|190194416|ref|NP_077302.3|     ....-----.......--..--................................----------
gi|21264320|ref|NP_612202.1|      ....ALRLI.......SC..RLvaaqekkkkslgkrlqaslgggsssqgttkqlPASLLHPLFQ
gi|25777608|ref|NP_078894.2|      ....-----.......--..--................................----------
gi|218931148|ref|NP_001136357.1|  ....-----.......--..--................................----------
gi|156938257|ref|NP_612369.3|     ....KLYCK.......DL..RL................................GSEVLEQVLH
gi|156938336|ref|NP_000237.2|     ....-----.......--..--................................----------
gi|54112380|ref|NP_001005366.1|   ....PLMLS.......GI..IR................................----------
gi|54112382|ref|NP_115979.3|      ....PLMLS.......GI..IR................................----------
gi|157168349|ref|NP_001093254.2|  ....-----.......--..--................................----------
gi|118442828|ref|NP_001072983.1|  ....-----.......--..--................................----------
gi|4507375|ref|NP_003184.1|       ....-----.......--..--................................----------
gi|116268109|ref|NP_115582.3|     ....-----.......--..--................................----------
gi|25777610|ref|NP_733840.1|      ....-----.......--..--................................----------
gi|164663798|ref|NP_001106873.1|  ....-----.......--..--................................----------
gi|66392157|ref|NP_001013860.1|   ....CLSCV.......DM..KL................................SLEVSEQILH
gi|161333854|ref|NP_001104508.1|  ....DFSSV.......KN..VI................................PD---KYIVS
gi|16306580|ref|NP_036440.1|      ....-----.......--..--................................----------
gi|341916269|ref|XP_003403438.1|  ....-----.......KC..SI................................SKLELSAAEQ
gi|119393876|ref|NP_075043.1|     ....-----.......-C..SI................................SKLELSAAEQ
gi|341916267|ref|XP_003403437.1|  ....-----.......-C..SI................................SKLELSAAEQ
gi|119393878|ref|NP_004527.2|     ....-----.......-C..SI................................SKLELSAAEQ
gi|341916263|ref|XP_003403435.1|  ....-----.......-C..SI................................SKLELSAAEQ
gi|40255157|ref|NP_700356.2|      ....-----.......--..--................................----------
gi|16306576|ref|NP_036294.1|      ....-----.......--..--................................--------LK
gi|302129689|ref|NP_001180464.1|  ....-----.......--..--................................----------
gi|302129687|ref|NP_001180463.1|  ....-----.......--..--................................----------
gi|16306572|ref|NP_036293.1|      ....-----.......--..--................................----------
gi|341915644|ref|XP_003403561.1|  ....-----.......--..--................................----------
gi|341913879|ref|XP_003403707.1|  ....-----.......--..--................................----------
gi|61742136|ref|NP_078831.3|      ....-----.......--..--................................------WKSQ
gi|38569471|ref|NP_006360.3|      ....-----.......--..--................................----------
gi|16306591|ref|NP_036295.1|      ....-----.......--..--................................----------
gi|51873034|ref|NP_001004055.1|   ....-----.......--..--................................----------
gi|341916265|ref|XP_003403436.1|  ....RIELH.......LN..HS................................RG-FIESIRP
gi|7661860|ref|NP_055480.1|       ....RVDLR.......FN..NL................................GLRGLSVIIP
gi|122937351|ref|NP_001073947.1|  ....KLEVV.......HNv.RL................................HAGHVQQLLA
gi|46249367|ref|NP_996836.1|      ....DLEVT.......CTw.K-................................-LPTLAKFSP
gi|46249369|ref|NP_996837.1|      ....DLEVT.......CTw.K-................................-LPTLAKFSP
gi|46249371|ref|NP_996838.1|      ....DLEVT.......CTw.K-................................-LPTLAKFSP
gi|46249373|ref|NP_996839.1|      ....DLEVT.......CTw.K-................................-LPTLAKFSP
gi|5174641|ref|NP_006106.1|       ....DLEVT.......CTw.K-................................-LPTLAKFSP
gi|88942379|ref|XP_933494.1|      ....MVNLDciqevevNC..KW................................VLPILTQFTP
gi|148356236|ref|NP_001091846.1|  ....MVNLDciqevevNC..KW................................VLPILTQFTP
gi|61102721|ref|NP_001010890.1|   ....MVNLDciqevevNC..KW................................VLPILTQFTP
gi|153792112|ref|NP_001093322.1|  ....TVNLDciqevevNC..NW................................TLPVLAEFTP
gi|153945800|ref|NP_001093584.1|  ....TVNLDciqevevNC..NW................................TLPVLAEFTP
gi|61696142|ref|NP_001013425.1|   ....-----.......NC..KW................................VLPILTQFTP
gi|226437621|ref|NP_001139816.1|  ....-----.......--..--................................--PILTQFTP
gi|59958373|ref|NP_001009611.1|   ....-----.......NC..KW................................VLPILTQFTP
gi|58219004|ref|NP_001010889.1|   ....-----.......NC..KW................................VLPILTQFTP
gi|153791443|ref|NP_001093320.1|  ....VLEIW.......NM..CW................................P-CMVAEVSR
gi|310118528|ref|XP_003118894.1|  ....VLEIW.......NM..CW................................-PCMIVEFSP
gi|310118526|ref|XP_001130065.3|  ....-----.......NC..KW................................VLPILTQFTP
gi|55742693|ref|NP_078922.1|      ....-----.......--..--................................----------
gi|194306635|ref|NP_001093260.2|  ....-----.......--..--................................----VAEVSR
gi|66954681|ref|NP_001019832.1|   ....KLVFS.......RC..HH................................----------
gi|59676593|ref|NP_001012277.1|   ....----Iqevev..CC..PW................................ELSTLVKFAP
gi|59676587|ref|NP_001012276.1|   ....----Iqevev..CC..PW................................ELSTLVKFAP
gi|12738831|ref|NP_075389.1|      ....ELEIR.......NM..SW................................PRLI-RKLRC
gi|194306638|ref|NP_001013714.3|  ....VLEIW.......NM..CW................................PCMIVEFIRY
gi|8923179|ref|NP_060173.1|       ....-----.......--..--................................-------LLR
gi|124249372|ref|NP_001074299.1|  ....----Iqevev..CC..PW................................ELSILIRFAP
gi|154800493|ref|NP_001094101.1|  ....VLEIW.......NM..CW................................-PCMIVEFSR
gi|29789255|ref|NP_085132.1|      ....-----.......--..--................................----------
gi|194018550|ref|NP_938204.2|     ....-----.......--..--................................----------
gi|157426875|ref|NP_079239.3|     ....QLSMA.......GCy.WL................................PGSTVEHVAR
gi|33589814|ref|NP_006327.2|      ....RIHLR.......ED..LV................................QDQDLEAIRK
gi|12738834|ref|NP_075390.1|      ....KLVFS.......RC..HH................................YT--------
gi|341915238|ref|XP_938952.6|     ....TLEII.......DC..KM................................DLWSLERLGK
gi|153792140|ref|NP_001093324.1|  ....QLEIR.......NM..SW................................-----PR---
gi|16506299|ref|NP_443172.1|      ....-----.......--..--................................----------
gi|194018546|ref|NP_001034450.2|  ....HLCCS.......KV..QN................................YSMPTSSFRN
gi|226437632|ref|NP_001004339.2|  ....-----.......--..--................................----------
gi|113865933|ref|NP_001038945.1|  ....HLCCN.......KV..QN................................YSMPTSSFRN
gi|116268109|ref|NP_115582.3|     ....-----.......--..--................................----------
gi|157426839|ref|NP_001093321.1|  ....HLCCN.......KV..QN................................YSMPTSSFRN
gi|268832194|ref|NP_001161343.1|  ....-----.......--..--................................----------
gi|268832172|ref|NP_060505.2|     ....-----.......--..--................................----------
gi|268830752|ref|NP_001161339.1|  ....-----.......--..--................................----------
gi|165932385|ref|NP_001107039.1|  ....TVDLS.......GI..PL................................TSRDLERVTS
gi|134288867|ref|NP_997527.2|     ....-----.......--..--................................----------
gi|23397500|ref|NP_694962.1|      ....-----.......--..--................................----------
gi|148922963|ref|NP_036291.2|     ....-----.......--..--................................----------
gi|16306584|ref|NP_036290.1|      ....-----.......--..--................................----------
gi|45505155|ref|NP_110420.3|      ....-----.......--..--................................----------
gi|45545409|ref|NP_995308.1|      ....-----.......--..--................................----------
gi|22547146|ref|NP_060848.2|      ....-----.......--..--................................----------
gi|51558774|ref|NP_001003803.1|   ....-----.......--..--................................----------
gi|289803020|ref|NP_001073879.2|  ....-----.......--..--................................----------
gi|158321897|ref|NP_703148.4|     ....-----.......--..--................................----------
gi|28827813|ref|NP_789792.1|      ....-----.......--..--................................----------


                                     80           90                                                
                                      |            |                                                
d1a4ya_                             GLQTPSC.KIQ..KLSLQ.NC..........C...L........T............G......
gi|21955154|ref|NP_653288.1|      G-----A.HTL..LVQLP.ER..........Tv..L........L............D......
gi|33519450|ref|NP_789790.2|      YNEKL--.---..-----.--..........-...-........-............-......
gi|28827813|ref|NP_789792.1|      -------.---..-----.--..........-...-........-............-......
gi|119395764|ref|NP_001073289.1|  VLPSSSH.AAC..SHGLV.NS..........H...L........T............S......
gi|34878693|ref|NP_004886.3|      VLPSSSH.AAC..SHGLV.NS..........H...L........T............S......
gi|158321897|ref|NP_703148.4|     -------.---..-----.--..........-...-........-............-......
gi|194018482|ref|NP_604393.2|     YSLIC--.---..-----.--..........-...-........-............-......
gi|110624785|ref|NP_789780.2|     ------R.DLE..ILETS.KF..........D...S........R............M......
gi|21361547|ref|NP_002930.2|      -------.---..-----.--..........-...-........-............-......
gi|42794608|ref|NP_976318.1|      -------.---..-----.--..........-...-........-............-......
gi|42822864|ref|NP_976322.1|      -------.---..-----.--..........-...-........-............-......
gi|42822866|ref|NP_976323.1|      -------.---..-----.--..........-...-........-............-......
gi|42822868|ref|NP_976321.1|      -------.---..-----.--..........-...-........-............-......
gi|42822870|ref|NP_976320.1|      -------.---..-----.--..........-...-........-............-......
gi|42822872|ref|NP_976317.1|      -------.---..-----.--..........-...-........-............-......
gi|42822874|ref|NP_976319.1|      -------.---..-----.--..........-...-........-............-......
gi|291463278|ref|NP_001167553.1|  -------.---..-----.--..........-...-........-............-......
gi|291463280|ref|NP_001167554.1|  -------.---..-----.--..........-...-........-............-......
gi|291463275|ref|NP_001167552.1|  -------.---..-----.--..........-...-........-............-......
gi|8923473|ref|NP_060322.1|       -------.---..-----.--..........-...-........-............-......
gi|194018484|ref|NP_659444.2|     TASQM-K.SL-..-----.--..........-...-........-............-......
gi|187937176|ref|NP_001120727.1|  CTYLTIP.NWA..RQDLR.SL..........R...L........W............T......
gi|33667040|ref|NP_789781.2|      -------.---..--NFM.NV..........Wk..L........S............Ssshpgs
gi|46049100|ref|NP_631915.2|      -------.---..-----.--..........-...-........-............-......
gi|113205085|ref|NP_079003.2|     QMHLV-S.KLK..ILRLG.SC..........R...L........T............T......
gi|188536116|ref|NP_001120933.1|  G------.---..-----.--..........-...-........-............-......
gi|338797736|ref|NP_061994.1|     VFKR--L.QFK..VVDLE.QT..........N...L........D............E......
gi|5174617|ref|NP_006083.1|       -------.---..-----.--..........-...-........-............-......
gi|188536002|ref|NP_001120934.1|  G------.---..-----.--..........-...-........-............-......
gi|116268109|ref|NP_115582.3|     -------.---..-----.--..........-...-........-............-......
gi|15193292|ref|NP_150639.1|      -------.---..-----.--..........-...-........-............-......
gi|118918429|ref|NP_849172.2|     -------.---..-----.--..........-...-........-............-......
gi|289666780|ref|NP_001166250.1|  -------.---..-----.--..........-...-........-............-......
gi|75709196|ref|NP_996611.2|      CTYLTIP.NWA..RQDLR.SL..........R...L........W............T......
gi|168986655|ref|NP_919263.2|     -------.---..-----.--..........-...-........-............-......
gi|116268109|ref|NP_115582.3|     C-----G.QIE..NLSFK.SR..........K...C........G............D......
gi|11545912|ref|NP_071445.1|      -------.---..-----.--..........-...-........-............-......
gi|118918429|ref|NP_849172.2|     -------.---..-----.--..........-...-........-............-......
gi|289666778|ref|NP_699184.2|     -------.---..-----.--..........-...-........-............-......
gi|27734755|ref|NP_116264.2|      ISKRCGG.FLR..KLSLR.GC..........Lg..V........G............D......
gi|4506411|ref|NP_002874.1|       -------.---..-LSFK.GK..........S...Lkln.....T............A......
gi|284447308|ref|NP_036289.3|     ISKRCGG.FLR..KLSLR.GC..........Ig..V........G............D......
gi|289666782|ref|NP_001166251.1|  -------.---..-----.--..........-...-........-............-......
gi|74271814|ref|NP_001028225.1|   V------.---..--LFR.WV..........P...V........T............D......
gi|7662386|ref|NP_055737.1|       V------.---..--LFR.WV..........P...V........T............D......
gi|14719829|ref|NP_127497.1|      V------.---..--LFR.WV..........P...V........T............D......
gi|296531375|ref|NP_001171835.1|  ------S.NWQ..RIDLF.DF..........Qrd.I........E............G......
gi|226342931|ref|NP_079101.3|     L-----S.GLR..TLNLH.NN..........L...I........S............S......
gi|308818204|ref|NP_001184224.1|  L-----P.NLE..RLDLS.KN..........N...I........T............S......
gi|4557543|ref|NP_001384.1|       L-----P.NLE..RLDLS.KN..........N...I........T............S......
gi|21389431|ref|NP_653221.1|      -------.---..-----.--..........-...-........-............-......
gi|14719835|ref|NP_127500.1|      V------.---..--LFR.WV..........P...V........T............D......
gi|14719833|ref|NP_127499.1|      V------.---..--LFR.WV..........P...V........T............D......
gi|34878690|ref|NP_899632.1|      G------.---..-----.--..........-...-........-............-......
gi|229577123|ref|NP_872345.2|     -------.---..-----.--..........-...-........-............-......
gi|6912466|ref|NP_036436.1|       -------.---..-----.--..........-...-........-............-......
gi|156415984|ref|NP_037485.2|     RVRSNDK.ELE..EVNLN.NI..........Qd..I........P............I......
gi|7657647|ref|NP_055363.1|       -------.---..-----.--..........-...-........-............-......
gi|7657649|ref|NP_055362.1|       -------.---..-----.--..........-...-........-............-......
gi|289666746|ref|NP_699181.2|     ----M-Q.GVV..RLELS.GC..........Nd..F........T............E......
gi|197333692|ref|NP_001127948.1|  ALAFLEE.NLK..ILRLK.FT..........E...M........G............K......
gi|21245134|ref|NP_056165.1|      ALAFLEE.NLK..ILRLK.FT..........E...M........G............K......
gi|161333852|ref|NP_659469.3|     ------C.KLR..KIRFE.GN..........Kr..V........T............D......
gi|284447314|ref|NP_001165184.1|  ISKRCGG.FLR..KLSLR.GC..........Ig..V........G............D......
gi|260763922|ref|NP_001159588.1|  -------.---..-----.--..........-...-........-............-......
gi|4507553|ref|NP_003266.1|       -------.---..-----.--..........-...-........-............-......
gi|21361547|ref|NP_002930.2|      -------.---..-----.--..........-...-........-............-......
gi|42794608|ref|NP_976318.1|      -------.---..-----.--..........-...-........-............-......
gi|42822864|ref|NP_976322.1|      -------.---..-----.--..........-...-........-............-......
gi|42822866|ref|NP_976323.1|      -------.---..-----.--..........-...-........-............-......
gi|42822868|ref|NP_976321.1|      -------.---..-----.--..........-...-........-............-......
gi|42822870|ref|NP_976320.1|      -------.---..-----.--..........-...-........-............-......
gi|42822872|ref|NP_976317.1|      -------.---..-----.--..........-...-........-............-......
gi|42822874|ref|NP_976319.1|      -------.---..-----.--..........-...-........-............-......
gi|62912470|ref|NP_001017403.1|   -------.---..-----.--..........-...-........-............-......
gi|38348406|ref|NP_940967.1|      L-----S.SLR..SVSLA.GN..........TimrL........D............D......
gi|187608777|ref|NP_038460.4|     -------.---..-LSFS.AC..........Sla.L........D............Q......
gi|16306595|ref|NP_005974.2|      -------.---..-----.--..........-...-........-............-......
gi|22748931|ref|NP_689654.1|      VIQGM-A.NIE..SLNLS.GC..........Yn..L........T............D......
gi|150378503|ref|NP_997046.1|     -------.---..-----.--..........-...-........-............-......
gi|4504379|ref|NP_003658.1|       -------.---..-----.--..........-...-........-............-......
gi|255683361|ref|NP_001156787.2|  -------.---..-----.--..........Q...L........S............D......
gi|61175232|ref|NP_001012992.1|   -------.---..-----.--..........-...-........-............-......
gi|54607116|ref|NP_938012.2|      -------.---..-----.--..........-...-........-............-......
gi|20302168|ref|NP_619542.1|      L-----Q.NLT..KINLN.HNpnvqhqngnpG...I........Q............S......
gi|21450705|ref|NP_659436.1|      -------.---..-----.--..........-...-........-............-......
gi|112380630|ref|NP_036266.2|     -------.---..-----.--..........-...-........-............-......
gi|291190783|ref|NP_001167448.1|  -------.---..-----.--..........-...-........-............-......
gi|291190781|ref|NP_060110.4|     -------.---..-----.--..........-...-........-............-......
gi|66392157|ref|NP_001013860.1|   -------.---..-----.--..........-...-........-............-......
gi|19924149|ref|NP_612564.1|      GAYQSLS.HLS..TLILT.GN..........P...I........Q............S......
gi|312433960|ref|NP_001186067.1|  LFFNWKQ.EFRtlEVTLR.DF..........Sk..L........N............K......
gi|312433962|ref|NP_001186068.1|  LFFNWKQ.EFRtlEVTLR.DF..........Sk..L........N............K......
gi|40788015|ref|NP_067032.3|      LFFNWKQ.EFRtlEVTLR.DF..........Sk..L........N............K......
gi|16306588|ref|NP_036292.2|      FLKVCGS.ELV..RLELS.CS..........Hf..L........N............E......
gi|14249170|ref|NP_116026.1|      -------.---..-----.--..........-...-........-............-......
gi|156938257|ref|NP_612369.3|     -------.---..-----.--..........-...-........-............-......
gi|161333854|ref|NP_001104508.1|  -------.---..-----.--..........-...-........-............-......
gi|19718734|ref|NP_003255.2|      C-----V.NLQ..ALVLT.SN..........G...I........N............T......
gi|149274651|ref|NP_115547.1|     -------.---..-----.--..........-...-........-............-......
gi|149274621|ref|NP_001092272.1|  -------.---..-----.--..........-...-........-............-......
gi|291190781|ref|NP_060110.4|     VVSRS-N.RLE..ELVLE.NA..........G...L........R............T......
gi|291190783|ref|NP_001167448.1|  VVSRS-N.RLE..ELVLE.NA..........G...L........R............T......
gi|163965441|ref|NP_653303.2|     -------.---..-----.--..........-...-........-............-......
gi|161333852|ref|NP_659469.3|     TLQRWRL.NVL..RLNFR.GC..........L...L........R............P......
gi|190194416|ref|NP_077302.3|     -------.---..-----.--..........-...-........-............-......
gi|21264320|ref|NP_612202.1|      AMTDPLC.HLS..SLTLS.HC..........K...L........P............D......
gi|25777608|ref|NP_078894.2|      -------.---..-----.--..........-...-........-............-......
gi|218931148|ref|NP_001136357.1|  -------.---..-----.--..........-...-........-............-......
gi|156938257|ref|NP_612369.3|     TLSKS-G.SLE..ELVLD.NA..........G...L........K............T......
gi|156938336|ref|NP_000237.2|     -------.---..-----.--..........-...-........-............-......
gi|54112380|ref|NP_001005366.1|   ------R.QPV..SLDLS.WT..........N...I........S............K......
gi|54112382|ref|NP_115979.3|      ------R.QPV..SLDLS.WT..........N...I........S............K......
gi|157168349|ref|NP_001093254.2|  ------R.QPR..ALDLS.WT..........G...V........S............K......
gi|118442828|ref|NP_001072983.1|  -------.---..-----.--..........-...-........-............-......
gi|4507375|ref|NP_003184.1|       -------.---..-----.--..........-...-........-............-......
gi|116268109|ref|NP_115582.3|     -------.---..-----.--..........-...-........-............-......
gi|25777610|ref|NP_733840.1|      -------.---..-----.--..........-...-........-............-......
gi|164663798|ref|NP_001106873.1|  -------.---..-----.--..........-...-........-............-......
gi|66392157|ref|NP_001013860.1|   MMSQS-S.HLE..ELVLE.TC..........S...L........R............G......
gi|161333854|ref|NP_001104508.1|  TLQRWRL.NVL..RLNFR.GC..........L...L........R............P......
gi|16306580|ref|NP_036440.1|      -------.-WT..KIDLS.RC..........Ka..I........V............P......
gi|341916269|ref|XP_003403438.1|  ELLLTLP.SLE..SLEVS.GT..........I...Q........S............Q......
gi|119393876|ref|NP_075043.1|     ELLLTLP.SLE..SLEVS.GT..........I...Q........S............Q......
gi|341916267|ref|XP_003403437.1|  ELLLTLP.SLE..SLEVS.GT..........I...Q........S............Q......
gi|119393878|ref|NP_004527.2|     ELLLTLP.SLE..SLEVS.GT..........I...Q........S............Q......
gi|341916263|ref|XP_003403435.1|  ELLLTLP.SLE..SLEVS.GT..........I...Q........S............Q......
gi|40255157|ref|NP_700356.2|      -------.---..-----.--..........-...-........-............-......
gi|16306576|ref|NP_036294.1|      LVGECCP.RLT..FLKLS.GC..........Hg..V........T............A......
gi|302129689|ref|NP_001180464.1|  -------.---..-----.--..........-...-........-............-......
gi|302129687|ref|NP_001180463.1|  -------.---..-----.--..........-...-........-............-......
gi|16306572|ref|NP_036293.1|      -------.---..-----.--..........-...-........-............-......
gi|341915644|ref|XP_003403561.1|  -------.---..-----.--..........-...-........-............-......
gi|341913879|ref|XP_003403707.1|  -------.---..-----.--..........-...-........-............-......
gi|61742136|ref|NP_078831.3|      LVGECCP.RLT..FLKLS.GC..........Hg..V........T............A......
gi|38569471|ref|NP_006360.3|      ------R.SIS..TLELF.TV..........P...L........S............T......
gi|16306591|ref|NP_036295.1|      -------.---..-----.--..........-...-........-............-......
gi|51873034|ref|NP_001004055.1|   -------.---..-----.--..........-...-........-............-......
gi|341916265|ref|XP_003403436.1|  ALELSKA.SVT..KCSIS.KL..........E...L........S............A......
gi|7661860|ref|NP_055480.1|       HVARF-Q.HLA..SLRLH.YV..........H...GdsrqpsvdG............E......
gi|122937351|ref|NP_001073947.1|  QVGF--P.RLA..SLTLP.TK..........A...F........DapptyastpdgeD......
gi|46249367|ref|NP_996836.1|      YLGQM-I.NLR..RLLLS.HI..........H...A........Ssyispeke....E......
gi|46249369|ref|NP_996837.1|      YLGQM-I.NLR..RLLLS.HI..........H...A........Ssyispeke....E......
gi|46249371|ref|NP_996838.1|      YLGQM-I.NLR..RLLLS.HI..........H...A........Ssyispeke....E......
gi|46249373|ref|NP_996839.1|      YLGQM-I.NLR..RLLLS.HI..........H...A........Ssyispeke....E......
gi|5174641|ref|NP_006106.1|       YLGQM-I.NLR..RLLLS.HI..........H...A........Ssyispeke....E......
gi|88942379|ref|XP_933494.1|      YLGHM-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|148356236|ref|NP_001091846.1|  YLGHM-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|61102721|ref|NP_001010890.1|   YLGHM-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|153792112|ref|NP_001093322.1|  YLGQM-R.NLR..KLVLS.DI..........DsryIspeq....K............K......
gi|153945800|ref|NP_001093584.1|  YLGQM-R.NLR..KLVLS.DI..........DsryIspeq....K............K......
gi|61696142|ref|NP_001013425.1|   YLGHM-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|226437621|ref|NP_001139816.1|  YLGHL-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|59958373|ref|NP_001009611.1|   YLGHM-R.NLQ..KLILS.HM..........D...V........Sryvspeqk....K......
gi|58219004|ref|NP_001010889.1|   YLGHM-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|153791443|ref|NP_001093320.1|  YLSQM-K.NLR..KLFISdGC..........Gy..Lpsfes...Q............G......
gi|310118528|ref|XP_003118894.1|  YLSQM-R.NLR..KLFISdGC..........Ry..Llispeq..K............K......
gi|310118526|ref|XP_001130065.3|  YLGHM-R.NLQ..KLVLS.HM..........D...V........Sryvspeqk....K......
gi|55742693|ref|NP_078922.1|      -------.---..-----.--..........-...-........-............-......
gi|194306635|ref|NP_001093260.2|  YLSQM-K.NLR..KLFISdGC..........Gy..Lpsfes...Q............G......
gi|66954681|ref|NP_001019832.1|   -------.---..--SMS.DN..........E...L........E............G......
gi|59676593|ref|NP_001012277.1|   YLGQM-R.NLR..KLVLF.NI..........R...A........Sacippdnk....G......
gi|59676587|ref|NP_001012276.1|   YLGQM-R.NLR..KLVLF.NI..........R...A........Sacippdnk....G......
gi|12738831|ref|NP_075389.1|      YLKEM-K.NLR..KLVFS.RChhytsdn...E...L........Q............G......
gi|194306638|ref|NP_001013714.3|  L-SQM-R.NLR..KLFISdGC..........Ryl.Lssds....Q............E......
gi|8923179|ref|NP_060173.1|       R------.---..-----.--..........-...-........-............-......
gi|124249372|ref|NP_001074299.1|  YLGQM-R.NLR..KLVLF.NI..........H...V........Sacipldrk....E......
gi|154800493|ref|NP_001094101.1|  YLSQM-R.NLR..KLFISdGC..........Ryl.Lssds....Q............E......
gi|29789255|ref|NP_085132.1|      -------.---..-----.--..........-...-........-............-......
gi|194018550|ref|NP_938204.2|     -------.---..-----.--..........-...-........-............-......
gi|157426875|ref|NP_079239.3|     C-----R.SLV..KVNLS.GC..........H...L........T............S......
gi|33589814|ref|NP_006327.2|      ------Q.DLV..ELYLT.N-..........-...-........-............-......
gi|12738834|ref|NP_075390.1|      -------.---..----S.DN..........E...L........E............G......
gi|341915238|ref|XP_938952.6|     ALRF--S.SLH..SLVLD.YC..........K...F........G............N......
gi|153792140|ref|NP_001093324.1|  -------.---..-----.--..........-...-........-............-......
gi|16506299|ref|NP_443172.1|      -------.---..-----.--..........-...-........-............-......
gi|194018546|ref|NP_001034450.2|  LLERIYPdSIQ..ELEVWkKC..........S...L........N............K......
gi|226437632|ref|NP_001004339.2|  -------.---..-----.--..........-...-........-............-......
gi|113865933|ref|NP_001038945.1|  LLKRVYPdSIQ..ELEIKrKC..........S...L........N............K......
gi|116268109|ref|NP_115582.3|     -------.---..-----.--..........-...-........-............-......
gi|157426839|ref|NP_001093321.1|  LLKRVYPdSIQ..ELEIKrKC..........S...L........N............K......
gi|268832194|ref|NP_001161343.1|  -------.---..-----.--..........-...-........-............-......
gi|268832172|ref|NP_060505.2|     -------.---..-----.--..........-...-........-............-......
gi|268830752|ref|NP_001161339.1|  -------.---..-----.--..........-...-........-............-......
gi|165932385|ref|NP_001107039.1|  YLQRCGE.QVD..SVELG.FT..........G...L........T............D......
gi|134288867|ref|NP_997527.2|     -------.---..-----.--..........-...-........-............-......
gi|23397500|ref|NP_694962.1|      -------.---..-----.--..........-...-........-............-......
gi|148922963|ref|NP_036291.2|     -------.---..-----.--..........-...-........-............-......
gi|16306584|ref|NP_036290.1|      -------.---..-----.--..........-...-........-............-......
gi|45505155|ref|NP_110420.3|      -------.---..-----.--..........-...-........-............-......
gi|45545409|ref|NP_995308.1|      -------.---..-----.--..........-...-........-............-......
gi|22547146|ref|NP_060848.2|      -------.---..-----.--..........-...-........-............-......
gi|51558774|ref|NP_001003803.1|   -------.---..-----.--..........-...-........-............-......
gi|289803020|ref|NP_001073879.2|  -------.NLL..ILRIS.HC..........Pni.L........T............D......
gi|158321897|ref|NP_703148.4|     -------.---..-----.--..........-...-........-............-......
gi|28827813|ref|NP_789792.1|      -------.---..-----.--..........-...-........-............-......


                                            100       110                                           
                                              |         |                                           
d1a4ya_                             .........AGCGVLSSTLRTLP..T..LQEL..HL............................
gi|21955154|ref|NP_653288.1|      .........AYSEHLAAALCTNP..N..LIEL..SL............................
gi|33519450|ref|NP_789790.2|      .........VYWRELCSMFITNK..N..FQIL..DM............................
gi|28827813|ref|NP_789792.1|      .........--CQDISTSLIHNK..N..LMHL..DL............................
gi|119395764|ref|NP_001073289.1|  .........SFCRGLFSVLSTSQ..S..LTEL..DL............................
gi|34878693|ref|NP_004886.3|      .........SFCRGLFSVLSTSQ..S..LTEL..DL............................
gi|158321897|ref|NP_703148.4|     .........---QHLWRIVMANR..N..LRSL..NL............................
gi|194018482|ref|NP_604393.2|     .........--WHHICSVLTTSG..H..LREL..QV............................
gi|110624785|ref|NP_789780.2|     .........HAWNSICSTLVTNE..N..LHEL..DL............................
gi|21361547|ref|NP_002930.2|      .........--------------..-..----..--............................
gi|42794608|ref|NP_976318.1|      .........--------------..-..----..--............................
gi|42822864|ref|NP_976322.1|      .........--------------..-..----..--............................
gi|42822866|ref|NP_976323.1|      .........--------------..-..----..--............................
gi|42822868|ref|NP_976321.1|      .........--------------..-..----..--............................
gi|42822870|ref|NP_976320.1|      .........--------------..-..----..--............................
gi|42822872|ref|NP_976317.1|      .........--------------..-..----..--............................
gi|42822874|ref|NP_976319.1|      .........--------------..-..----..--............................
gi|291463278|ref|NP_001167553.1|  .........PFWTDLCSIFGSNK..D..LMGL..AI............................
gi|291463280|ref|NP_001167554.1|  .........PFWTDLCSIFGSNK..D..LMGL..AI............................
gi|291463275|ref|NP_001167552.1|  .........PFWTDLCSIFGSNK..D..LMGL..AI............................
gi|8923473|ref|NP_060322.1|       .........PFWTDLCSIFGSNK..D..LMGL..AI............................
gi|194018484|ref|NP_659444.2|     .........VYWREICSLFYTME..S..LREL..HI............................
gi|187937176|ref|NP_001120727.1|  .........----DFCSLFSSNS..N..LKFL..EV............................
gi|33667040|ref|NP_789781.2|      eapesnglhRWWQDLCSVFATND..K..LEVL..TM............................
gi|46049100|ref|NP_631915.2|      .........----------SSNS..N..LKFL..EV............................
gi|113205085|ref|NP_079003.2|     .........DDVQALGEAFEMIP..E..LEEL..NL............................
gi|188536116|ref|NP_001120933.1|  .........--------------..-..-RHL..DM............................
gi|338797736|ref|NP_061994.1|     .........DGASALFDMIEYYE..S..ATHL..NI............................
gi|5174617|ref|NP_006083.1|       .........--------------..-..----..--............................
gi|188536002|ref|NP_001120934.1|  .........--------------..-..-RHL..DM............................
gi|116268109|ref|NP_115582.3|     .........--------------..-..LKRL..DL............................
gi|15193292|ref|NP_150639.1|      .........--------------..-..----..--............................
gi|118918429|ref|NP_849172.2|     .........--------------..-..----..--............................
gi|289666780|ref|NP_001166250.1|  .........--------------..-..----..--............................
gi|75709196|ref|NP_996611.2|      .........----DFCSLFSSNS..N..LKFL..EV............................
gi|168986655|ref|NP_919263.2|     .........--------------..-..----..--............................
gi|116268109|ref|NP_115582.3|     .........AFAEALSRSLPTMG..R..LQML..GL............................
gi|11545912|ref|NP_071445.1|      .........--------------..-..----..--............................
gi|118918429|ref|NP_849172.2|     .........--------------..-..----..--............................
gi|289666778|ref|NP_699184.2|     .........--------------..-..----..--............................
gi|27734755|ref|NP_116264.2|      .........NALRTFA---QNCR..N..IEVL..NL............................
gi|4506411|ref|NP_002874.1|       .........EDAKDVIKEIEDFD..S..LEAL..RL............................
gi|284447308|ref|NP_036289.3|     .........SSLKTFA---QNCR..N..IEHL..NL............................
gi|289666782|ref|NP_001166251.1|  .........--------------..-..----..--............................
gi|74271814|ref|NP_001028225.1|   .........AYWQILFSVLKVTR..N..LKEL..DL............................
gi|7662386|ref|NP_055737.1|       .........AYWQILFSVLKVTR..N..LKEL..DL............................
gi|14719829|ref|NP_127497.1|      .........AYWQILFSVLKVTR..N..LKEL..DL............................
gi|296531375|ref|NP_001171835.1|  .........RVVENIS---KRCGg.F..LRKL..SL............................
gi|226342931|ref|NP_079101.3|     .........EGLP--DEAFESLT..Q..LQHL..CV............................
gi|308818204|ref|NP_001184224.1|  .........SGIG--PKAFKLLK..K..LMRL..NM............................
gi|4557543|ref|NP_001384.1|       .........SGIG--PKAFKLLK..K..LMRL..NM............................
gi|21389431|ref|NP_653221.1|      .........--------------..-..----..--............................
gi|14719835|ref|NP_127500.1|      .........AYWQILFSVLKVTR..N..LKEL..DL............................
gi|14719833|ref|NP_127499.1|      .........AYWQILFSVLKVTR..N..LKEL..DL............................
gi|34878690|ref|NP_899632.1|      .........--------------..-..-RHL..DM............................
gi|229577123|ref|NP_872345.2|     .........--------------..-..----..--............................
gi|6912466|ref|NP_036436.1|       .........------------CL..M..LETV..TV............................
gi|156415984|ref|NP_037485.2|     .........PMLSELCEAMKANT..Y..VRSF..SL............................
gi|7657647|ref|NP_055363.1|       .........--------------..-..----..--............................
gi|7657649|ref|NP_055362.1|       .........--------------..-..----..--............................
gi|289666746|ref|NP_699181.2|     .........AGLWSSL-------..-..----..--............................
gi|197333692|ref|NP_001127948.1|  .........-----IPRWVFHLK..N..LKEL..YL............................
gi|21245134|ref|NP_056165.1|      .........-----IPRWVFHLK..N..LKEL..YL............................
gi|161333852|ref|NP_659469.3|     .........ASFKFID---KNYP..N..LSHI..YM............................
gi|284447314|ref|NP_001165184.1|  .........SSLKTFA---QNCR..N..IEHL..NL............................
gi|260763922|ref|NP_001159588.1|  .........--------------..-..----..--............................
gi|4507553|ref|NP_003266.1|       .........--------------..-..----..--............................
gi|21361547|ref|NP_002930.2|      .........--------------..-..----..--............................
gi|42794608|ref|NP_976318.1|      .........--------------..-..----..--............................
gi|42822864|ref|NP_976322.1|      .........--------------..-..----..--............................
gi|42822866|ref|NP_976323.1|      .........--------------..-..----..--............................
gi|42822868|ref|NP_976321.1|      .........--------------..-..----..--............................
gi|42822870|ref|NP_976320.1|      .........--------------..-..----..--............................
gi|42822872|ref|NP_976317.1|      .........--------------..-..----..--............................
gi|42822874|ref|NP_976319.1|      .........--------------..-..----..--............................
gi|62912470|ref|NP_001017403.1|   .........---------FEGLH..N..LETL..DL............................
gi|38348406|ref|NP_940967.1|      .........-------SVFEGLE..R..LREL..DL............................
gi|187608777|ref|NP_038460.4|     .........AQLTPLLRALKLHT..A..LREL..RL............................
gi|16306595|ref|NP_005974.2|      .........--------------..-..VQHM..DL............................
gi|22748931|ref|NP_689654.1|      .........NGLGHAF--VQEIG..S..LRAL..NL............................
gi|150378503|ref|NP_997046.1|     .........--------------..-..----..--............................
gi|4504379|ref|NP_003658.1|       .........------------LH..S..LETL..DL............................
gi|255683361|ref|NP_001156787.2|  .........TSIIAVA---SHCP..L..LQKV..HV............................
gi|61175232|ref|NP_001012992.1|   .........--------------..-..----..--............................
gi|54607116|ref|NP_938012.2|      .........--------------..-..----..--............................
gi|20302168|ref|NP_619542.1|      .........NGLNITDGAFLNLK..N..LREL..LL............................
gi|21450705|ref|NP_659436.1|      .........--------------..-..----..--............................
gi|112380630|ref|NP_036266.2|     .........--------------..-..----..--............................
gi|291190783|ref|NP_001167448.1|  .........--------------..-..----..--............................
gi|291190781|ref|NP_060110.4|     .........--------------..-..----..--............................
gi|66392157|ref|NP_001013860.1|   .........--------------..-..----..--............................
gi|19924149|ref|NP_612564.1|      .........LA----LGAFSGLS..S..LQKL..VA............................
gi|312433960|ref|NP_001186067.1|  .........QDIRYLGKIFSSAT..S..L-RL..QI............................
gi|312433962|ref|NP_001186068.1|  .........QDIRYLGKIFSSAT..S..L-RL..QI............................
gi|40788015|ref|NP_067032.3|      .........QDIRYLGKIFSSAT..S..L-RL..QI............................
gi|16306588|ref|NP_036292.2|      .........TCLEVIS---EMCP..N..LQAL..NL............................
gi|14249170|ref|NP_116026.1|      .........--------------..-..----..--............................
gi|156938257|ref|NP_612369.3|     .........--------------..-..----..--............................
gi|161333854|ref|NP_001104508.1|  .........------------CS..R..ITSL..VF............................
gi|19718734|ref|NP_003255.2|      .........----IEEDSFSSLG..S..LEHL..DL............................
gi|149274651|ref|NP_115547.1|     .........--------------..-..----..--............................
gi|149274621|ref|NP_001092272.1|  .........--------------..-..----..--............................
gi|291190781|ref|NP_060110.4|     .........DFAQKLASALAHNP..NsgLHTI..NL............................
gi|291190783|ref|NP_001167448.1|  .........DFAQKLASALAHNP..NsgLHTI..NL............................
gi|163965441|ref|NP_653303.2|     .........--------------..-..----..--............................
gi|161333852|ref|NP_659469.3|     .........KTFRSVS----H--..-..----..--............................
gi|190194416|ref|NP_077302.3|     .........--------------..-..----..--............................
gi|21264320|ref|NP_612202.1|      .........AVCRDLSEALRAAP..A..LTEL..GL............................
gi|25777608|ref|NP_078894.2|      .........--------------..-..----..--............................
gi|218931148|ref|NP_001136357.1|  .........--------------..-..----..--............................
gi|156938257|ref|NP_612369.3|     .........DFVQKLAGVFGENG..ScvLHAL..TL............................
gi|156938336|ref|NP_000237.2|     .........--------------..-..----..--............................
gi|54112380|ref|NP_001005366.1|   .........KQLSWLI---NRLP..G..LRDL..VL............................
gi|54112382|ref|NP_115979.3|      .........KQLSWLI---NRLP..G..LRDL..VL............................
gi|157168349|ref|NP_001093254.2|  .........KQLMWLL---NRLQ..G..----..--............................
gi|118442828|ref|NP_001072983.1|  .........--------------..-..----..--............................
gi|4507375|ref|NP_003184.1|       .........--------------..-..----..--............................
gi|116268109|ref|NP_115582.3|     .........--------------..-..---L..CL............................
gi|25777610|ref|NP_733840.1|      .........--------------..-..----..--............................
gi|164663798|ref|NP_001106873.1|  .........--------------..-..----..--............................
gi|66392157|ref|NP_001013860.1|   .........DFVRRLAQALAGHSssG..LREL..SL............................
gi|161333854|ref|NP_001104508.1|  .........KTFRSVS----H--..-..----..--............................
gi|16306580|ref|NP_036440.1|      .........QALSGII-------..-..----..--............................
gi|341916269|ref|XP_003403438.1|  .........D---QIFPNLDKFL..C..LKELsvDL............................
gi|119393876|ref|NP_075043.1|     .........D---QIFPNLDKFL..C..LKELsvDL............................
gi|341916267|ref|XP_003403437.1|  .........D---QIFPNLDKFL..C..LKELsvDL............................
gi|119393878|ref|NP_004527.2|     .........D---QIFPNLDKFL..C..LKELsvDL............................
gi|341916263|ref|XP_003403435.1|  .........D---QIFPNLDKFL..C..LKELsvDL............................
gi|40255157|ref|NP_700356.2|      .........--------------..-..----..--............................
gi|16306576|ref|NP_036294.1|      .........DALVMLA---KACC..Q..LHSL..DL............................
gi|302129689|ref|NP_001180464.1|  .........--------------..-..----..--............................
gi|302129687|ref|NP_001180463.1|  .........--------------..-..----..--............................
gi|16306572|ref|NP_036293.1|      .........--------------..-..----..--............................
gi|341915644|ref|XP_003403561.1|  .........--------------..-..----..--............................
gi|341913879|ref|XP_003403707.1|  .........--------------..-..----..--............................
gi|61742136|ref|NP_078831.3|      .........DALVMLA---KACC..Q..LHSL..DL............................
gi|38569471|ref|NP_006360.3|      .........EAALTLCHLLSSWV..S..LESL..TL............................
gi|16306591|ref|NP_036295.1|      .........--------------..-..----..--............................
gi|51873034|ref|NP_001004055.1|   .........--------------..-..----..--............................
gi|341916265|ref|XP_003403436.1|  .........AE----QELLLTLP..S..LESL..EV............................
gi|7661860|ref|NP_055480.1|       .........DNFRYFLAQMGRFT..C..LREL..SM............................
gi|122937351|ref|NP_001073947.1|  .........PLLASIARELSKMA..Q..LTEL..SV............................
gi|46249367|ref|NP_996836.1|      .........QYIAQFTSQFLSLQ..C..LQAL..YV............................
gi|46249369|ref|NP_996837.1|      .........QYIAQFTSQFLSLQ..C..LQAL..YV............................
gi|46249371|ref|NP_996838.1|      .........QYIAQFTSQFLSLQ..C..LQAL..YV............................
gi|46249373|ref|NP_996839.1|      .........QYIAQFTSQFLSLQ..C..LQAL..YV............................
gi|5174641|ref|NP_006106.1|       .........QYIAQFTSQFLSLQ..C..LQAL..YV............................
gi|88942379|ref|XP_933494.1|      .........EIVTQFTTQFLKLH..C..LQKL..YM............................
gi|148356236|ref|NP_001091846.1|  .........EIVTQFTTQFLKLR..C..LQKL..YM............................
gi|61102721|ref|NP_001010890.1|   .........EIVTQFTTQFLKLR..C..LQKL..YM............................
gi|153792112|ref|NP_001093322.1|  .........EFVTQFTTQFLKLR..C..LQKL..YM............................
gi|153945800|ref|NP_001093584.1|  .........EFVTQFTTQFLKLR..C..LQKL..YM............................
gi|61696142|ref|NP_001013425.1|   .........EIVTQFTTQFLKLC..C..LQKL..SM............................
gi|226437621|ref|NP_001139816.1|  .........EIVTQFTTQFLKLR..C..LQKL..YM............................
gi|59958373|ref|NP_001009611.1|   .........EIVTQFTTQFLKLR..C..LQKL..YM............................
gi|58219004|ref|NP_001010889.1|   .........EIVTQFTTQFLKLC..C..LQKL..SM............................
gi|153791443|ref|NP_001093320.1|  .........QLVAEFSSVFLRLE..Y..LQML..YM............................
gi|310118528|ref|XP_003118894.1|  .........EIVTQFTTQFLKLH..C..LQKL..YM............................
gi|310118526|ref|XP_001130065.3|  .........EIVTQFTTQFLKLC..C..LQKL..SM............................
gi|55742693|ref|NP_078922.1|      .........--------------..-..----..--............................
gi|194306635|ref|NP_001093260.2|  .........QLVAEFSSVFLRLE..Y..LQML..YM............................
gi|66954681|ref|NP_001019832.1|   .........RLVTKFSSVFLRLE..H..LQLL..KI............................
gi|59676593|ref|NP_001012277.1|   .........QFIARFTSQFLKLD..Y..FQNL..SM............................
gi|59676587|ref|NP_001012276.1|   .........QFIARFTSQFLKLD..Y..FQNL..SM............................
gi|12738831|ref|NP_075389.1|      .........RLVAKFSSVFLRLE..H..LQLL..KI............................
gi|194306638|ref|NP_001013714.3|  .........QLVAEFSSVLLRLE..Y..LQML..YV............................
gi|8923179|ref|NP_060173.1|       .........----------YMAS..R..LHSL..RM............................
gi|124249372|ref|NP_001074299.1|  .........QFVIQFTSQFLKLD..Y..FQKL..YM............................
gi|154800493|ref|NP_001094101.1|  .........QLVAEFSSVLLRLE..Y..LQML..YV............................
gi|29789255|ref|NP_085132.1|      .........--------------..-..---L..SL............................
gi|194018550|ref|NP_938204.2|     .........--------------..-..---L..SL............................
gi|157426875|ref|NP_079239.3|     .........LR---LSKMLSALQ..H..LRSL..AI............................
gi|33589814|ref|NP_006327.2|      .........--------------..-..----..--............................
gi|12738834|ref|NP_075390.1|      .........WLVTRFTSVFLRLE..H..LQLL..KI............................
gi|341915238|ref|XP_938952.6|     .........EELESIFSGLENNQ..R..LQGL..SL............................
gi|153792140|ref|NP_001093324.1|  .........-LIRKLRCYLKEMK..N..LRKL..VF............................
gi|16506299|ref|NP_443172.1|      .........--------------..-..----..--............................
gi|194018546|ref|NP_001034450.2|  .........TG--KFAPYLSQMS..N..LREL..FLafgyerelyvsvqwpcipdldspflcly
gi|226437632|ref|NP_001004339.2|  .........--------------..-..----..--............................
gi|113865933|ref|NP_001038945.1|  .........TG--KFAPYLSQMS..N..LRKL..FLafgyddelyvsgqqqfvpdldcpflcly
gi|116268109|ref|NP_115582.3|     .........--------------..-..----..--............................
gi|157426839|ref|NP_001093321.1|  .........TG--KFAPYLSQMS..N..LRKL..FLafgyddelyvsgqqqfvpdldcpflcly
gi|268832194|ref|NP_001161343.1|  .........--------------..-..----..--............................
gi|268832172|ref|NP_060505.2|     .........--------------..-..----..--............................
gi|268830752|ref|NP_001161339.1|  .........--------------..-..----..--............................
gi|165932385|ref|NP_001107039.1|  .........DMVLQLLPALSTLP..R..LTTL..AL............................
gi|134288867|ref|NP_997527.2|     .........--------------..-..----..--............................
gi|23397500|ref|NP_694962.1|      .........--------------..-..----..--............................
gi|148922963|ref|NP_036291.2|     .........--------------..-..----..--............................
gi|16306584|ref|NP_036290.1|      .........------CDILSQLV..-..----..--............................
gi|45505155|ref|NP_110420.3|      .........--------------..-..LRHL..YM............................
gi|45545409|ref|NP_995308.1|      .........--------------..-..LRHL..YM............................
gi|22547146|ref|NP_060848.2|      .........--------------..-..----..--............................
gi|51558774|ref|NP_001003803.1|   .........--------------..-..----..--............................
gi|289803020|ref|NP_001073879.2|  .........RSLWLAS---CY--..-..----..--............................
gi|158321897|ref|NP_703148.4|     .........-----FCSMLGTHP..H..LRQL..DL............................
gi|28827813|ref|NP_789792.1|      .........--WQDLCSVLHTNE..H..LREL..DL............................


                                           120               130                                    
                                             |                 |                                    
d1a4ya_                             .........S......DN..LLGDAGLQLLCEGLLD............................
gi|21955154|ref|NP_653288.1|      .........Y......RN..ALGSRGVKLLCQGLRH............................
gi|33519450|ref|NP_789790.2|      .........E......NT..SLDDPSLAILCKALAQ............................
gi|28827813|ref|NP_789792.1|      .........K......GS..DIGDNGVKSLCEALKH............................
gi|119395764|ref|NP_001073289.1|  .........S......DN..SLGDPGMRVLCETLQH............................
gi|34878693|ref|NP_004886.3|      .........S......DN..SLGDPGMRVLCETLQH............................
gi|158321897|ref|NP_703148.4|     .........G......GT..HLKEEDVRMACEALKH............................
gi|194018482|ref|NP_604393.2|     .........Q......DS..TLSESTFVTWCNQLRH............................
gi|110624785|ref|NP_789780.2|     .........S......NS..KLHASSVKGLCLALKN............................
gi|21361547|ref|NP_002930.2|      .........-......--..----------------............................
gi|42794608|ref|NP_976318.1|      .........-......--..----------------............................
gi|42822864|ref|NP_976322.1|      .........-......--..----------------............................
gi|42822866|ref|NP_976323.1|      .........-......--..----------------............................
gi|42822868|ref|NP_976321.1|      .........-......--..----------------............................
gi|42822870|ref|NP_976320.1|      .........-......--..----------------............................
gi|42822872|ref|NP_976317.1|      .........-......--..----------------............................
gi|42822874|ref|NP_976319.1|      .........-......--..----------------............................
gi|291463278|ref|NP_001167553.1|  .........N......DS..FLSASLVRILCEQIAS............................
gi|291463280|ref|NP_001167554.1|  .........N......DS..FLSASLVRILCEQIAS............................
gi|291463275|ref|NP_001167552.1|  .........N......DS..FLSASLVRILCEQIAS............................
gi|8923473|ref|NP_060322.1|       .........N......DS..FLSASLVRILCEQIAS............................
gi|194018484|ref|NP_659444.2|     .........F......DN..DLNGISERILSKALEH............................
gi|187937176|ref|NP_001120727.1|  .........K......QS..FLSDSSVRILCDHVTR............................
gi|33667040|ref|NP_789781.2|      .........T......NS..VLGPPFLKALAAALRH............................
gi|46049100|ref|NP_631915.2|      .........K......QS..FLSDSSVRILCDHVTR............................
gi|113205085|ref|NP_079003.2|     .........S......WN..SKVGGNLPLILQKFQK............................
gi|188536116|ref|NP_001120933.1|  .........V......QC..VLPSSSHAACSHGLVN............................
gi|338797736|ref|NP_061994.1|     .........S......FNk.HIGTRGWQAAAHMMRK............................
gi|5174617|ref|NP_006083.1|       .........-......--..----------------............................
gi|188536002|ref|NP_001120934.1|  .........V......QC..VLPSSSHAACSHGLGR............................
gi|116268109|ref|NP_115582.3|     .........S......HL..LLNSSTLALLTHRLSQ............................
gi|15193292|ref|NP_150639.1|      .........-......--..----------------............................
gi|118918429|ref|NP_849172.2|     .........-......--..----------------............................
gi|289666780|ref|NP_001166250.1|  .........-......--..-VTGEDFWILSKILKN............................
gi|75709196|ref|NP_996611.2|      .........K......QS..FLSDSSVRILCDHVTR............................
gi|168986655|ref|NP_919263.2|     .........-......--..----------------............................
gi|116268109|ref|NP_115582.3|     .........A......GS..KITARGISHLVKALPL............................
gi|11545912|ref|NP_071445.1|      .........-......--..----------------............................
gi|118918429|ref|NP_849172.2|     .........-......--..----------------............................
gi|289666778|ref|NP_699184.2|     .........-......--..---GEDFWILSKILKN............................
gi|27734755|ref|NP_116264.2|      .........N......GCt.KTTDATCTSLSKF---............................
gi|4506411|ref|NP_002874.1|       .........E......GN..TVGVEAARVIAKALEK............................
gi|284447308|ref|NP_036289.3|     .........N......GCt.KITDSTCYSLSRF---............................
gi|289666782|ref|NP_001166251.1|  .........-......--..-VTGEDFWILSKILKN............................
gi|74271814|ref|NP_001028225.1|   .........S......GN..SLSHSAVKSLCKTLRR............................
gi|7662386|ref|NP_055737.1|       .........S......GN..SLSHSAVKSLCKTLRR............................
gi|14719829|ref|NP_127497.1|      .........S......GN..SLSHSAVKSLCKTLRR............................
gi|296531375|ref|NP_001171835.1|  .........R......GCl.GVGDNALRTFAQN---............................
gi|226342931|ref|NP_079101.3|     .........A......HN..KLSVAP-QFLPRSLRVadlaanqvmeifpltfg...........
gi|308818204|ref|NP_001184224.1|  .........D......GN..NLIQ-----IPSQ---............................
gi|4557543|ref|NP_001384.1|       .........D......GN..NLIQ-----IPSQ---............................
gi|21389431|ref|NP_653221.1|      .........-......--..----------------............................
gi|14719835|ref|NP_127500.1|      .........S......GN..SLSHSAVKSLCKTLRR............................
gi|14719833|ref|NP_127499.1|      .........S......GN..SLSHSAVKSLCKTLRR............................
gi|34878690|ref|NP_899632.1|      .........V......QC..VLPSSSHAACSHGLGR............................
gi|229577123|ref|NP_872345.2|     .........-......--..----------------............................
gi|6912466|ref|NP_036436.1|       .........S......GCr.RLTDRGLYTIAQC---............................
gi|156415984|ref|NP_037485.2|     .........V......AT..RSGDPIANAVADMLRE............................
gi|7657647|ref|NP_055363.1|       .........-......--..----------------............................
gi|7657649|ref|NP_055362.1|       .........-......--..----------------............................
gi|289666746|ref|NP_699181.2|     .........-......--..----------------............................
gi|197333692|ref|NP_001127948.1|  .........S......GC..VLPEQLSTMQLEGFQD............................
gi|21245134|ref|NP_056165.1|      .........S......GC..VLPEQLSTMQLEGFQD............................
gi|161333852|ref|NP_659469.3|     .........A......DCk.GITDSSLRSLSP----............................
gi|284447314|ref|NP_001165184.1|  .........N......GCt.KITDSTCYSLSRFCSK............................
gi|260763922|ref|NP_001159588.1|  .........-......--..----------------............................
gi|4507553|ref|NP_003266.1|       .........-......--..----------------............................
gi|21361547|ref|NP_002930.2|      .........-......--..----------------............................
gi|42794608|ref|NP_976318.1|      .........-......--..----------------............................
gi|42822864|ref|NP_976322.1|      .........-......--..----------------............................
gi|42822866|ref|NP_976323.1|      .........-......--..----------------............................
gi|42822868|ref|NP_976321.1|      .........-......--..----------------............................
gi|42822870|ref|NP_976320.1|      .........-......--..----------------............................
gi|42822872|ref|NP_976317.1|      .........-......--..----------------............................
gi|42822874|ref|NP_976319.1|      .........-......--..----------------............................
gi|62912470|ref|NP_001017403.1|   .........N......YN..KLQE-----FPVAIRT............................
gi|38348406|ref|NP_940967.1|      .........Q......RN..YIFE-----IEGGAFD............................
gi|187608777|ref|NP_038460.4|     .........A......GN..RLGDKCVAELVAALGT............................
gi|16306595|ref|NP_005974.2|      .........S......NS..VIEVSTLHGILS---Q............................
gi|22748931|ref|NP_689654.1|      .........S......LCk.QITDSSLGRIAQY---............................
gi|150378503|ref|NP_997046.1|     .........-......--..----------------............................
gi|4504379|ref|NP_003658.1|       .........N......YN..NLDE-----FPTAIRT............................
gi|255683361|ref|NP_001156787.2|  .........G......NQd.KLTDEGLKQLGSK---............................
gi|61175232|ref|NP_001012992.1|   .........-......--..----------------............................
gi|54607116|ref|NP_938012.2|      .........-......--..----------------............................
gi|20302168|ref|NP_619542.1|      .........E......DN..QLPQ-----IPSGL--............................
gi|21450705|ref|NP_659436.1|      .........-......--..----------------............................
gi|112380630|ref|NP_036266.2|     .........-......--..----------------............................
gi|291190783|ref|NP_001167448.1|  .........-......--..----------------............................
gi|291190781|ref|NP_060110.4|     .........-......--..----------------............................
gi|66392157|ref|NP_001013860.1|   .........-......--..----------------............................
gi|19924149|ref|NP_612564.1|      .........V......ET..NLAS-----LENFPIG............................
gi|312433960|ref|NP_001186067.1|  .........K......RCa.GVAGS----LSLVLST............................
gi|312433962|ref|NP_001186068.1|  .........K......RCa.GVAGS----LSLVLST............................
gi|40788015|ref|NP_067032.3|      .........K......RCa.GVAGS----LSLVLST............................
gi|16306588|ref|NP_036292.2|      .........S......SCd.KLPPQAFNHIAK----............................
gi|14249170|ref|NP_116026.1|      .........-......--..----------------............................
gi|156938257|ref|NP_612369.3|     .........-......--..----------------............................
gi|161333854|ref|NP_001104508.1|  .........T......GAp.HISDCTFRALS-----............................
gi|19718734|ref|NP_003255.2|      .........S......YN..YLSN-----LSSSWFK............................
gi|149274651|ref|NP_115547.1|     .........-......--..----------------............................
gi|149274621|ref|NP_001092272.1|  .........-......--..----------------............................
gi|291190781|ref|NP_060110.4|     .........A......GN..PLEDRGVSSLSIQFAK............................
gi|291190783|ref|NP_001167448.1|  .........A......GN..PLEDRGVSSLSIQFAK............................
gi|163965441|ref|NP_653303.2|     .........-......--..----------------............................
gi|161333852|ref|NP_659469.3|     .........-......--..----------------............................
gi|190194416|ref|NP_077302.3|     .........-......--..----------------............................
gi|21264320|ref|NP_612202.1|      .........L......HN..RLSEAGLRMLSEGLAW............................
gi|25777608|ref|NP_078894.2|      .........-......--..----------------............................
gi|218931148|ref|NP_001136357.1|  .........-......--..----------------............................
gi|156938257|ref|NP_612369.3|     .........S......HN..PIEDKGFLSLSQQLLC............................
gi|156938336|ref|NP_000237.2|     .........-......--..----------------............................
gi|54112380|ref|NP_001005366.1|   .........S......GC..SWIA-----VSALCSS............................
gi|54112382|ref|NP_115979.3|      .........S......GC..SWIA-----VSALCSS............................
gi|157168349|ref|NP_001093254.2|  .........-......--..----------------............................
gi|118442828|ref|NP_001072983.1|  .........-......--..------FDSIMKQQSQ............................
gi|4507375|ref|NP_003184.1|       .........-......--..------FDSIMKQQSQ............................
gi|116268109|ref|NP_115582.3|     .........S......EC..PLEPPSLTRLCATLKD............................
gi|25777610|ref|NP_733840.1|      .........-......--..----------------............................
gi|164663798|ref|NP_001106873.1|  .........-......--..----------------............................
gi|66392157|ref|NP_001013860.1|   .........A......GN..LLDDRGMTALSRHLER............................
gi|161333854|ref|NP_001104508.1|  .........-......--..----------------............................
gi|16306580|ref|NP_036440.1|      .........-......--..----------------............................
gi|341916269|ref|XP_003403438.1|  .........E......GNinVFSV-----IPEEFPN............................
gi|119393876|ref|NP_075043.1|     .........E......GNinVFSV-----IPEEFPN............................
gi|341916267|ref|XP_003403437.1|  .........E......GNinVFSV-----IPEEFPN............................
gi|119393878|ref|NP_004527.2|     .........E......GNinVFSV-----IPEEFPN............................
gi|341916263|ref|XP_003403435.1|  .........E......GNinVFSV-----IPEEFPN............................
gi|40255157|ref|NP_700356.2|      .........-......--..----------------............................
gi|16306576|ref|NP_036294.1|      .........Q......HS..MVESTAVVSFLEE---............................
gi|302129689|ref|NP_001180464.1|  .........-......--..----------------............................
gi|302129687|ref|NP_001180463.1|  .........-......--..----------------............................
gi|16306572|ref|NP_036293.1|      .........-......--..----------------............................
gi|341915644|ref|XP_003403561.1|  .........-......--..----------------............................
gi|341913879|ref|XP_003403707.1|  .........-......--..----------------............................
gi|61742136|ref|NP_078831.3|      .........Q......HS..MVESTAVVSFLEE---............................
gi|38569471|ref|NP_006360.3|      .........S......YN..GLGSNIFRLLDSL---............................
gi|16306591|ref|NP_036295.1|      .........-......--..----------------............................
gi|51873034|ref|NP_001004055.1|   .........-......--..----------------............................
gi|341916265|ref|XP_003403436.1|  .........S......GT..IQSQ------------............................
gi|7661860|ref|NP_055480.1|       .........G......SS..LLSGR----LDQLLST............................
gi|122937351|ref|NP_001073947.1|  .........A......FS..TLTGKIPTLLGPL---............................
gi|46249367|ref|NP_996836.1|      .........D......SLf.FLRG----RLDQLLRH............................
gi|46249369|ref|NP_996837.1|      .........D......SLf.FLRG----RLDQLLRH............................
gi|46249371|ref|NP_996838.1|      .........D......SLf.FLRG----RLDQLLRH............................
gi|46249373|ref|NP_996839.1|      .........D......SLf.FLRG----RLDQLLRH............................
gi|5174641|ref|NP_006106.1|       .........D......SLf.FLRG----RLDQLLRH............................
gi|88942379|ref|XP_933494.1|      .........N......SVs.FLEG----HLDQLLSC............................
gi|148356236|ref|NP_001091846.1|  .........N......SVs.FLEG----HLDQLLSC............................
gi|61102721|ref|NP_001010890.1|   .........N......SVs.FLEG----HLDQLLSC............................
gi|153792112|ref|NP_001093322.1|  .........N......SVs.FLEG----HLDQMLSC............................
gi|153945800|ref|NP_001093584.1|  .........N......SVs.FLEG----HLDQMLSC............................
gi|61696142|ref|NP_001013425.1|   .........N......SVs.FLEG----HLDQLLSC............................
gi|226437621|ref|NP_001139816.1|  .........N......SVs.FLEG----HLDQLLSC............................
gi|59958373|ref|NP_001009611.1|   .........N......SVs.FLEG----HLDQLLSC............................
gi|58219004|ref|NP_001010889.1|   .........N......SVs.FLEG----HLDQLLSC............................
gi|153791443|ref|NP_001093320.1|  .........R......RI..RFFEG---YLDQLIRC............................
gi|310118528|ref|XP_003118894.1|  .........N......SVs.FLEG----HLDQLLSC............................
gi|310118526|ref|XP_001130065.3|  .........N......SVs.FLEG----HLDQLLSC............................
gi|55742693|ref|NP_078922.1|      .........-......--..----------------............................
gi|194306635|ref|NP_001093260.2|  .........R......RI..RFFEG---YLDQLIRC............................
gi|66954681|ref|NP_001019832.1|   .........K......LI..TFFSGHLEQLIRCL--............................
gi|59676593|ref|NP_001012277.1|   .........H......SVs.FLEG----HLDQLLRC............................
gi|59676587|ref|NP_001012276.1|   .........H......SVs.FLEG----HLDQLLRC............................
gi|12738831|ref|NP_075389.1|      .........K......LI..TFFSGHLEQLIRCL--............................
gi|194306638|ref|NP_001013714.3|  .........R......RVc.FFRG----HLDQLIRC............................
gi|8923179|ref|NP_060173.1|       .........G......GY..LFSGSQAPQLSPALLR............................
gi|124249372|ref|NP_001074299.1|  .........H......SVs.FLEG----HLDQLLRC............................
gi|154800493|ref|NP_001094101.1|  .........R......RVc.FFRG----HLDQLIRC............................
gi|29789255|ref|NP_085132.1|      .........A......EN..KLGPCMLLALRGNQT-............................
gi|194018550|ref|NP_938204.2|     .........A......EN..KLGPCMLLALRGNQT-............................
gi|157426875|ref|NP_079239.3|     .........DvspgfdAS..QLSSECKATL-----Srvrelkqtlftpsygvvpcctsleklll
gi|33589814|ref|NP_006327.2|      .........-......-Ce.KLSAKSLQTLRSF---............................
gi|12738834|ref|NP_075390.1|      .........K......LI..TFFSGHLEQLIRCL--............................
gi|341915238|ref|XP_938952.6|     .........R......YC..GLGPQSGLRLGSVISQ............................
gi|153792140|ref|NP_001093324.1|  .........S......RC..L---------------............................
gi|16506299|ref|NP_443172.1|      .........-......--..----------------............................
gi|194018546|ref|NP_001034450.2|  ypqmlyikkI......-S..NIKE----HLEHLLRY............................
gi|226437632|ref|NP_001004339.2|  .........-......--..----------------............................
gi|113865933|ref|NP_001038945.1|  ypqmlyirkI......-S..NIKE----HLEHLLRC............................
gi|116268109|ref|NP_115582.3|     .........-......--..----------------............................
gi|157426839|ref|NP_001093321.1|  ypqmlyirkI......-S..NIKE----HLEHLLRC............................
gi|268832194|ref|NP_001161343.1|  .........-......--..----------------............................
gi|268832172|ref|NP_060505.2|     .........-......--..----------------............................
gi|268830752|ref|NP_001161339.1|  .........-......--..----------------............................
gi|165932385|ref|NP_001107039.1|  .........N......GN..RLTRAVLRDLTDILKD............................
gi|134288867|ref|NP_997527.2|     .........-......--..----------------............................
gi|23397500|ref|NP_694962.1|      .........-......--..------MRGLLSCLSK............................
gi|148922963|ref|NP_036291.2|     .........-......--..----------------............................
gi|16306584|ref|NP_036290.1|      .........-......--..----------------............................
gi|45505155|ref|NP_110420.3|      .........K......WV..RLTK--PQPFKDFL--............................
gi|45545409|ref|NP_995308.1|      .........K......WV..RLTK--PQPFKDFL--............................
gi|22547146|ref|NP_060848.2|      .........-......--..----------------............................
gi|51558774|ref|NP_001003803.1|   .........-......--..----------------............................
gi|289803020|ref|NP_001073879.2|  .........-......--..----------------............................
gi|158321897|ref|NP_703148.4|     .........G......SS..ILTERAMKTLCAKLRH............................
gi|28827813|ref|NP_789792.1|      .........Y......HS..NLDKSAMNILHHELRH............................


                                                                                                    
                                                                                                    
d1a4ya_                             ................................................................
gi|21955154|ref|NP_653288.1|      ................................................................
gi|33519450|ref|NP_789790.2|      ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................
gi|119395764|ref|NP_001073289.1|  ................................................................
gi|34878693|ref|NP_004886.3|      ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|194018482|ref|NP_604393.2|     ................................................................
gi|110624785|ref|NP_789780.2|     ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|291463278|ref|NP_001167553.1|  ................................................................
gi|291463280|ref|NP_001167554.1|  ................................................................
gi|291463275|ref|NP_001167552.1|  ................................................................
gi|8923473|ref|NP_060322.1|       ................................................................
gi|194018484|ref|NP_659444.2|     ................................................................
gi|187937176|ref|NP_001120727.1|  ................................................................
gi|33667040|ref|NP_789781.2|      ................................................................
gi|46049100|ref|NP_631915.2|      ................................................................
gi|113205085|ref|NP_079003.2|     ................................................................
gi|188536116|ref|NP_001120933.1|  ................................................................
gi|338797736|ref|NP_061994.1|     ................................................................
gi|5174617|ref|NP_006083.1|       ................................................................
gi|188536002|ref|NP_001120934.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|15193292|ref|NP_150639.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666780|ref|NP_001166250.1|  ................................................................
gi|75709196|ref|NP_996611.2|      ................................................................
gi|168986655|ref|NP_919263.2|     ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|11545912|ref|NP_071445.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666778|ref|NP_699184.2|     ................................................................
gi|27734755|ref|NP_116264.2|      ................................................................
gi|4506411|ref|NP_002874.1|       ................................................................
gi|284447308|ref|NP_036289.3|     ................................................................
gi|289666782|ref|NP_001166251.1|  ................................................................
gi|74271814|ref|NP_001028225.1|   ................................................................
gi|7662386|ref|NP_055737.1|       ................................................................
gi|14719829|ref|NP_127497.1|      ................................................................
gi|296531375|ref|NP_001171835.1|  ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|308818204|ref|NP_001184224.1|  ................................................................
gi|4557543|ref|NP_001384.1|       ................................................................
gi|21389431|ref|NP_653221.1|      ................................................................
gi|14719835|ref|NP_127500.1|      ................................................................
gi|14719833|ref|NP_127499.1|      ................................................................
gi|34878690|ref|NP_899632.1|      ................................................................
gi|229577123|ref|NP_872345.2|     ................................................................
gi|6912466|ref|NP_036436.1|       ................................................................
gi|156415984|ref|NP_037485.2|     ................................................................
gi|7657647|ref|NP_055363.1|       ................................................................
gi|7657649|ref|NP_055362.1|       ................................................................
gi|289666746|ref|NP_699181.2|     ................................................................
gi|197333692|ref|NP_001127948.1|  ................................................................
gi|21245134|ref|NP_056165.1|      ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|284447314|ref|NP_001165184.1|  ................................................................
gi|260763922|ref|NP_001159588.1|  ................................................................
gi|4507553|ref|NP_003266.1|       ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|187608777|ref|NP_038460.4|     ................................................................
gi|16306595|ref|NP_005974.2|      ................................................................
gi|22748931|ref|NP_689654.1|      ................................................................
gi|150378503|ref|NP_997046.1|     ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|255683361|ref|NP_001156787.2|  ................................................................
gi|61175232|ref|NP_001012992.1|   ................................................................
gi|54607116|ref|NP_938012.2|      ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|21450705|ref|NP_659436.1|      ................................................................
gi|112380630|ref|NP_036266.2|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|19924149|ref|NP_612564.1|      ................................................................
gi|312433960|ref|NP_001186067.1|  ................................................................
gi|312433962|ref|NP_001186068.1|  ................................................................
gi|40788015|ref|NP_067032.3|      ................................................................
gi|16306588|ref|NP_036292.2|      ................................................................
gi|14249170|ref|NP_116026.1|      ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|149274651|ref|NP_115547.1|     ................................................................
gi|149274621|ref|NP_001092272.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|163965441|ref|NP_653303.2|     ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|190194416|ref|NP_077302.3|     ................................................................
gi|21264320|ref|NP_612202.1|      ................................................................
gi|25777608|ref|NP_078894.2|      ................................................................
gi|218931148|ref|NP_001136357.1|  ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|156938336|ref|NP_000237.2|     ................................................................
gi|54112380|ref|NP_001005366.1|   ................................................................
gi|54112382|ref|NP_115979.3|      ................................................................
gi|157168349|ref|NP_001093254.2|  ................................................................
gi|118442828|ref|NP_001072983.1|  ................................................................
gi|4507375|ref|NP_003184.1|       ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|25777610|ref|NP_733840.1|      ................................................................
gi|164663798|ref|NP_001106873.1|  ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|16306580|ref|NP_036440.1|      ................................................................
gi|341916269|ref|XP_003403438.1|  ................................................................
gi|119393876|ref|NP_075043.1|     ................................................................
gi|341916267|ref|XP_003403437.1|  ................................................................
gi|119393878|ref|NP_004527.2|     ................................................................
gi|341916263|ref|XP_003403435.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|16306576|ref|NP_036294.1|      ................................................................
gi|302129689|ref|NP_001180464.1|  ................................................................
gi|302129687|ref|NP_001180463.1|  ................................................................
gi|16306572|ref|NP_036293.1|      ................................................................
gi|341915644|ref|XP_003403561.1|  ................................................................
gi|341913879|ref|XP_003403707.1|  ................................................................
gi|61742136|ref|NP_078831.3|      ................................................................
gi|38569471|ref|NP_006360.3|      ................................................................
gi|16306591|ref|NP_036295.1|      ................................................................
gi|51873034|ref|NP_001004055.1|   ................................................................
gi|341916265|ref|XP_003403436.1|  ................................................................
gi|7661860|ref|NP_055480.1|       ................................................................
gi|122937351|ref|NP_001073947.1|  ................................................................
gi|46249367|ref|NP_996836.1|      ................................................................
gi|46249369|ref|NP_996837.1|      ................................................................
gi|46249371|ref|NP_996838.1|      ................................................................
gi|46249373|ref|NP_996839.1|      ................................................................
gi|5174641|ref|NP_006106.1|       ................................................................
gi|88942379|ref|XP_933494.1|      ................................................................
gi|148356236|ref|NP_001091846.1|  ................................................................
gi|61102721|ref|NP_001010890.1|   ................................................................
gi|153792112|ref|NP_001093322.1|  ................................................................
gi|153945800|ref|NP_001093584.1|  ................................................................
gi|61696142|ref|NP_001013425.1|   ................................................................
gi|226437621|ref|NP_001139816.1|  ................................................................
gi|59958373|ref|NP_001009611.1|   ................................................................
gi|58219004|ref|NP_001010889.1|   ................................................................
gi|153791443|ref|NP_001093320.1|  ................................................................
gi|310118528|ref|XP_003118894.1|  ................................................................
gi|310118526|ref|XP_001130065.3|  ................................................................
gi|55742693|ref|NP_078922.1|      ................................................................
gi|194306635|ref|NP_001093260.2|  ................................................................
gi|66954681|ref|NP_001019832.1|   ................................................................
gi|59676593|ref|NP_001012277.1|   ................................................................
gi|59676587|ref|NP_001012276.1|   ................................................................
gi|12738831|ref|NP_075389.1|      ................................................................
gi|194306638|ref|NP_001013714.3|  ................................................................
gi|8923179|ref|NP_060173.1|       ................................................................
gi|124249372|ref|NP_001074299.1|  ................................................................
gi|154800493|ref|NP_001094101.1|  ................................................................
gi|29789255|ref|NP_085132.1|      ................................................................
gi|194018550|ref|NP_938204.2|     ................................................................
gi|157426875|ref|NP_079239.3|     yfeildrtregailsgqlmvgqsnvphyqnlrvfyarlapgyinqevvrlylavlsdrtpqnlh
gi|33589814|ref|NP_006327.2|      ................................................................
gi|12738834|ref|NP_075390.1|      ................................................................
gi|341915238|ref|XP_938952.6|     ................................................................
gi|153792140|ref|NP_001093324.1|  ................................................................
gi|16506299|ref|NP_443172.1|      ................................................................
gi|194018546|ref|NP_001034450.2|  ................................................................
gi|226437632|ref|NP_001004339.2|  ................................................................
gi|113865933|ref|NP_001038945.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|157426839|ref|NP_001093321.1|  ................................................................
gi|268832194|ref|NP_001161343.1|  ................................................................
gi|268832172|ref|NP_060505.2|     ................................................................
gi|268830752|ref|NP_001161339.1|  ................................................................
gi|165932385|ref|NP_001107039.1|  ................................................................
gi|134288867|ref|NP_997527.2|     ................................................................
gi|23397500|ref|NP_694962.1|      ................................................................
gi|148922963|ref|NP_036291.2|     ................................................................
gi|16306584|ref|NP_036290.1|      ................................................................
gi|45505155|ref|NP_110420.3|      ................................................................
gi|45545409|ref|NP_995308.1|      ................................................................
gi|22547146|ref|NP_060848.2|      ................................................................
gi|51558774|ref|NP_001003803.1|   ................................................................
gi|289803020|ref|NP_001073879.2|  ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................


                                                                                                    
                                                                                                    
d1a4ya_                             ................................................................
gi|21955154|ref|NP_653288.1|      ................................................................
gi|33519450|ref|NP_789790.2|      ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................
gi|119395764|ref|NP_001073289.1|  ................................................................
gi|34878693|ref|NP_004886.3|      ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|194018482|ref|NP_604393.2|     ................................................................
gi|110624785|ref|NP_789780.2|     ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|291463278|ref|NP_001167553.1|  ................................................................
gi|291463280|ref|NP_001167554.1|  ................................................................
gi|291463275|ref|NP_001167552.1|  ................................................................
gi|8923473|ref|NP_060322.1|       ................................................................
gi|194018484|ref|NP_659444.2|     ................................................................
gi|187937176|ref|NP_001120727.1|  ................................................................
gi|33667040|ref|NP_789781.2|      ................................................................
gi|46049100|ref|NP_631915.2|      ................................................................
gi|113205085|ref|NP_079003.2|     ................................................................
gi|188536116|ref|NP_001120933.1|  ................................................................
gi|338797736|ref|NP_061994.1|     ................................................................
gi|5174617|ref|NP_006083.1|       ................................................................
gi|188536002|ref|NP_001120934.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|15193292|ref|NP_150639.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666780|ref|NP_001166250.1|  ................................................................
gi|75709196|ref|NP_996611.2|      ................................................................
gi|168986655|ref|NP_919263.2|     ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|11545912|ref|NP_071445.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666778|ref|NP_699184.2|     ................................................................
gi|27734755|ref|NP_116264.2|      ................................................................
gi|4506411|ref|NP_002874.1|       ................................................................
gi|284447308|ref|NP_036289.3|     ................................................................
gi|289666782|ref|NP_001166251.1|  ................................................................
gi|74271814|ref|NP_001028225.1|   ................................................................
gi|7662386|ref|NP_055737.1|       ................................................................
gi|14719829|ref|NP_127497.1|      ................................................................
gi|296531375|ref|NP_001171835.1|  ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|308818204|ref|NP_001184224.1|  ................................................................
gi|4557543|ref|NP_001384.1|       ................................................................
gi|21389431|ref|NP_653221.1|      ................................................................
gi|14719835|ref|NP_127500.1|      ................................................................
gi|14719833|ref|NP_127499.1|      ................................................................
gi|34878690|ref|NP_899632.1|      ................................................................
gi|229577123|ref|NP_872345.2|     ................................................................
gi|6912466|ref|NP_036436.1|       ................................................................
gi|156415984|ref|NP_037485.2|     ................................................................
gi|7657647|ref|NP_055363.1|       ................................................................
gi|7657649|ref|NP_055362.1|       ................................................................
gi|289666746|ref|NP_699181.2|     ................................................................
gi|197333692|ref|NP_001127948.1|  ................................................................
gi|21245134|ref|NP_056165.1|      ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|284447314|ref|NP_001165184.1|  ................................................................
gi|260763922|ref|NP_001159588.1|  ................................................................
gi|4507553|ref|NP_003266.1|       ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|187608777|ref|NP_038460.4|     ................................................................
gi|16306595|ref|NP_005974.2|      ................................................................
gi|22748931|ref|NP_689654.1|      ................................................................
gi|150378503|ref|NP_997046.1|     ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|255683361|ref|NP_001156787.2|  ................................................................
gi|61175232|ref|NP_001012992.1|   ................................................................
gi|54607116|ref|NP_938012.2|      ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|21450705|ref|NP_659436.1|      ................................................................
gi|112380630|ref|NP_036266.2|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|19924149|ref|NP_612564.1|      ................................................................
gi|312433960|ref|NP_001186067.1|  ................................................................
gi|312433962|ref|NP_001186068.1|  ................................................................
gi|40788015|ref|NP_067032.3|      ................................................................
gi|16306588|ref|NP_036292.2|      ................................................................
gi|14249170|ref|NP_116026.1|      ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|149274651|ref|NP_115547.1|     ................................................................
gi|149274621|ref|NP_001092272.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|163965441|ref|NP_653303.2|     ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|190194416|ref|NP_077302.3|     ................................................................
gi|21264320|ref|NP_612202.1|      ................................................................
gi|25777608|ref|NP_078894.2|      ................................................................
gi|218931148|ref|NP_001136357.1|  ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|156938336|ref|NP_000237.2|     ................................................................
gi|54112380|ref|NP_001005366.1|   ................................................................
gi|54112382|ref|NP_115979.3|      ................................................................
gi|157168349|ref|NP_001093254.2|  ................................................................
gi|118442828|ref|NP_001072983.1|  ................................................................
gi|4507375|ref|NP_003184.1|       ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|25777610|ref|NP_733840.1|      ................................................................
gi|164663798|ref|NP_001106873.1|  ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|16306580|ref|NP_036440.1|      ................................................................
gi|341916269|ref|XP_003403438.1|  ................................................................
gi|119393876|ref|NP_075043.1|     ................................................................
gi|341916267|ref|XP_003403437.1|  ................................................................
gi|119393878|ref|NP_004527.2|     ................................................................
gi|341916263|ref|XP_003403435.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|16306576|ref|NP_036294.1|      ................................................................
gi|302129689|ref|NP_001180464.1|  ................................................................
gi|302129687|ref|NP_001180463.1|  ................................................................
gi|16306572|ref|NP_036293.1|      ................................................................
gi|341915644|ref|XP_003403561.1|  ................................................................
gi|341913879|ref|XP_003403707.1|  ................................................................
gi|61742136|ref|NP_078831.3|      ................................................................
gi|38569471|ref|NP_006360.3|      ................................................................
gi|16306591|ref|NP_036295.1|      ................................................................
gi|51873034|ref|NP_001004055.1|   ................................................................
gi|341916265|ref|XP_003403436.1|  ................................................................
gi|7661860|ref|NP_055480.1|       ................................................................
gi|122937351|ref|NP_001073947.1|  ................................................................
gi|46249367|ref|NP_996836.1|      ................................................................
gi|46249369|ref|NP_996837.1|      ................................................................
gi|46249371|ref|NP_996838.1|      ................................................................
gi|46249373|ref|NP_996839.1|      ................................................................
gi|5174641|ref|NP_006106.1|       ................................................................
gi|88942379|ref|XP_933494.1|      ................................................................
gi|148356236|ref|NP_001091846.1|  ................................................................
gi|61102721|ref|NP_001010890.1|   ................................................................
gi|153792112|ref|NP_001093322.1|  ................................................................
gi|153945800|ref|NP_001093584.1|  ................................................................
gi|61696142|ref|NP_001013425.1|   ................................................................
gi|226437621|ref|NP_001139816.1|  ................................................................
gi|59958373|ref|NP_001009611.1|   ................................................................
gi|58219004|ref|NP_001010889.1|   ................................................................
gi|153791443|ref|NP_001093320.1|  ................................................................
gi|310118528|ref|XP_003118894.1|  ................................................................
gi|310118526|ref|XP_001130065.3|  ................................................................
gi|55742693|ref|NP_078922.1|      ................................................................
gi|194306635|ref|NP_001093260.2|  ................................................................
gi|66954681|ref|NP_001019832.1|   ................................................................
gi|59676593|ref|NP_001012277.1|   ................................................................
gi|59676587|ref|NP_001012276.1|   ................................................................
gi|12738831|ref|NP_075389.1|      ................................................................
gi|194306638|ref|NP_001013714.3|  ................................................................
gi|8923179|ref|NP_060173.1|       ................................................................
gi|124249372|ref|NP_001074299.1|  ................................................................
gi|154800493|ref|NP_001094101.1|  ................................................................
gi|29789255|ref|NP_085132.1|      ................................................................
gi|194018550|ref|NP_938204.2|     ................................................................
gi|157426875|ref|NP_079239.3|     aflisvpgsfaesgatknlldsmarnvvldalqlpkswlngssllqhmkfnnpfyfsfsrctls
gi|33589814|ref|NP_006327.2|      ................................................................
gi|12738834|ref|NP_075390.1|      ................................................................
gi|341915238|ref|XP_938952.6|     ................................................................
gi|153792140|ref|NP_001093324.1|  ................................................................
gi|16506299|ref|NP_443172.1|      ................................................................
gi|194018546|ref|NP_001034450.2|  ................................................................
gi|226437632|ref|NP_001004339.2|  ................................................................
gi|113865933|ref|NP_001038945.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|157426839|ref|NP_001093321.1|  ................................................................
gi|268832194|ref|NP_001161343.1|  ................................................................
gi|268832172|ref|NP_060505.2|     ................................................................
gi|268830752|ref|NP_001161339.1|  ................................................................
gi|165932385|ref|NP_001107039.1|  ................................................................
gi|134288867|ref|NP_997527.2|     ................................................................
gi|23397500|ref|NP_694962.1|      ................................................................
gi|148922963|ref|NP_036291.2|     ................................................................
gi|16306584|ref|NP_036290.1|      ................................................................
gi|45505155|ref|NP_110420.3|      ................................................................
gi|45545409|ref|NP_995308.1|      ................................................................
gi|22547146|ref|NP_060848.2|      ................................................................
gi|51558774|ref|NP_001003803.1|   ................................................................
gi|289803020|ref|NP_001073879.2|  ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................


                                                140          150                               160  
                                                  |            |                                 |  
d1a4ya_                             .............PQCRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|21955154|ref|NP_653288.1|      .............PNCKLQNLRLK...RC...RIS...............S......SACEDL.
gi|33519450|ref|NP_789790.2|      .............PVCKLRKLIFT...SV...YFG...............H......--DSEL.
gi|28827813|ref|NP_789792.1|      .............PECKLQTLRLE...SC...NLT...............V......FCCLNI.
gi|119395764|ref|NP_001073289.1|  .............PGCNIRRLWLG...RC...GLS...............H......ECCFDI.
gi|34878693|ref|NP_004886.3|      .............PGCNIRRLWLG...RC...GLS...............H......ECCFDI.
gi|158321897|ref|NP_703148.4|     .............PKCLLESLRLD...CC...GLT...............H......ACYLKI.
gi|194018482|ref|NP_604393.2|     .............PSCRLQKLGIN...NV...SFS...............G......QSV-LL.
gi|110624785|ref|NP_789780.2|     .............PRCKVQKLTCK...SV...TPE...............W......-VLQDL.
gi|21361547|ref|NP_002930.2|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42794608|ref|NP_976318.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42822864|ref|NP_976322.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42822866|ref|NP_976323.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42822868|ref|NP_976321.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42822870|ref|NP_976320.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42822872|ref|NP_976317.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|42822874|ref|NP_976319.1|      .............--CRLEKLQLE...YC...SLS...............A......ASCEPL.
gi|291463278|ref|NP_001167553.1|  .............DTCHLQRVVFK...NI...SPA...............D......-AHRNL.
gi|291463280|ref|NP_001167554.1|  .............DTCHLQRVVFK...NI...SPA...............D......-AHRNL.
gi|291463275|ref|NP_001167552.1|  .............DTCHLQRVVFK...NI...SPA...............D......-AHRNL.
gi|8923473|ref|NP_060322.1|       .............DTCHLQRVVFK...NI...SPA...............D......-AHRNL.
gi|194018484|ref|NP_659444.2|     .............SSCKLRTLKLS...YV...STA...............S......-GFEDL.
gi|187937176|ref|NP_001120727.1|  .............STCHLQKVEIK...NV...TPD...............T......-AYRDF.
gi|33667040|ref|NP_789781.2|      .............PQCKLQKLLLRrvnST...MLN...............Q......----DL.
gi|46049100|ref|NP_631915.2|      .............STCHLQKVEIK...NV...TPD...............T......-AYRDF.
gi|113205085|ref|NP_079003.2|     .............-GSKIQMIELV...DC...SLT...............S......EDGTFL.
gi|188536116|ref|NP_001120933.1|  .............-----------...-S...HLT...............S......SFCRGL.
gi|338797736|ref|NP_061994.1|     .............-TSCLQYLDAR...NT...PLL...............D......HSAPFV.
gi|5174617|ref|NP_006083.1|       .............------YLKLT...YC...NAC...............S......ADCSAL.
gi|188536002|ref|NP_001120934.1|  .............-----------...-C...GLS...............H......ECCFDI.
gi|116268109|ref|NP_115582.3|     .............-MTCLQSLRLN...RN...SIG...............D......VGCCHL.
gi|15193292|ref|NP_150639.1|      .............-----QRLWLK...RC...RIS...............S......SACEDL.
gi|118918429|ref|NP_849172.2|     .............-----------...--...---...............-......------.
gi|289666780|ref|NP_001166250.1|  .............-CLYINGLDVG...YN...LLC...............D......VGAYYA.
gi|75709196|ref|NP_996611.2|      .............STCHLQKVEIK...NV...TPD...............T......-AYRDF.
gi|168986655|ref|NP_919263.2|     .............-----------...--...---...............-......-----P.
gi|116268109|ref|NP_115582.3|     .............-CPQLKEVSFR...DN...QLS...............D......QVVLNI.
gi|11545912|ref|NP_071445.1|      .............------HLKLT...FC...SVG...............P......TECAAL.
gi|118918429|ref|NP_849172.2|     .............-----------...--...---...............-......------.
gi|289666778|ref|NP_699184.2|     .............-CLYINGLDVG...YN...LLC...............D......VGAYYA.
gi|27734755|ref|NP_116264.2|      .............-CSKLRHLDLA...SCt..SIT...............N......MSLKAL.
gi|4506411|ref|NP_002874.1|       .............-KSELKRCHWS...DM...FTG...............RlrteipPALISL.
gi|284447308|ref|NP_036289.3|     .............-CSKLKHLDLT...SCv..SIT...............N......SSLKGI.
gi|289666782|ref|NP_001166251.1|  .............-CLYINGLDVG...YN...LLC...............D......VGAYYA.
gi|74271814|ref|NP_001028225.1|   .............PRCLLETLRLA...GC...GLT...............A......EDCKDL.
gi|7662386|ref|NP_055737.1|       .............PRCLLETLRLA...GC...GLT...............A......EDCKDL.
gi|14719829|ref|NP_127497.1|      .............PRCLLETLRLA...GC...GLT...............A......EDCKDL.
gi|296531375|ref|NP_001171835.1|  .............-CRNIEVLNLN...GCt..KTT...............D......------.
gi|226342931|ref|NP_079101.3|     .............EKPALRSVYLH...NN...QLS...............N......AGL--P.
gi|308818204|ref|NP_001184224.1|  .............LPSTLEELKVN...EN...NLQ...............A......ID----.
gi|4557543|ref|NP_001384.1|       .............LPSTLEELKVN...EN...NLQ...............A......ID----.
gi|21389431|ref|NP_653221.1|      .............-----------...--...---...............-......--WKTL.
gi|14719835|ref|NP_127500.1|      .............PRCLLETLRLA...GC...GLT...............A......EDCKDL.
gi|14719833|ref|NP_127499.1|      .............PRCLLETLRLA...GC...GLT...............A......EDCKDL.
gi|34878690|ref|NP_899632.1|      .............-----------...-C...GLS...............H......ECCFDI.
gi|229577123|ref|NP_872345.2|     .............-----------...--...---...............-......------.
gi|6912466|ref|NP_036436.1|       .............-CPELRRLEVS...GCy..NIS...............N......E---AV.
gi|156415984|ref|NP_037485.2|     .............-NRSLQSLNIE...SN...FIS...............S......TGLMAV.
gi|7657647|ref|NP_055363.1|       .............-----------...--...---...............-......------.
gi|7657649|ref|NP_055362.1|       .............-----------...--...---...............-......------.
gi|289666746|ref|NP_699181.2|     .............-SARITSLSVS...DCi..NVA...............D......DAIAAI.
gi|197333692|ref|NP_001127948.1|  .............-LKNLRTLYLK...SSls.R--...............-......-----I.
gi|21245134|ref|NP_056165.1|      .............-LKNLRTLYLK...SSls.R--...............-......-----I.
gi|161333852|ref|NP_659469.3|     .............-LKQLTVLNLA...NCv..RIG...............D......MGLKQF.
gi|284447314|ref|NP_001165184.1|  .............-----------...--...---...............-......------.
gi|260763922|ref|NP_001159588.1|  .............-----------...--...---...............-......------.
gi|4507553|ref|NP_003266.1|       .............-----------...--...---...............-......------.
gi|21361547|ref|NP_002930.2|      .............-----------...--...---...............-......------.
gi|42794608|ref|NP_976318.1|      .............-----------...--...---...............-......------.
gi|42822864|ref|NP_976322.1|      .............-----------...--...---...............-......------.
gi|42822866|ref|NP_976323.1|      .............-----------...--...---...............-......------.
gi|42822868|ref|NP_976321.1|      .............-----------...--...---...............-......------.
gi|42822870|ref|NP_976320.1|      .............-----------...--...---...............-......------.
gi|42822872|ref|NP_976317.1|      .............-----------...--...---...............-......------.
gi|42822874|ref|NP_976319.1|      .............-----------...--...---...............-......------.
gi|62912470|ref|NP_001017403.1|   .............-LGRLQELGFH...NN...NIK...............A......----IP.
gi|38348406|ref|NP_940967.1|      .............GLAELRHLNLA...FN...NLP...............C......-----I.
gi|187608777|ref|NP_038460.4|     .............-MPSLALLDLS...SN...HLG...............P......EGLRQL.
gi|16306595|ref|NP_005974.2|      .............-CSKLQNLSLE...GL...RLS...............D......----PI.
gi|22748931|ref|NP_689654.1|      .............-LKGLEVLELG...GCs..NIT...............N......TGLLLI.
gi|150378503|ref|NP_997046.1|     .............-----------...--...---...............-......------.
gi|4504379|ref|NP_003658.1|       .............-LSNLKELGFH...SN...NIR...............S......----IP.
gi|255683361|ref|NP_001156787.2|  .............-CRELKDIHFG...QCy..KIS...............D......EGMIVI.
gi|61175232|ref|NP_001012992.1|   .............-----------...--...---...............-......------.
gi|54607116|ref|NP_938012.2|      .............-----------...--...---...............-......------.
gi|20302168|ref|NP_619542.1|      .............-PESLTELSLI...QNniyNIT...............K......EGISRLi
gi|21450705|ref|NP_659436.1|      .............-----------...--...---...............-......------.
gi|112380630|ref|NP_036266.2|     .............-----------...--...---...............-......------.
gi|291190783|ref|NP_001167448.1|  .............-----------...--...---...............-......------.
gi|291190781|ref|NP_060110.4|     .............-----------...--...---...............-......------.
gi|66392157|ref|NP_001013860.1|   .............-----------...--...---...............-......------.
gi|19924149|ref|NP_612564.1|      .............HLKTLKELNVA...HN...LIQ...............S......---FKL.
gi|312433960|ref|NP_001186067.1|  .............-CKNIYSLMVE...AS...PLT...............I......EDERHI.
gi|312433962|ref|NP_001186068.1|  .............-CKNIYSLMVE...AS...PLT...............I......EDERHI.
gi|40788015|ref|NP_067032.3|      .............-CKNIYSLMVE...AS...PLT...............I......EDERHI.
gi|16306588|ref|NP_036292.2|      .............-LCSLKRLVLY...RT...KVE...............Q......------.
gi|14249170|ref|NP_116026.1|      .............-----------...--...---...............-......------.
gi|156938257|ref|NP_612369.3|     .............-----------...--...---...............-......------.
gi|161333854|ref|NP_001104508.1|  .............-ACKLRKIRFE...GNk..RVT...............D......ASFKFI.
gi|19718734|ref|NP_003255.2|      .............PLSSLTFLNLL...GN...PYK...............T......LGETSL.
gi|149274651|ref|NP_115547.1|     .............-----------...--...---...............-......------.
gi|149274621|ref|NP_001092272.1|  .............-----------...--...---...............-......------.
gi|291190781|ref|NP_060110.4|     .............LPKGLKHLNLS...KT...SLS...............P......KGVNSL.
gi|291190783|ref|NP_001167448.1|  .............LPKGLKHLNLS...KT...SLS...............P......KGVNSL.
gi|163965441|ref|NP_653303.2|     .............-----------...--...---...............-......------.
gi|161333852|ref|NP_659469.3|     .............-CRNLQELNVS...DCp..TFT...............D......ESMRHI.
gi|190194416|ref|NP_077302.3|     .............-----------...--...---...............-......------.
gi|21264320|ref|NP_612202.1|      .............PQCRVQTVRVQ...LP...DPQ...............R......-GLQYL.
gi|25777608|ref|NP_078894.2|      .............-----------...--...---...............-......------.
gi|218931148|ref|NP_001136357.1|  .............-----------...--...---...............-......------.
gi|156938257|ref|NP_612369.3|     .............FPSGLTKLCLA...KT...AIS...............P......RGLQAL.
gi|156938336|ref|NP_000237.2|     .............---------FL...GT...RLT...............P......PDAHVL.
gi|54112380|ref|NP_001005366.1|   .............SCPLLRTLDVQ...WVe..GLK...............D......AQMRDL.
gi|54112382|ref|NP_115979.3|      .............SCPLLRTLDVQ...WVe..GLK...............D......AQMRDL.
gi|157168349|ref|NP_001093254.2|  .............----LQELVLS...GC...SWL...............S......--VSAL.
gi|118442828|ref|NP_001072983.1|  .............-LSKLQEVSLR...NC...AVS...............C......AGEK--.
gi|4507375|ref|NP_003184.1|       .............-LSKLQEVSLR...NC...AVS...............C......AGEK--.
gi|116268109|ref|NP_115582.3|     .............-CPGPLELQLS...CE...FLS...............D......QSLETL.
gi|25777610|ref|NP_733840.1|      .............-----------...--...---...............-......------.
gi|164663798|ref|NP_001106873.1|  .............-----------...--...---...............-......------.
gi|66392157|ref|NP_001013860.1|   .............CPGALRRLSLA...QT...GLT...............P......RGMRAL.
gi|161333854|ref|NP_001104508.1|  .............-CRNLQELNVS...DCp..TFT...............D......ESMRHI.
gi|16306580|ref|NP_036440.1|      .............-KRQPVSLDLS...WT...NIS...............K......KQLTWL.
gi|341916269|ref|XP_003403438.1|  .............-FHHMEKLLIQ...ISa..EYD...............P......---SKL.
gi|119393876|ref|NP_075043.1|     .............-FHHMEKLLIQ...ISa..EYD...............P......---SKL.
gi|341916267|ref|XP_003403437.1|  .............-FHHMEKLLIQ...ISa..EYD...............P......---SKL.
gi|119393878|ref|NP_004527.2|     .............-FHHMEKLLIQ...ISa..EYD...............P......---SKL.
gi|341916263|ref|XP_003403435.1|  .............-FHHMEKLLIQ...ISa..EYD...............P......---SKL.
gi|40255157|ref|NP_700356.2|      .............-----------...--...---...............-......------.
gi|16306576|ref|NP_036294.1|      .............AGSRMRKLWLT...YS...SQT...............T......AILGAL.
gi|302129689|ref|NP_001180464.1|  .............------TLVLA...YSs..AVS...............S......---KMV.
gi|302129687|ref|NP_001180463.1|  .............------TLVLA...YSs..AVS...............S......---KMV.
gi|16306572|ref|NP_036293.1|      .............------TLVLA...YSs..AVS...............S......---KMV.
gi|341915644|ref|XP_003403561.1|  .............-----------...--...---...............-......------.
gi|341913879|ref|XP_003403707.1|  .............-----------...--...---...............-......------.
gi|61742136|ref|NP_078831.3|      .............AGSRMRKLWLT...YS...SQT...............T......AILGAL.
gi|38569471|ref|NP_006360.3|      .............-----------...--...---...............-......------.
gi|16306591|ref|NP_036295.1|      .............-----------...--...---...............-......------.
gi|51873034|ref|NP_001004055.1|   .............-----------...--...---...............-......------.
gi|341916265|ref|XP_003403436.1|  .............-----------...--...---...............-......------.
gi|7661860|ref|NP_055480.1|       .............LQSPLESLELA...FC...ALL...............P......EDLRFL.
gi|122937351|ref|NP_001073947.1|  .............-QTPLRVLDLA...NC...ALN...............H......TDMAFL.
gi|46249367|ref|NP_996836.1|      .............VMNPLETLSIT...NC...RLS...............E......GDVMHL.
gi|46249369|ref|NP_996837.1|      .............VMNPLETLSIT...NC...RLS...............E......GDVMHL.
gi|46249371|ref|NP_996838.1|      .............VMNPLETLSIT...NC...RLS...............E......GDVMHL.
gi|46249373|ref|NP_996839.1|      .............VMNPLETLSIT...NC...RLS...............E......GDVMHL.
gi|5174641|ref|NP_006106.1|       .............VMNPLETLSIT...NC...RLS...............E......GDVMHL.
gi|88942379|ref|XP_933494.1|      .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|148356236|ref|NP_001091846.1|  .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|61102721|ref|NP_001010890.1|   .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|153792112|ref|NP_001093322.1|  .............LKTSLNILAIT...NC...VLL...............E......SDLKHL.
gi|153945800|ref|NP_001093584.1|  .............LKTSLNILAIT...NC...VLL...............E......SDLKHL.
gi|61696142|ref|NP_001013425.1|   .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|226437621|ref|NP_001139816.1|  .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|59958373|ref|NP_001009611.1|   .............LKTSLKFLTIT...NC...VLL...............E......SDLKHL.
gi|58219004|ref|NP_001010889.1|   .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|153791443|ref|NP_001093320.1|  .............LKSPLETLALT...YG...SLD...............E......EDLKCL.
gi|310118528|ref|XP_003118894.1|  .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|310118526|ref|XP_001130065.3|  .............LKTSLKVLTIT...NC...VLL...............E......SDLKHL.
gi|55742693|ref|NP_078922.1|      .............-----------...--...---...............-......------.
gi|194306635|ref|NP_001093260.2|  .............LKSPLETLALT...YG...SLD...............E......EDLKCL.
gi|66954681|ref|NP_001019832.1|   .............-QNPLENLELT...YG...YLL...............E......EDMKCL.
gi|59676593|ref|NP_001012277.1|   .............LQASLEMVVMT...DC...LLS...............E......SDLKHL.
gi|59676587|ref|NP_001012276.1|   .............LQASLEMVVMT...DC...LLS...............E......SDLKHL.
gi|12738831|ref|NP_075389.1|      .............-QNPLENLELT...YG...YLL...............E......EDMKCL.
gi|194306638|ref|NP_001013714.3|  .............LRSPLETLALT...YG...FLE...............K......VDLKCL.
gi|8923179|ref|NP_060173.1|       .............-----------...--...---...............-......----AL.
gi|124249372|ref|NP_001074299.1|  .............LQAPLETVVMT...EC...LLS...............E......SDLKHL.
gi|154800493|ref|NP_001094101.1|  .............LRSPLETLALT...YG...FLE...............K......VDLKCL.
gi|29789255|ref|NP_085132.1|      .............-MVEILCLMLE...YN...IID...............N......------.
gi|194018550|ref|NP_938204.2|     .............-MVEILCLMLE...YN...IID...............N......------.
gi|157426875|ref|NP_079239.3|     gghliqqvinggkDLRSL------...--...---...............-......------.
gi|33589814|ref|NP_006327.2|      .............-SHTLVSLSLF...GCt..NIFyeeenpggcedeylvN......PTCQVLv
gi|12738834|ref|NP_075390.1|      .............-QNPLENLELT...CG...NLL...............E......EDLKCL.
gi|341915238|ref|XP_938952.6|     .............--SAICELFLD...GN...YLE...............C......SGALAL.
gi|153792140|ref|NP_001093324.1|  .............-QNPLENLELT...YG...YLL...............E......EDMKCL.
gi|16506299|ref|NP_443172.1|      .............-----------...--...---...............-......------.
gi|194018546|ref|NP_001034450.2|  .............LKNPLGAFIFS...DA...YLT...............D......RDMECL.
gi|226437632|ref|NP_001004339.2|  .............-----------...--...---...............-......------.
gi|113865933|ref|NP_001038945.1|  .............LKNPLGTFIFC...HA...YLA...............D......QDMECL.
gi|116268109|ref|NP_115582.3|     .............-----------...--...---...............-......------.
gi|157426839|ref|NP_001093321.1|  .............LKNPLGTFIFC...HA...YLA...............D......QDMECL.
gi|268832194|ref|NP_001161343.1|  .............-----------...--...---...............-......------.
gi|268832172|ref|NP_060505.2|     .............-----------...--...---...............-......------.
gi|268830752|ref|NP_001161339.1|  .............-----------...--...---...............-......------.
gi|165932385|ref|NP_001107039.1|  .............-----------...--...---...............-......------.
gi|134288867|ref|NP_997527.2|     .............-----------...--...---...............-......------.
gi|23397500|ref|NP_694962.1|      .............SNNRLKSLSIQ...YL...ELD...............R......------.
gi|148922963|ref|NP_036291.2|     .............-----------...--...---...............-......----AL.
gi|16306584|ref|NP_036290.1|      .............-----------...--...---...............-......------.
gi|45505155|ref|NP_110420.3|      .............-CISLRTFVMR...NCag.PTN...............S......LKYVPL.
gi|45545409|ref|NP_995308.1|      .............-CISLRTFVMR...NCag.PTN...............S......LKYVPL.
gi|22547146|ref|NP_060848.2|      .............---QLRHLDLR...RL...SFT...............L......DDA-LV.
gi|51558774|ref|NP_001003803.1|   .............-----------...--...---...............-......------.
gi|289803020|ref|NP_001073879.2|  .............-CRALQAVTYR...SAtd.PVG...............H......EVIWAL.
gi|158321897|ref|NP_703148.4|     .............PTCKIQTLMFR...NA...QIT...............P......-GVQHL.
gi|28827813|ref|NP_789792.1|      .............PNCKLQKLLLK...FI...TFP...............D......-GCQDI.


                                                                        170                         
                                                                          |                         
d1a4ya_                             .......................ASVL...RAKP....DF........................
gi|21955154|ref|NP_653288.1|      .......................SAAL...IANK....NL........................
gi|33519450|ref|NP_789790.2|      .......................FKAV...LHNP....HL........................
gi|28827813|ref|NP_789792.1|      .......................SNAL...IRSQ....SL........................
gi|119395764|ref|NP_001073289.1|  .......................SLVL...SSNQ....KL........................
gi|34878693|ref|NP_004886.3|      .......................SLVL...SSNQ....KL........................
gi|158321897|ref|NP_703148.4|     .......................SQIL...TTSP....SL........................
gi|194018482|ref|NP_604393.2|     .......................FEVL...FYQP....DL........................
gi|110624785|ref|NP_789780.2|     .......................IIAL...QGNS....KL........................
gi|21361547|ref|NP_002930.2|      .......................ASVL...RAKP....DF........................
gi|42794608|ref|NP_976318.1|      .......................ASVL...RAKP....DF........................
gi|42822864|ref|NP_976322.1|      .......................ASVL...RAKP....DF........................
gi|42822866|ref|NP_976323.1|      .......................ASVL...RAKP....DF........................
gi|42822868|ref|NP_976321.1|      .......................ASVL...RAKP....DF........................
gi|42822870|ref|NP_976320.1|      .......................ASVL...RAKP....DF........................
gi|42822872|ref|NP_976317.1|      .......................ASVL...RAKP....DF........................
gi|42822874|ref|NP_976319.1|      .......................ASVL...RAKP....DF........................
gi|291463278|ref|NP_001167553.1|  .......................CLAL...RGHK....TV........................
gi|291463280|ref|NP_001167554.1|  .......................CLAL...RGHK....TV........................
gi|291463275|ref|NP_001167552.1|  .......................CLAL...RGHK....TV........................
gi|8923473|ref|NP_060322.1|       .......................CLAL...RGHK....TV........................
gi|194018484|ref|NP_659444.2|     .......................LKAL...ARNR....SL........................
gi|187937176|ref|NP_001120727.1|  .......................CLAF...IGKK....TL........................
gi|33667040|ref|NP_789781.2|      .......................IGVL...TGNQ....HL........................
gi|46049100|ref|NP_631915.2|      .......................CLAF...IGKK....TL........................
gi|113205085|ref|NP_079003.2|     .......................GQLL...PMLQ....SL........................
gi|188536116|ref|NP_001120933.1|  .......................FSVL...STSQ....SL........................
gi|338797736|ref|NP_061994.1|     .......................ARAL...RIRS....SL........................
gi|5174617|ref|NP_006083.1|       .......................SFVL...HHFP....KR........................
gi|188536002|ref|NP_001120934.1|  .......................SLVL...SSNQ....KL........................
gi|116268109|ref|NP_115582.3|     .......................SEAL...RAAT....SL........................
gi|15193292|ref|NP_150639.1|      .......................SAAL...IANK....NL........................
gi|118918429|ref|NP_849172.2|     .......................-SLL...PQLL....YC........................
gi|289666780|ref|NP_001166250.1|  .......................AKLL...QKQL....NL........................
gi|75709196|ref|NP_996611.2|      .......................CLAF...IGKK....TL........................
gi|168986655|ref|NP_919263.2|     .......................VSYF...IRNM....EE........................
gi|116268109|ref|NP_115582.3|     .......................VEVL...PHLP....RL........................
gi|11545912|ref|NP_071445.1|      .......................AFVL...QHLR....RP........................
gi|118918429|ref|NP_849172.2|     .......................----...----....--........................
gi|289666778|ref|NP_699184.2|     .......................AKLL...QKQL....NL........................
gi|27734755|ref|NP_116264.2|      .......................SE--...-GCP....LL........................
gi|4506411|ref|NP_002874.1|       .......................GEGL...ITAGa...QL........................
gi|284447308|ref|NP_036289.3|     .......................SE--...-GCR....NL........................
gi|289666782|ref|NP_001166251.1|  .......................AKLL...QKQL....NL........................
gi|74271814|ref|NP_001028225.1|   .......................AFGL...RANQ....TL........................
gi|7662386|ref|NP_055737.1|       .......................AFGL...RANQ....TL........................
gi|14719829|ref|NP_127497.1|      .......................AFGL...RANQ....TL........................
gi|296531375|ref|NP_001171835.1|  .......................---A...EGCP....LL........................
gi|226342931|ref|NP_079101.3|     .......................PDAF...RGSE....AI........................
gi|308818204|ref|NP_001184224.1|  .......................EESL...SDLN....QL........................
gi|4557543|ref|NP_001384.1|       .......................EESL...SDLN....QL........................
gi|21389431|ref|NP_653221.1|      .......................PSSL...LKLN....QL........................
gi|14719835|ref|NP_127500.1|      .......................AFGL...RANQ....TL........................
gi|14719833|ref|NP_127499.1|      .......................AFGL...RANQ....TL........................
gi|34878690|ref|NP_899632.1|      .......................SLVL...SSNQ....KL........................
gi|229577123|ref|NP_872345.2|     .......................---V...AGLS....HL........................
gi|6912466|ref|NP_036436.1|       .......................FDVV...SLCP....NL........................
gi|156415984|ref|NP_037485.2|     .......................LKAV...RENA....TL........................
gi|7657647|ref|NP_055363.1|       .......................----...----....--........................
gi|7657649|ref|NP_055362.1|       .......................----...----....--........................
gi|289666746|ref|NP_699181.2|     .......................SQ--...-LLP....NL........................
gi|197333692|ref|NP_001127948.1|  .......................PQVVt..DLLP....SL........................
gi|21245134|ref|NP_056165.1|      .......................PQVVt..DLLP....SL........................
gi|161333852|ref|NP_659469.3|     .......................LDGP...-ASM....RI........................
gi|284447314|ref|NP_001165184.1|  .......................----...--LK....HI........................
gi|260763922|ref|NP_001159588.1|  .......................----...----....--........................
gi|4507553|ref|NP_003266.1|       .......................----...----....--........................
gi|21361547|ref|NP_002930.2|      .......................----...----....--........................
gi|42794608|ref|NP_976318.1|      .......................----...----....--........................
gi|42822864|ref|NP_976322.1|      .......................----...----....--........................
gi|42822866|ref|NP_976323.1|      .......................----...----....--........................
gi|42822868|ref|NP_976321.1|      .......................----...----....--........................
gi|42822870|ref|NP_976320.1|      .......................----...----....--........................
gi|42822872|ref|NP_976317.1|      .......................----...----....--........................
gi|42822874|ref|NP_976319.1|      .......................----...----....--........................
gi|62912470|ref|NP_001017403.1|   .......................EKAF...MGNP....LL........................
gi|38348406|ref|NP_940967.1|      .......................VD--...FGLT....RL........................
gi|187608777|ref|NP_038460.4|     .......................AMGLpgqATLQ....SL........................
gi|16306595|ref|NP_005974.2|      .......................VNTL...AKNS....NL........................
gi|22748931|ref|NP_689654.1|      .......................AW--...-GLQ....RL........................
gi|150378503|ref|NP_997046.1|     .......................----...----....--........................
gi|4504379|ref|NP_003658.1|       .......................EKAF...VGNP....SL........................
gi|255683361|ref|NP_001156787.2|  .......................AK--...----....--........................
gi|61175232|ref|NP_001012992.1|   .......................----...----....--........................
gi|54607116|ref|NP_938012.2|      .......................----...----....--........................
gi|20302168|ref|NP_619542.1|      nlknlylawncyfnkvcektnieDGVF...ETLT....NL........................
gi|21450705|ref|NP_659436.1|      .......................----...----....--........................
gi|112380630|ref|NP_036266.2|     .......................----...----....--........................
gi|291190783|ref|NP_001167448.1|  .......................----...----....YL........................
gi|291190781|ref|NP_060110.4|     .......................----...----....YL........................
gi|66392157|ref|NP_001013860.1|   .......................----...-CCT....SL........................
gi|19924149|ref|NP_612564.1|      .......................PEYF...SNLT....NL........................
gi|312433960|ref|NP_001186067.1|  .......................TS--...--VT....NL........................
gi|312433962|ref|NP_001186068.1|  .......................TS--...--VT....NL........................
gi|40788015|ref|NP_067032.3|      .......................TS--...--VT....NL........................
gi|16306588|ref|NP_036292.2|      .......................----...----....--........................
gi|14249170|ref|NP_116026.1|      .......................----...----....--........................
gi|156938257|ref|NP_612369.3|     .......................----...-CCS....HL........................
gi|161333854|ref|NP_001104508.1|  .......................DK--...-NYP....NL........................
gi|19718734|ref|NP_003255.2|      .......................FSHL...TKLQ....ILrvgnmdtftkiqrkdfagltflee
gi|149274651|ref|NP_115547.1|     .......................----...----....--........................
gi|149274621|ref|NP_001092272.1|  .......................----...----....--........................
gi|291190781|ref|NP_060110.4|     .......................SQSL...SANPltasTL........................
gi|291190783|ref|NP_001167448.1|  .......................SQSL...SANPltasTL........................
gi|163965441|ref|NP_653303.2|     .......................----...----....SV........................
gi|161333852|ref|NP_659469.3|     .......................SE--...-GCP....GV........................
gi|190194416|ref|NP_077302.3|     .......................----...----....--........................
gi|21264320|ref|NP_612202.1|      .......................VGML...RQSP....AL........................
gi|25777608|ref|NP_078894.2|      .......................----...--LS....SL........................
gi|218931148|ref|NP_001136357.1|  .......................----...----....--........................
gi|156938257|ref|NP_612369.3|     .......................GQTF...GANPafasSL........................
gi|156938336|ref|NP_000237.2|     .......................GKAL...EAAG....QD........................
gi|54112380|ref|NP_001005366.1|   .......................LSP-...----....--........................
gi|54112382|ref|NP_115979.3|      .......................LSP-...----....--........................
gi|157168349|ref|NP_001093254.2|  .......................GS--...APLP....AL........................
gi|118442828|ref|NP_001072983.1|  .......................GGVA...EACP....NI........................
gi|4507375|ref|NP_003184.1|       .......................GGVA...EACP....NI........................
gi|116268109|ref|NP_115582.3|     .......................LDCL...PQLP....QL........................
gi|25777610|ref|NP_733840.1|      .......................----...--LS....SL........................
gi|164663798|ref|NP_001106873.1|  .......................----...----....--........................
gi|66392157|ref|NP_001013860.1|   .......................GRAL...ATNAafdsTL........................
gi|161333854|ref|NP_001104508.1|  .......................SE--...-GCP....GV........................
gi|16306580|ref|NP_036440.1|      .......................VN--...-RLP....GL........................
gi|341916269|ref|XP_003403438.1|  .......................VKLI...QNSP....NL........................
gi|119393876|ref|NP_075043.1|     .......................VKLI...QNSP....NL........................
gi|341916267|ref|XP_003403437.1|  .......................VKLI...QNSP....NL........................
gi|119393878|ref|NP_004527.2|     .......................VKLI...QNSP....NL........................
gi|341916263|ref|XP_003403435.1|  .......................VKLI...QNSP....NL........................
gi|40255157|ref|NP_700356.2|      .......................----...----....-V........................
gi|16306576|ref|NP_036294.1|      .......................---Lg..SCCP....QL........................
gi|302129689|ref|NP_001180464.1|  .......................RQIL...ELCP....NL........................
gi|302129687|ref|NP_001180463.1|  .......................RQIL...ELCP....NL........................
gi|16306572|ref|NP_036293.1|      .......................RQIL...ELCP....NL........................
gi|341915644|ref|XP_003403561.1|  .......................----...----....--........................
gi|341913879|ref|XP_003403707.1|  .......................----...----....--........................
gi|61742136|ref|NP_078831.3|      .......................---Lg..SCCP....QL........................
gi|38569471|ref|NP_006360.3|      .......................-RAL...SGQAgc..RL........................
gi|16306591|ref|NP_036295.1|      .......................----...----....--........................
gi|51873034|ref|NP_001004055.1|   .......................----...----....--........................
gi|341916265|ref|XP_003403436.1|  .......................VKLI...QNSP....NL........................
gi|7661860|ref|NP_055480.1|       .......................ARS-...PHAA....HL........................
gi|122937351|ref|NP_001073947.1|  .......................AD-C...AHAA....HL........................
gi|46249367|ref|NP_996836.1|      .......................SQS-...PSVS....QL........................
gi|46249369|ref|NP_996837.1|      .......................SQS-...PSVS....QL........................
gi|46249371|ref|NP_996838.1|      .......................SQS-...PSVS....QL........................
gi|46249373|ref|NP_996839.1|      .......................SQS-...PSVS....QL........................
gi|5174641|ref|NP_006106.1|       .......................SQS-...PSVS....QL........................
gi|88942379|ref|XP_933494.1|      .......................SQ--...--CPsis.QL........................
gi|148356236|ref|NP_001091846.1|  .......................SQ--...--CPsis.QL........................
gi|61102721|ref|NP_001010890.1|   .......................SQ--...--CPsis.QL........................
gi|153792112|ref|NP_001093322.1|  .......................SKY-...PSIG....QL........................
gi|153945800|ref|NP_001093584.1|  .......................SKY-...PSIG....QL........................
gi|61696142|ref|NP_001013425.1|   .......................SQ--...--CPsis.QL........................
gi|226437621|ref|NP_001139816.1|  .......................SQ--...--CPsis.QL........................
gi|59958373|ref|NP_001009611.1|   .......................SQ--...--CPsis.QL........................
gi|58219004|ref|NP_001010889.1|   .......................SQ--...--CPsis.QL........................
gi|153791443|ref|NP_001093320.1|  .......................PWY-...PSLS....QL........................
gi|310118528|ref|XP_003118894.1|  .......................SQ--...--CPsis.QL........................
gi|310118526|ref|XP_001130065.3|  .......................SQ--...--CPsis.QL........................
gi|55742693|ref|NP_078922.1|      .......................----...----....--........................
gi|194306635|ref|NP_001093260.2|  .......................PWY-...PSLS....QL........................
gi|66954681|ref|NP_001019832.1|   .......................SQY-...PSLG....YL........................
gi|59676593|ref|NP_001012277.1|   .......................SW--...--CPsir.QL........................
gi|59676587|ref|NP_001012276.1|   .......................SW--...--CPsir.QL........................
gi|12738831|ref|NP_075389.1|      .......................SQY-...PSLG....YL........................
gi|194306638|ref|NP_001013714.3|  .......................PRY-...PSLS....QL........................
gi|8923179|ref|NP_060173.1|       .......................GQ--...-KCP....NL........................
gi|124249372|ref|NP_001074299.1|  .......................SW--...--CPsir.QL........................
gi|154800493|ref|NP_001094101.1|  .......................PRY-...PSLS....QL........................
gi|29789255|ref|NP_085132.1|      .......................----...-NDT....QL........................
gi|194018550|ref|NP_938204.2|     .......................----...-NDT....QL........................
gi|157426875|ref|NP_079239.3|     .......................----...----....--........................
gi|33589814|ref|NP_006327.2|      ......................kDFTF...EGFS....RL........................
gi|12738834|ref|NP_075390.1|      .......................SQ-F...PSLG....YL........................
gi|341915238|ref|XP_938952.6|     .......................----...----....--........................
gi|153792140|ref|NP_001093324.1|  .......................SQY-...PSLG....YL........................
gi|16506299|ref|NP_443172.1|      .......................----...----....--........................
gi|194018546|ref|NP_001034450.2|  .......................SQY-...PSLS....QL........................
gi|226437632|ref|NP_001004339.2|  .......................----...----....--........................
gi|113865933|ref|NP_001038945.1|  .......................SQY-...PSLS....QL........................
gi|116268109|ref|NP_115582.3|     .......................----...----....--........................
gi|157426839|ref|NP_001093321.1|  .......................SQY-...PSLS....QL........................
gi|268832194|ref|NP_001161343.1|  .......................----...----....--........................
gi|268832172|ref|NP_060505.2|     .......................----...----....--........................
gi|268830752|ref|NP_001161339.1|  .......................----...----....--........................
gi|165932385|ref|NP_001107039.1|  .......................---P...SKFP....NV........................
gi|134288867|ref|NP_997527.2|     .......................----...----....--........................
gi|23397500|ref|NP_694962.1|      .......................----...----....--........................
gi|148922963|ref|NP_036291.2|     .......................TVVF...INSK....SL........................
gi|16306584|ref|NP_036290.1|      .......................----...----....--........................
gi|45505155|ref|NP_110420.3|      .......................VTGL...ASAR....NL........................
gi|45545409|ref|NP_995308.1|      .......................VTGL...ASAR....NL........................
gi|22547146|ref|NP_060848.2|      .......................LQAA...RSCP....EL........................
gi|51558774|ref|NP_001003803.1|   .......................----...----....--........................
gi|289803020|ref|NP_001073879.2|  .......................GAGC...REIV....SL........................
gi|158321897|ref|NP_703148.4|     .......................WRIV...MANR....NL........................
gi|28827813|ref|NP_789792.1|      .......................STSL...IHNK....NL........................


                                                                                                    
                                                                                                    
d1a4ya_                             ..............................................KEL.TV...........S
gi|21955154|ref|NP_653288.1|      ..............................................TRM.DL...........S
gi|33519450|ref|NP_789790.2|      ..............................................KLL.SL...........Y
gi|28827813|ref|NP_789792.1|      ..............................................IFL.NL...........S
gi|119395764|ref|NP_001073289.1|  ..............................................VEL.DL...........S
gi|34878693|ref|NP_004886.3|      ..............................................VEL.DL...........S
gi|158321897|ref|NP_703148.4|     ..............................................KSL.SL...........A
gi|194018482|ref|NP_604393.2|     ..............................................KYL.SF...........T
gi|110624785|ref|NP_789780.2|     ..............................................THL.NF...........S
gi|21361547|ref|NP_002930.2|      ..............................................KEL.TV...........S
gi|42794608|ref|NP_976318.1|      ..............................................KEL.TV...........S
gi|42822864|ref|NP_976322.1|      ..............................................KEL.TV...........S
gi|42822866|ref|NP_976323.1|      ..............................................KEL.TV...........S
gi|42822868|ref|NP_976321.1|      ..............................................KEL.TV...........S
gi|42822870|ref|NP_976320.1|      ..............................................KEL.TV...........S
gi|42822872|ref|NP_976317.1|      ..............................................KEL.TV...........S
gi|42822874|ref|NP_976319.1|      ..............................................KEL.TV...........S
gi|291463278|ref|NP_001167553.1|  ..............................................TYL.TL...........Q
gi|291463280|ref|NP_001167554.1|  ..............................................TYL.TL...........Q
gi|291463275|ref|NP_001167552.1|  ..............................................TYL.TL...........Q
gi|8923473|ref|NP_060322.1|       ..............................................TYL.TL...........Q
gi|194018484|ref|NP_659444.2|     ..............................................TYL.SI...........N
gi|187937176|ref|NP_001120727.1|  ..............................................THL.TL...........A
gi|33667040|ref|NP_789781.2|      ..............................................RYL.EI...........Q
gi|46049100|ref|NP_631915.2|      ..............................................THL.TL...........A
gi|113205085|ref|NP_079003.2|     ..............................................EVL.DL...........S
gi|188536116|ref|NP_001120933.1|  ..............................................TEL.DL...........S
gi|338797736|ref|NP_061994.1|     ..............................................AVL.HL...........E
gi|5174617|ref|NP_006083.1|       ..............................................LAL.DL...........D
gi|188536002|ref|NP_001120934.1|  ..............................................VEL.DL...........S
gi|116268109|ref|NP_115582.3|     ..............................................EEL.DL...........S
gi|15193292|ref|NP_150639.1|      ..............................................TRM.DL...........S
gi|118918429|ref|NP_849172.2|     ..............................................RKL.RL...........D
gi|289666780|ref|NP_001166250.1|  ..............................................IYL.NL...........M
gi|75709196|ref|NP_996611.2|      ..............................................THL.TL...........A
gi|168986655|ref|NP_919263.2|     ..............................................SYV.NL...........N
gi|116268109|ref|NP_115582.3|     ..............................................RKL.DL...........S
gi|11545912|ref|NP_071445.1|      ..............................................VAL.QL...........D
gi|118918429|ref|NP_849172.2|     ..............................................---.--...........-
gi|289666778|ref|NP_699184.2|     ..............................................IYL.NL...........M
gi|27734755|ref|NP_116264.2|      ..............................................EQL.NI...........S
gi|4506411|ref|NP_002874.1|       ..............................................VEL.DL...........S
gi|284447308|ref|NP_036289.3|     ..............................................EYL.NL...........S
gi|289666782|ref|NP_001166251.1|  ..............................................IYL.NL...........M
gi|74271814|ref|NP_001028225.1|   ..............................................TEL.DL...........S
gi|7662386|ref|NP_055737.1|       ..............................................TEL.DL...........S
gi|14719829|ref|NP_127497.1|      ..............................................TEL.DL...........S
gi|296531375|ref|NP_001171835.1|  ..............................................EQL.NI...........S
gi|226342931|ref|NP_079101.3|     ..............................................ATL.SL...........S
gi|308818204|ref|NP_001184224.1|  ..............................................VTL.EL...........E
gi|4557543|ref|NP_001384.1|       ..............................................VTL.EL...........E
gi|21389431|ref|NP_653221.1|      ..............................................---.--...........Q
gi|14719835|ref|NP_127500.1|      ..............................................TEL.DL...........S
gi|14719833|ref|NP_127499.1|      ..............................................TEL.DL...........S
gi|34878690|ref|NP_899632.1|      ..............................................VEL.DL...........S
gi|229577123|ref|NP_872345.2|     ..............................................EEL.DLvydvkdcgmnfE
gi|6912466|ref|NP_036436.1|       ..............................................EHL.DV...........S
gi|156415984|ref|NP_037485.2|     ..............................................TEL.RV...........D
gi|7657647|ref|NP_055363.1|       ..............................................---.--...........-
gi|7657649|ref|NP_055362.1|       ..............................................---.--...........-
gi|289666746|ref|NP_699181.2|     ..............................................AEL.SL...........Q
gi|197333692|ref|NP_001127948.1|  ..............................................QKL.SL...........D
gi|21245134|ref|NP_056165.1|      ..............................................QKL.SL...........D
gi|161333852|ref|NP_659469.3|     ..............................................REL.NL...........S
gi|284447314|ref|NP_001165184.1|  ..............................................Q--.--...........-
gi|260763922|ref|NP_001159588.1|  ..............................................---.--...........-
gi|4507553|ref|NP_003266.1|       ..............................................---.--...........-
gi|21361547|ref|NP_002930.2|      ..............................................QSL.DI...........Q
gi|42794608|ref|NP_976318.1|      ..............................................QSL.DI...........Q
gi|42822864|ref|NP_976322.1|      ..............................................QSL.DI...........Q
gi|42822866|ref|NP_976323.1|      ..............................................QSL.DI...........Q
gi|42822868|ref|NP_976321.1|      ..............................................QSL.DI...........Q
gi|42822870|ref|NP_976320.1|      ..............................................QSL.DI...........Q
gi|42822872|ref|NP_976317.1|      ..............................................QSL.DI...........Q
gi|42822874|ref|NP_976319.1|      ..............................................QSL.DI...........Q
gi|62912470|ref|NP_001017403.1|   ..............................................QTI.HF...........Y
gi|38348406|ref|NP_940967.1|      ..............................................RVL.NV...........S
gi|187608777|ref|NP_038460.4|     ..............................................EEL.DL...........S
gi|16306595|ref|NP_005974.2|      ..............................................VRL.NL...........S
gi|22748931|ref|NP_689654.1|      ..............................................KSL.NL...........R
gi|150378503|ref|NP_997046.1|     ..............................................---.--...........-
gi|4504379|ref|NP_003658.1|       ..............................................ITI.HF...........Y
gi|255683361|ref|NP_001156787.2|  ..............................................---.--...........-
gi|61175232|ref|NP_001012992.1|   ..............................................---.-I...........S
gi|54607116|ref|NP_938012.2|      ..............................................---.--...........-
gi|20302168|ref|NP_619542.1|      ..............................................ELL.SL...........S
gi|21450705|ref|NP_659436.1|      ..............................................---.--...........-
gi|112380630|ref|NP_036266.2|     ..............................................---.--...........-
gi|291190783|ref|NP_001167448.1|  ..............................................AVL.NL...........S
gi|291190781|ref|NP_060110.4|     ..............................................AVL.NL...........S
gi|66392157|ref|NP_001013860.1|   ..............................................THL.DA...........S
gi|19924149|ref|NP_612564.1|      ..............................................EHL.DL...........S
gi|312433960|ref|NP_001186067.1|  ..............................................KTL.SI...........H
gi|312433962|ref|NP_001186068.1|  ..............................................KTL.SI...........H
gi|40788015|ref|NP_067032.3|      ..............................................KTL.SI...........H
gi|16306588|ref|NP_036292.2|      ..............................................---.--...........-
gi|14249170|ref|NP_116026.1|      ..............................................---.--...........-
gi|156938257|ref|NP_612369.3|     ..............................................TYL.NL...........A
gi|161333854|ref|NP_001104508.1|  ..............................................SHI.YM...........A
gi|19718734|ref|NP_003255.2|      leidasdlqsyepkslksiqnvshlilhmkqhillleifvdvtssvECL.EL...........R
gi|149274651|ref|NP_115547.1|     ..............................................---.--...........-
gi|149274621|ref|NP_001092272.1|  ..............................................---.--...........-
gi|291190781|ref|NP_060110.4|     ..............................................VHL.DL...........S
gi|291190783|ref|NP_001167448.1|  ..............................................VHL.DL...........S
gi|163965441|ref|NP_653303.2|     ..............................................KEI.YI...........R
gi|161333852|ref|NP_659469.3|     ..............................................LCL.NL...........S
gi|190194416|ref|NP_077302.3|     ..............................................---.--...........-
gi|21264320|ref|NP_612202.1|      ..............................................TTL.DL...........S
gi|25777608|ref|NP_078894.2|      ..............................................RQL.NL...........A
gi|218931148|ref|NP_001136357.1|  ..............................................---.--...........-
gi|156938257|ref|NP_612369.3|     ..............................................RYL.DL...........S
gi|156938336|ref|NP_000237.2|     ..............................................FSL.DL...........R
gi|54112380|ref|NP_001005366.1|   ..............................................---.--...........-
gi|54112382|ref|NP_115979.3|      ..............................................---.--...........-
gi|157168349|ref|NP_001093254.2|  ..............................................RLL.DL...........R
gi|118442828|ref|NP_001072983.1|  ..............................................RKV.DL...........S
gi|4507375|ref|NP_003184.1|       ..............................................RKV.DL...........S
gi|116268109|ref|NP_115582.3|     ..............................................SLL.QL...........S
gi|25777610|ref|NP_733840.1|      ..............................................RQL.NL...........A
gi|164663798|ref|NP_001106873.1|  ..............................................---.--...........-
gi|66392157|ref|NP_001013860.1|   ..............................................THL.DL...........S
gi|161333854|ref|NP_001104508.1|  ..............................................LCL.NL...........S
gi|16306580|ref|NP_036440.1|      ..............................................KDL.LL...........A
gi|341916269|ref|XP_003403438.1|  ..............................................HVF.HL...........K
gi|119393876|ref|NP_075043.1|     ..............................................HVF.HL...........K
gi|341916267|ref|XP_003403437.1|  ..............................................HVF.HL...........K
gi|119393878|ref|NP_004527.2|     ..............................................HVF.HL...........K
gi|341916263|ref|XP_003403435.1|  ..............................................HVF.HL...........K
gi|40255157|ref|NP_700356.2|      ..............................................ARL.DL...........S
gi|16306576|ref|NP_036294.1|      ..............................................QVL.EV...........S
gi|302129689|ref|NP_001180464.1|  ..............................................EHL.DL...........T
gi|302129687|ref|NP_001180463.1|  ..............................................EHL.DL...........T
gi|16306572|ref|NP_036293.1|      ..............................................EHL.DL...........T
gi|341915644|ref|XP_003403561.1|  ..............................................---.--...........-
gi|341913879|ref|XP_003403707.1|  ..............................................---.--...........-
gi|61742136|ref|NP_078831.3|      ..............................................QVL.EV...........S
gi|38569471|ref|NP_006360.3|      ..............................................RAL.HL...........S
gi|16306591|ref|NP_036295.1|      ..............................................---.--...........-
gi|51873034|ref|NP_001004055.1|   ..............................................---.--...........-
gi|341916265|ref|XP_003403436.1|  ..............................................HVF.HL...........K
gi|7661860|ref|NP_055480.1|       ..............................................KKL.DL...........S
gi|122937351|ref|NP_001073947.1|  ..............................................EVL.DL...........S
gi|46249367|ref|NP_996836.1|      ..............................................SVL.SL...........S
gi|46249369|ref|NP_996837.1|      ..............................................SVL.SL...........S
gi|46249371|ref|NP_996838.1|      ..............................................SVL.SL...........S
gi|46249373|ref|NP_996839.1|      ..............................................SVL.SL...........S
gi|5174641|ref|NP_006106.1|       ..............................................SVL.SL...........S
gi|88942379|ref|XP_933494.1|      ..............................................KTL.DL...........S
gi|148356236|ref|NP_001091846.1|  ..............................................KTL.DL...........S
gi|61102721|ref|NP_001010890.1|   ..............................................KTL.DL...........S
gi|153792112|ref|NP_001093322.1|  ..............................................KTL.DL...........S
gi|153945800|ref|NP_001093584.1|  ..............................................KTL.DL...........S
gi|61696142|ref|NP_001013425.1|   ..............................................KTL.DL...........S
gi|226437621|ref|NP_001139816.1|  ..............................................KTL.DL...........S
gi|59958373|ref|NP_001009611.1|   ..............................................KTL.DL...........S
gi|58219004|ref|NP_001010889.1|   ..............................................KTL.DL...........S
gi|153791443|ref|NP_001093320.1|  ..............................................KQL.NL...........S
gi|310118528|ref|XP_003118894.1|  ..............................................KTL.DL...........S
gi|310118526|ref|XP_001130065.3|  ..............................................KTL.DL...........S
gi|55742693|ref|NP_078922.1|      ..............................................---.--...........-
gi|194306635|ref|NP_001093260.2|  ..............................................KQL.NL...........S
gi|66954681|ref|NP_001019832.1|   ..............................................KHL.NL...........S
gi|59676593|ref|NP_001012277.1|   ..............................................KEL.DL...........R
gi|59676587|ref|NP_001012276.1|   ..............................................KEL.DL...........R
gi|12738831|ref|NP_075389.1|      ..............................................KHL.NL...........S
gi|194306638|ref|NP_001013714.3|  ..............................................KQL.NL...........S
gi|8923179|ref|NP_060173.1|       ..............................................KRL.CL...........H
gi|124249372|ref|NP_001074299.1|  ..............................................KEL.DL...........R
gi|154800493|ref|NP_001094101.1|  ..............................................KQL.NL...........S
gi|29789255|ref|NP_085132.1|      ..............................................QIIsTL...........E
gi|194018550|ref|NP_938204.2|     ..............................................QIIsTL...........E
gi|157426875|ref|NP_079239.3|     ..............................................ASL.NL...........S
gi|33589814|ref|NP_006327.2|      ..............................................RFL.NL...........G
gi|12738834|ref|NP_075390.1|      ..............................................KHL.NL...........S
gi|341915238|ref|XP_938952.6|     ..............................................---.--...........-
gi|153792140|ref|NP_001093324.1|  ..............................................KHL.NL...........S
gi|16506299|ref|NP_443172.1|      ..............................................---.--...........-
gi|194018546|ref|NP_001034450.2|  ..............................................KEL.RL...........I
gi|226437632|ref|NP_001004339.2|  ..............................................---.--...........-
gi|113865933|ref|NP_001038945.1|  ..............................................KEL.HL...........I
gi|116268109|ref|NP_115582.3|     ..............................................---.--...........-
gi|157426839|ref|NP_001093321.1|  ..............................................KEL.HL...........I
gi|268832194|ref|NP_001161343.1|  ..............................................---.--...........-
gi|268832172|ref|NP_060505.2|     ..............................................---.--...........-
gi|268830752|ref|NP_001161339.1|  ..............................................---.--...........-
gi|165932385|ref|NP_001107039.1|  ..............................................TWI.DL...........G
gi|134288867|ref|NP_997527.2|     ..............................................--V.DL...........S
gi|23397500|ref|NP_694962.1|      ..............................................---.LV...........W
gi|148922963|ref|NP_036291.2|     ..............................................SSI.KI...........E
gi|16306584|ref|NP_036290.1|      ..............................................---.--...........-
gi|45505155|ref|NP_110420.3|      ..............................................EHL.EM...........V
gi|45545409|ref|NP_995308.1|      ..............................................EHL.EM...........V
gi|22547146|ref|NP_060848.2|      ..............................................HSL.FL...........D
gi|51558774|ref|NP_001003803.1|   ..............................................---.--...........-
gi|289803020|ref|NP_001073879.2|  ..............................................QVA.PL...........H
gi|158321897|ref|NP_703148.4|     ..............................................RSL.NL...........G
gi|28827813|ref|NP_789792.1|      ..............................................MHL.DL...........K


                                     180                                                            
                                       |                                                            
d1a4ya_                             .NND......I.....................................................
gi|21955154|ref|NP_653288.1|      .GNG......V.....................................................
gi|33519450|ref|NP_789790.2|      .GTS......L.....................................................
gi|28827813|ref|NP_789792.1|      .TNN......L.....................................................
gi|119395764|ref|NP_001073289.1|  .DNA......L.....................................................
gi|34878693|ref|NP_004886.3|      .DNA......L.....................................................
gi|158321897|ref|NP_703148.4|     .GNK......V.....................................................
gi|194018482|ref|NP_604393.2|     .LTK......L.....................................................
gi|110624785|ref|NP_789780.2|     .SNK......L.....................................................
gi|21361547|ref|NP_002930.2|      .NND......I.....................................................
gi|42794608|ref|NP_976318.1|      .NND......I.....................................................
gi|42822864|ref|NP_976322.1|      .NND......I.....................................................
gi|42822866|ref|NP_976323.1|      .NND......I.....................................................
gi|42822868|ref|NP_976321.1|      .NND......I.....................................................
gi|42822870|ref|NP_976320.1|      .NND......I.....................................................
gi|42822872|ref|NP_976317.1|      .NND......I.....................................................
gi|42822874|ref|NP_976319.1|      .NND......I.....................................................
gi|291463278|ref|NP_001167553.1|  .GND......-.....................................................
gi|291463280|ref|NP_001167554.1|  .GND......-.....................................................
gi|291463275|ref|NP_001167552.1|  .GND......-.....................................................
gi|8923473|ref|NP_060322.1|       .GND......-.....................................................
gi|194018484|ref|NP_659444.2|     .CTS......I.....................................................
gi|187937176|ref|NP_001120727.1|  .GHIe.....W.....................................................
gi|33667040|ref|NP_789781.2|      .HVE......V.....................................................
gi|46049100|ref|NP_631915.2|      .GHIe.....W.....................................................
gi|113205085|ref|NP_079003.2|     .INR......D.....................................................
gi|188536116|ref|NP_001120933.1|  .DNS......L.....................................................
gi|338797736|ref|NP_061994.1|     .NAS......L.....................................................
gi|5174617|ref|NP_006083.1|       .NNN......L.....................................................
gi|188536002|ref|NP_001120934.1|  .DNA......L.....................................................
gi|116268109|ref|NP_115582.3|     .HNQ......I.....................................................
gi|15193292|ref|NP_150639.1|      .GNG......V.....................................................
gi|118918429|ref|NP_849172.2|     .TNQ......F.....................................................
gi|289666780|ref|NP_001166250.1|  .FND......I.....................................................
gi|75709196|ref|NP_996611.2|      .GHIe.....W.....................................................
gi|168986655|ref|NP_919263.2|     .HHG......L.....................................................
gi|116268109|ref|NP_115582.3|     .SNS......I.....................................................
gi|11545912|ref|NP_071445.1|      .YNS......V.....................................................
gi|118918429|ref|NP_849172.2|     .---......-.....................................................
gi|289666778|ref|NP_699184.2|     .FND......I.....................................................
gi|27734755|ref|NP_116264.2|      .WCDq.....V.....................................................
gi|4506411|ref|NP_002874.1|       .DNA......F.....................................................
gi|284447308|ref|NP_036289.3|     .WCDq.....I.....................................................
gi|289666782|ref|NP_001166251.1|  .FND......I.....................................................
gi|74271814|ref|NP_001028225.1|   .FNV......L.....................................................
gi|7662386|ref|NP_055737.1|       .FNV......L.....................................................
gi|14719829|ref|NP_127497.1|      .FNV......L.....................................................
gi|296531375|ref|NP_001171835.1|  .WCDq.....V.....................................................
gi|226342931|ref|NP_079101.3|     .NNQ......L.....................................................
gi|308818204|ref|NP_001184224.1|  .GNN......L.....................................................
gi|4557543|ref|NP_001384.1|       .GNN......L.....................................................
gi|21389431|ref|NP_653221.1|      .EWQ......L.....................................................
gi|14719835|ref|NP_127500.1|      .FNV......L.....................................................
gi|14719833|ref|NP_127499.1|      .FNV......L.....................................................
gi|34878690|ref|NP_899632.1|      .DNA......L.....................................................
gi|229577123|ref|NP_872345.2|     .WNLfl....F.....................................................
gi|6912466|ref|NP_036436.1|       .GCSkvtcisL.....................................................
gi|156415984|ref|NP_037485.2|     .NQRqw....P.....................................................
gi|7657647|ref|NP_055363.1|       .---......-.....................................................
gi|7657649|ref|NP_055362.1|       .---......-.....................................................
gi|289666746|ref|NP_699181.2|     .AYH......V.....................................................
gi|197333692|ref|NP_001127948.1|  .NEG......S.....................................................
gi|21245134|ref|NP_056165.1|      .NEG......S.....................................................
gi|161333852|ref|NP_659469.3|     .NCVr.....L.....................................................
gi|284447314|ref|NP_001165184.1|  .---......-.....................................................
gi|260763922|ref|NP_001159588.1|  .---......-.....................................................
gi|4507553|ref|NP_003266.1|       .---......-.....................................................
gi|21361547|ref|NP_002930.2|      .CEE......L.....................................................
gi|42794608|ref|NP_976318.1|      .CEE......L.....................................................
gi|42822864|ref|NP_976322.1|      .CEE......L.....................................................
gi|42822866|ref|NP_976323.1|      .CEE......L.....................................................
gi|42822868|ref|NP_976321.1|      .CEE......L.....................................................
gi|42822870|ref|NP_976320.1|      .CEE......L.....................................................
gi|42822872|ref|NP_976317.1|      .CEE......L.....................................................
gi|42822874|ref|NP_976319.1|      .CEE......L.....................................................
gi|62912470|ref|NP_001017403.1|   .DNP......I.....................................................
gi|38348406|ref|NP_940967.1|      .YNV......L.....................................................
gi|187608777|ref|NP_038460.4|     .MNP......L.....................................................
gi|16306595|ref|NP_005974.2|      .GCSg.....F.....................................................
gi|22748931|ref|NP_689654.1|      .SCRh.....L.....................................................
gi|150378503|ref|NP_997046.1|     .---......-.....................................................
gi|4504379|ref|NP_003658.1|       .DNP......I.....................................................
gi|255683361|ref|NP_001156787.2|  .---......-.....................................................
gi|61175232|ref|NP_001012992.1|   .GEP......L.....................................................
gi|54607116|ref|NP_938012.2|      .---......-.....................................................
gi|20302168|ref|NP_619542.1|      .FNS......L.....................................................
gi|21450705|ref|NP_659436.1|      .---......-.....................................................
gi|112380630|ref|NP_036266.2|     .---......-.....................................................
gi|291190783|ref|NP_001167448.1|  .RTV......Fshrk.................................................
gi|291190781|ref|NP_060110.4|     .RTV......Fshrk.................................................
gi|66392157|ref|NP_001013860.1|   .RNV......Fsrtk.................................................
gi|19924149|ref|NP_612564.1|      .SNK......Iqsiyctdlrvlhqmpllnlsldlslnpmnfiqpgafkeirlhkltlrnnfdsl
gi|312433960|ref|NP_001186067.1|  .DLQ......-.....................................................
gi|312433962|ref|NP_001186068.1|  .DLQ......-.....................................................
gi|40788015|ref|NP_067032.3|      .DLQ......-.....................................................
gi|16306588|ref|NP_036292.2|      .---......-.....................................................
gi|14249170|ref|NP_116026.1|      .---......-.....................................................
gi|156938257|ref|NP_612369.3|     .RNScshr..K.....................................................
gi|161333854|ref|NP_001104508.1|  .DCKg.....I.....................................................
gi|19718734|ref|NP_003255.2|      .DTD......L.....................................................
gi|149274651|ref|NP_115547.1|     .---......-.....................................................
gi|149274621|ref|NP_001092272.1|  .---......-.....................................................
gi|291190781|ref|NP_060110.4|     .GNV......L.....................................................
gi|291190783|ref|NP_001167448.1|  .GNV......L.....................................................
gi|163965441|ref|NP_653303.2|     .GWK......V.....................................................
gi|161333852|ref|NP_659469.3|     .NTT......I.....................................................
gi|190194416|ref|NP_077302.3|     .---......-.....................................................
gi|21264320|ref|NP_612202.1|      .GCQ......L.....................................................
gi|25777608|ref|NP_078894.2|      .GVR......M.....................................................
gi|218931148|ref|NP_001136357.1|  .---......-.....................................................
gi|156938257|ref|NP_612369.3|     .KNPgl....L.....................................................
gi|156938336|ref|NP_000237.2|     .STG......I.....................................................
gi|54112380|ref|NP_001005366.1|   .---......-.....................................................
gi|54112382|ref|NP_115979.3|      .---......-.....................................................
gi|157168349|ref|NP_001093254.2|  .WIEd.....V.....................................................
gi|118442828|ref|NP_001072983.1|  .KNL......L.....................................................
gi|4507375|ref|NP_003184.1|       .KNL......L.....................................................
gi|116268109|ref|NP_115582.3|     .QTG......L.....................................................
gi|25777610|ref|NP_733840.1|      .GVR......M.....................................................
gi|164663798|ref|NP_001106873.1|  .---......-.....................................................
gi|66392157|ref|NP_001013860.1|   .GNPgal...G.....................................................
gi|161333854|ref|NP_001104508.1|  .NTT......I.....................................................
gi|16306580|ref|NP_036440.1|      .GCS......W.....................................................
gi|341916269|ref|XP_003403438.1|  .CNF......F.....................................................
gi|119393876|ref|NP_075043.1|     .CNF......F.....................................................
gi|341916267|ref|XP_003403437.1|  .CNF......F.....................................................
gi|119393878|ref|NP_004527.2|     .CNF......F.....................................................
gi|341916263|ref|XP_003403435.1|  .CNF......F.....................................................
gi|40255157|ref|NP_700356.2|      .HNR......L.....................................................
gi|16306576|ref|NP_036294.1|      tGIN......R.....................................................
gi|302129689|ref|NP_001180464.1|  .QTD......I.....................................................
gi|302129687|ref|NP_001180463.1|  .QTD......I.....................................................
gi|16306572|ref|NP_036293.1|      .QTD......I.....................................................
gi|341915644|ref|XP_003403561.1|  .---......-.....................................................
gi|341913879|ref|XP_003403707.1|  .---......-.....................................................
gi|61742136|ref|NP_078831.3|      tGIN......R.....................................................
gi|38569471|ref|NP_006360.3|      .DLF......Splpileltraivralpllrvlsirvdhpsqrdnpgvpgnagppshiigdeeip
gi|16306591|ref|NP_036295.1|      .---......-.....................................................
gi|51873034|ref|NP_001004055.1|   .---......-.....................................................
gi|341916265|ref|XP_003403436.1|  .CNF......F.....................................................
gi|7661860|ref|NP_055480.1|       .GND......L.....................................................
gi|122937351|ref|NP_001073947.1|  .GHN......L.....................................................
gi|46249367|ref|NP_996836.1|      .GVM......L.....................................................
gi|46249369|ref|NP_996837.1|      .GVM......L.....................................................
gi|46249371|ref|NP_996838.1|      .GVM......L.....................................................
gi|46249373|ref|NP_996839.1|      .GVM......L.....................................................
gi|5174641|ref|NP_006106.1|       .GVM......L.....................................................
gi|88942379|ref|XP_933494.1|      .GIR......L.....................................................
gi|148356236|ref|NP_001091846.1|  .GIR......L.....................................................
gi|61102721|ref|NP_001010890.1|   .GIR......L.....................................................
gi|153792112|ref|NP_001093322.1|  .GTR......L.....................................................
gi|153945800|ref|NP_001093584.1|  .GTR......L.....................................................
gi|61696142|ref|NP_001013425.1|   .GIR......L.....................................................
gi|226437621|ref|NP_001139816.1|  .GIR......L.....................................................
gi|59958373|ref|NP_001009611.1|   .GIR......L.....................................................
gi|58219004|ref|NP_001010889.1|   .GIR......L.....................................................
gi|153791443|ref|NP_001093320.1|  .HGT......L.....................................................
gi|310118528|ref|XP_003118894.1|  .GIR......L.....................................................
gi|310118526|ref|XP_001130065.3|  .GIR......L.....................................................
gi|55742693|ref|NP_078922.1|      .---......-.....................................................
gi|194306635|ref|NP_001093260.2|  .HGT......L.....................................................
gi|66954681|ref|NP_001019832.1|   .YVL......L.....................................................
gi|59676593|ref|NP_001012277.1|   .GVT......L.....................................................
gi|59676587|ref|NP_001012276.1|   .GVT......L.....................................................
gi|12738831|ref|NP_075389.1|      .YVL......L.....................................................
gi|194306638|ref|NP_001013714.3|  .HGA......L.....................................................
gi|8923179|ref|NP_060173.1|       .VAD......L.....................................................
gi|124249372|ref|NP_001074299.1|  .GIT......L.....................................................
gi|154800493|ref|NP_001094101.1|  .HGA......L.....................................................
gi|29789255|ref|NP_085132.1|      .STD......V.....................................................
gi|194018550|ref|NP_938204.2|     .STD......V.....................................................
gi|157426875|ref|NP_079239.3|     .GCV......Hclspdsllrkae.........................................
gi|33589814|ref|NP_006327.2|      .RMI......-.....................................................
gi|12738834|ref|NP_075390.1|      .YVL......L.....................................................
gi|341915238|ref|XP_938952.6|     .---......-.....................................................
gi|153792140|ref|NP_001093324.1|  .YVL......L.....................................................
gi|16506299|ref|NP_443172.1|      .---......-.....................................................
gi|194018546|ref|NP_001034450.2|  .HIL......M.....................................................
gi|226437632|ref|NP_001004339.2|  .---......-.....................................................
gi|113865933|ref|NP_001038945.1|  .HIL......M.....................................................
gi|116268109|ref|NP_115582.3|     .---......-.....................................................
gi|157426839|ref|NP_001093321.1|  .HIL......M.....................................................
gi|268832194|ref|NP_001161343.1|  .---......-.....................................................
gi|268832172|ref|NP_060505.2|     .---......-.....................................................
gi|268830752|ref|NP_001161339.1|  .---......-.....................................................
gi|165932385|ref|NP_001107039.1|  .NNV......-.....................................................
gi|134288867|ref|NP_997527.2|     .GIP......L.....................................................
gi|23397500|ref|NP_694962.1|      .RNS......I.....................................................
gi|148922963|ref|NP_036291.2|     .DTP......V.....................................................
gi|16306584|ref|NP_036290.1|      .---......-.....................................................
gi|45505155|ref|NP_110420.3|      .RVP......Fl....................................................
gi|45545409|ref|NP_995308.1|      .RVP......Fl....................................................
gi|22547146|ref|NP_060848.2|      .NSTl.....V.....................................................
gi|51558774|ref|NP_001003803.1|   .---......-.....................................................
gi|289803020|ref|NP_001073879.2|  .PCQqptr..F.....................................................
gi|158321897|ref|NP_703148.4|     .G--......-.....................................................
gi|28827813|ref|NP_789792.1|      .---......-.....................................................


                                                                                                    
                                                                                                    
d1a4ya_                             ................................................................
gi|21955154|ref|NP_653288.1|      ................................................................
gi|33519450|ref|NP_789790.2|      ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................
gi|119395764|ref|NP_001073289.1|  ................................................................
gi|34878693|ref|NP_004886.3|      ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|194018482|ref|NP_604393.2|     ................................................................
gi|110624785|ref|NP_789780.2|     ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|291463278|ref|NP_001167553.1|  ................................................................
gi|291463280|ref|NP_001167554.1|  ................................................................
gi|291463275|ref|NP_001167552.1|  ................................................................
gi|8923473|ref|NP_060322.1|       ................................................................
gi|194018484|ref|NP_659444.2|     ................................................................
gi|187937176|ref|NP_001120727.1|  ................................................................
gi|33667040|ref|NP_789781.2|      ................................................................
gi|46049100|ref|NP_631915.2|      ................................................................
gi|113205085|ref|NP_079003.2|     ................................................................
gi|188536116|ref|NP_001120933.1|  ................................................................
gi|338797736|ref|NP_061994.1|     ................................................................
gi|5174617|ref|NP_006083.1|       ................................................................
gi|188536002|ref|NP_001120934.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|15193292|ref|NP_150639.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666780|ref|NP_001166250.1|  ................................................................
gi|75709196|ref|NP_996611.2|      ................................................................
gi|168986655|ref|NP_919263.2|     ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|11545912|ref|NP_071445.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666778|ref|NP_699184.2|     ................................................................
gi|27734755|ref|NP_116264.2|      ................................................................
gi|4506411|ref|NP_002874.1|       ................................................................
gi|284447308|ref|NP_036289.3|     ................................................................
gi|289666782|ref|NP_001166251.1|  ................................................................
gi|74271814|ref|NP_001028225.1|   ................................................................
gi|7662386|ref|NP_055737.1|       ................................................................
gi|14719829|ref|NP_127497.1|      ................................................................
gi|296531375|ref|NP_001171835.1|  ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|308818204|ref|NP_001184224.1|  ................................................................
gi|4557543|ref|NP_001384.1|       ................................................................
gi|21389431|ref|NP_653221.1|      ................................................................
gi|14719835|ref|NP_127500.1|      ................................................................
gi|14719833|ref|NP_127499.1|      ................................................................
gi|34878690|ref|NP_899632.1|      ................................................................
gi|229577123|ref|NP_872345.2|     ................................................................
gi|6912466|ref|NP_036436.1|       ................................................................
gi|156415984|ref|NP_037485.2|     ................................................................
gi|7657647|ref|NP_055363.1|       ................................................................
gi|7657649|ref|NP_055362.1|       ................................................................
gi|289666746|ref|NP_699181.2|     ................................................................
gi|197333692|ref|NP_001127948.1|  ................................................................
gi|21245134|ref|NP_056165.1|      ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|284447314|ref|NP_001165184.1|  ................................................................
gi|260763922|ref|NP_001159588.1|  ................................................................
gi|4507553|ref|NP_003266.1|       ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|187608777|ref|NP_038460.4|     ................................................................
gi|16306595|ref|NP_005974.2|      ................................................................
gi|22748931|ref|NP_689654.1|      ................................................................
gi|150378503|ref|NP_997046.1|     ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|255683361|ref|NP_001156787.2|  ................................................................
gi|61175232|ref|NP_001012992.1|   ................................................................
gi|54607116|ref|NP_938012.2|      ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|21450705|ref|NP_659436.1|      ................................................................
gi|112380630|ref|NP_036266.2|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|19924149|ref|NP_612564.1|      nvmktciqglaglevhrlvlgefrnegnlekfdksaleglcnltieefrlayldyylddiidlf
gi|312433960|ref|NP_001186067.1|  ................................................................
gi|312433962|ref|NP_001186068.1|  ................................................................
gi|40788015|ref|NP_067032.3|      ................................................................
gi|16306588|ref|NP_036292.2|      ................................................................
gi|14249170|ref|NP_116026.1|      ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|149274651|ref|NP_115547.1|     ................................................................
gi|149274621|ref|NP_001092272.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|163965441|ref|NP_653303.2|     ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|190194416|ref|NP_077302.3|     ................................................................
gi|21264320|ref|NP_612202.1|      ................................................................
gi|25777608|ref|NP_078894.2|      ................................................................
gi|218931148|ref|NP_001136357.1|  ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|156938336|ref|NP_000237.2|     ................................................................
gi|54112380|ref|NP_001005366.1|   ................................................................
gi|54112382|ref|NP_115979.3|      ................................................................
gi|157168349|ref|NP_001093254.2|  ................................................................
gi|118442828|ref|NP_001072983.1|  ................................................................
gi|4507375|ref|NP_003184.1|       ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|25777610|ref|NP_733840.1|      ................................................................
gi|164663798|ref|NP_001106873.1|  ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|16306580|ref|NP_036440.1|      ................................................................
gi|341916269|ref|XP_003403438.1|  ................................................................
gi|119393876|ref|NP_075043.1|     ................................................................
gi|341916267|ref|XP_003403437.1|  ................................................................
gi|119393878|ref|NP_004527.2|     ................................................................
gi|341916263|ref|XP_003403435.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|16306576|ref|NP_036294.1|      ................................................................
gi|302129689|ref|NP_001180464.1|  ................................................................
gi|302129687|ref|NP_001180463.1|  ................................................................
gi|16306572|ref|NP_036293.1|      ................................................................
gi|341915644|ref|XP_003403561.1|  ................................................................
gi|341913879|ref|XP_003403707.1|  ................................................................
gi|61742136|ref|NP_078831.3|      ................................................................
gi|38569471|ref|NP_006360.3|      encleqlemgfpr...................................................
gi|16306591|ref|NP_036295.1|      ................................................................
gi|51873034|ref|NP_001004055.1|   ................................................................
gi|341916265|ref|XP_003403436.1|  ................................................................
gi|7661860|ref|NP_055480.1|       ................................................................
gi|122937351|ref|NP_001073947.1|  ................................................................
gi|46249367|ref|NP_996836.1|      ................................................................
gi|46249369|ref|NP_996837.1|      ................................................................
gi|46249371|ref|NP_996838.1|      ................................................................
gi|46249373|ref|NP_996839.1|      ................................................................
gi|5174641|ref|NP_006106.1|       ................................................................
gi|88942379|ref|XP_933494.1|      ................................................................
gi|148356236|ref|NP_001091846.1|  ................................................................
gi|61102721|ref|NP_001010890.1|   ................................................................
gi|153792112|ref|NP_001093322.1|  ................................................................
gi|153945800|ref|NP_001093584.1|  ................................................................
gi|61696142|ref|NP_001013425.1|   ................................................................
gi|226437621|ref|NP_001139816.1|  ................................................................
gi|59958373|ref|NP_001009611.1|   ................................................................
gi|58219004|ref|NP_001010889.1|   ................................................................
gi|153791443|ref|NP_001093320.1|  ................................................................
gi|310118528|ref|XP_003118894.1|  ................................................................
gi|310118526|ref|XP_001130065.3|  ................................................................
gi|55742693|ref|NP_078922.1|      ................................................................
gi|194306635|ref|NP_001093260.2|  ................................................................
gi|66954681|ref|NP_001019832.1|   ................................................................
gi|59676593|ref|NP_001012277.1|   ................................................................
gi|59676587|ref|NP_001012276.1|   ................................................................
gi|12738831|ref|NP_075389.1|      ................................................................
gi|194306638|ref|NP_001013714.3|  ................................................................
gi|8923179|ref|NP_060173.1|       ................................................................
gi|124249372|ref|NP_001074299.1|  ................................................................
gi|154800493|ref|NP_001094101.1|  ................................................................
gi|29789255|ref|NP_085132.1|      ................................................................
gi|194018550|ref|NP_938204.2|     ................................................................
gi|157426875|ref|NP_079239.3|     ................................................................
gi|33589814|ref|NP_006327.2|      ................................................................
gi|12738834|ref|NP_075390.1|      ................................................................
gi|341915238|ref|XP_938952.6|     ................................................................
gi|153792140|ref|NP_001093324.1|  ................................................................
gi|16506299|ref|NP_443172.1|      ................................................................
gi|194018546|ref|NP_001034450.2|  ................................................................
gi|226437632|ref|NP_001004339.2|  ................................................................
gi|113865933|ref|NP_001038945.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|157426839|ref|NP_001093321.1|  ................................................................
gi|268832194|ref|NP_001161343.1|  ................................................................
gi|268832172|ref|NP_060505.2|     ................................................................
gi|268830752|ref|NP_001161339.1|  ................................................................
gi|165932385|ref|NP_001107039.1|  ................................................................
gi|134288867|ref|NP_997527.2|     ................................................................
gi|23397500|ref|NP_694962.1|      ................................................................
gi|148922963|ref|NP_036291.2|     ................................................................
gi|16306584|ref|NP_036290.1|      ................................................................
gi|45505155|ref|NP_110420.3|      ................................................................
gi|45545409|ref|NP_995308.1|      ................................................................
gi|22547146|ref|NP_060848.2|      ................................................................
gi|51558774|ref|NP_001003803.1|   ................................................................
gi|289803020|ref|NP_001073879.2|  ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................


                                                                                                  19
                                                                                                    
d1a4ya_                             .......................................................NEAGV.RVL
gi|21955154|ref|NP_653288.1|      .......................................................GFPGM.MLL
gi|33519450|ref|NP_789790.2|      .......................................................SQSDI.RHL
gi|28827813|ref|NP_789792.1|      .......................................................LDDGV.QLL
gi|119395764|ref|NP_001073289.1|  .......................................................GDFGI.RLL
gi|34878693|ref|NP_004886.3|      .......................................................GDFGI.RLL
gi|158321897|ref|NP_703148.4|     .......................................................TDQGV.MPL
gi|194018482|ref|NP_604393.2|     .......................................................SRDDI.RSL
gi|110624785|ref|NP_789780.2|     .......................................................GMTVP.-LI
gi|21361547|ref|NP_002930.2|      .......................................................NEAGV.RVL
gi|42794608|ref|NP_976318.1|      .......................................................NEAGV.RVL
gi|42822864|ref|NP_976322.1|      .......................................................NEAGV.RVL
gi|42822866|ref|NP_976323.1|      .......................................................NEAGV.RVL
gi|42822868|ref|NP_976321.1|      .......................................................NEAGV.RVL
gi|42822870|ref|NP_976320.1|      .......................................................NEAGV.RVL
gi|42822872|ref|NP_976317.1|      .......................................................NEAGV.RVL
gi|42822874|ref|NP_976319.1|      .......................................................NEAGV.RVL
gi|291463278|ref|NP_001167553.1|  .......................................................QDDMF.PAL
gi|291463280|ref|NP_001167554.1|  .......................................................QDDMF.PAL
gi|291463275|ref|NP_001167552.1|  .......................................................QDDMF.PAL
gi|8923473|ref|NP_060322.1|       .......................................................QDDMF.PAL
gi|194018484|ref|NP_659444.2|     .......................................................SLNMF.SLL
gi|187937176|ref|NP_001120727.1|  .......................................................ERTMM.LML
gi|33667040|ref|NP_789781.2|      .......................................................ESKAV.KLL
gi|46049100|ref|NP_631915.2|      .......................................................ERTMM.LML
gi|113205085|ref|NP_079003.2|     .......................................................IVGSL.NSI
gi|188536116|ref|NP_001120933.1|  .......................................................GDPGM.RVL
gi|338797736|ref|NP_061994.1|     .......................................................SGRPL.MLL
gi|5174617|ref|NP_006083.1|       .......................................................NDYGV.REL
gi|188536002|ref|NP_001120934.1|  .......................................................GDFGI.RLL
gi|116268109|ref|NP_115582.3|     .......................................................GDAGV.QHL
gi|15193292|ref|NP_150639.1|      .......................................................GFPGM.MLL
gi|118918429|ref|NP_849172.2|     .......................................................QDPVM.ELL
gi|289666780|ref|NP_001166250.1|  .......................................................GPEGG.ELI
gi|75709196|ref|NP_996611.2|      .......................................................ERTMM.LML
gi|168986655|ref|NP_919263.2|     .......................................................GPRGT.KAI
gi|116268109|ref|NP_115582.3|     .......................................................CVSTL.LCL
gi|11545912|ref|NP_071445.1|      .......................................................GDIGV.EQL
gi|118918429|ref|NP_849172.2|     .......................................................-----.---
gi|289666778|ref|NP_699184.2|     .......................................................GPEGG.ELI
gi|27734755|ref|NP_116264.2|      .......................................................TKDGI.QAL
gi|4506411|ref|NP_002874.1|       .......................................................GPDGV.QGF
gi|284447308|ref|NP_036289.3|     .......................................................TKDGI.EAL
gi|289666782|ref|NP_001166251.1|  .......................................................GPEGG.ELI
gi|74271814|ref|NP_001028225.1|   .......................................................TDAGA.KHL
gi|7662386|ref|NP_055737.1|       .......................................................TDAGA.KHL
gi|14719829|ref|NP_127497.1|      .......................................................TDAGA.KHL
gi|296531375|ref|NP_001171835.1|  .......................................................TKDGI.QAL
gi|226342931|ref|NP_079101.3|     .......................................................SYLPP.---
gi|308818204|ref|NP_001184224.1|  .......................................................SEANV.NPL
gi|4557543|ref|NP_001384.1|       .......................................................SEANV.NPL
gi|21389431|ref|NP_653221.1|      .......................................................HRTGL.LKI
gi|14719835|ref|NP_127500.1|      .......................................................TDAGA.KHL
gi|14719833|ref|NP_127499.1|      .......................................................TDAGA.KHL
gi|34878690|ref|NP_899632.1|      .......................................................GDFGI.RLL
gi|229577123|ref|NP_872345.2|     .......................................................TYRDC.LSL
gi|6912466|ref|NP_036436.1|       .......................................................TREAS.IKL
gi|156415984|ref|NP_037485.2|     .......................................................GDAVE.MEM
gi|7657647|ref|NP_055363.1|       .......................................................-----.---
gi|7657649|ref|NP_055362.1|       .......................................................-----.---
gi|289666746|ref|NP_699181.2|     .......................................................TDTAL.AYF
gi|197333692|ref|NP_001127948.1|  .......................................................KLVVL.---
gi|21245134|ref|NP_056165.1|      .......................................................KLVVL.---
gi|161333852|ref|NP_659469.3|     .......................................................SDASV.MKL
gi|284447314|ref|NP_001165184.1|  .......................................................-----.---
gi|260763922|ref|NP_001159588.1|  .......................................................-----.---
gi|4507553|ref|NP_003266.1|       .......................................................-----.---
gi|21361547|ref|NP_002930.2|      .......................................................SDARW.AEL
gi|42794608|ref|NP_976318.1|      .......................................................SDARW.AEL
gi|42822864|ref|NP_976322.1|      .......................................................SDARW.AEL
gi|42822866|ref|NP_976323.1|      .......................................................SDARW.AEL
gi|42822868|ref|NP_976321.1|      .......................................................SDARW.AEL
gi|42822870|ref|NP_976320.1|      .......................................................SDARW.AEL
gi|42822872|ref|NP_976317.1|      .......................................................SDARW.AEL
gi|42822874|ref|NP_976319.1|      .......................................................SDARW.AEL
gi|62912470|ref|NP_001017403.1|   .......................................................QFVGR.---
gi|38348406|ref|NP_940967.1|      .......................................................EWFLA.---
gi|187608777|ref|NP_038460.4|     .......................................................GDGCG.QSL
gi|16306595|ref|NP_005974.2|      .......................................................SEFA-.--L
gi|22748931|ref|NP_689654.1|      .......................................................SDVGI.GHL
gi|150378503|ref|NP_997046.1|     .......................................................-----.---
gi|4504379|ref|NP_003658.1|       .......................................................QFVGR.---
gi|255683361|ref|NP_001156787.2|  .......................................................-----.---
gi|61175232|ref|NP_001012992.1|   .......................................................SGAEV.RDI
gi|54607116|ref|NP_938012.2|      .......................................................-----.---
gi|20302168|ref|NP_619542.1|      .......................................................SHVPP.---
gi|21450705|ref|NP_659436.1|      .......................................................-----.---
gi|112380630|ref|NP_036266.2|     .......................................................-----.---
gi|291190783|ref|NP_001167448.1|  .......................................................GKEVP.PSF
gi|291190781|ref|NP_060110.4|     .......................................................GKEVP.PSF
gi|66392157|ref|NP_001013860.1|   .......................................................SRAAP.AAL
gi|19924149|ref|NP_612564.1|      ncltnvssfslvsvtiervkdfsynfgwqhlelvnckfgqfptlklkslkrltftSNKGG.NAF
gi|312433960|ref|NP_001186067.1|  .......................................................NQRLP.GGL
gi|312433962|ref|NP_001186068.1|  .......................................................NQRLP.GGL
gi|40788015|ref|NP_067032.3|      .......................................................NQRLP.GGL
gi|16306588|ref|NP_036292.2|      .......................................................-----.TAL
gi|14249170|ref|NP_116026.1|      .......................................................-----.---
gi|156938257|ref|NP_612369.3|     .......................................................GREAP.PAF
gi|161333854|ref|NP_001104508.1|  .......................................................TDSSL.RSL
gi|19718734|ref|NP_003255.2|      .......................................................DTFHF.SEL
gi|149274651|ref|NP_115547.1|     .......................................................-----.---
gi|149274621|ref|NP_001092272.1|  .......................................................-----.---
gi|291190781|ref|NP_060110.4|     .......................................................RGDDL.SHM
gi|291190783|ref|NP_001167448.1|  .......................................................RGDDL.SHM
gi|163965441|ref|NP_653303.2|     .......................................................EERIL.GVF
gi|161333852|ref|NP_659469.3|     .......................................................TNRTM.RLL
gi|190194416|ref|NP_077302.3|     .......................................................-----.--L
gi|21264320|ref|NP_612202.1|      .......................................................PAPMV.TYL
gi|25777608|ref|NP_078894.2|      .......................................................TPVKC.TVV
gi|218931148|ref|NP_001136357.1|  .......................................................-----.---
gi|156938257|ref|NP_612369.3|     .......................................................ATDEA.NAL
gi|156938336|ref|NP_000237.2|     .......................................................CPSGL.GSL
gi|54112380|ref|NP_001005366.1|   .......................................................-----.---
gi|54112382|ref|NP_115979.3|      .......................................................-----.---
gi|157168349|ref|NP_001093254.2|  .......................................................KDS--.---
gi|118442828|ref|NP_001072983.1|  .......................................................SSWDEvIHI
gi|4507375|ref|NP_003184.1|       .......................................................SSWDEvIHI
gi|116268109|ref|NP_115582.3|     .......................................................SPKSP.FLL
gi|25777610|ref|NP_733840.1|      .......................................................TPVKC.TVV
gi|164663798|ref|NP_001106873.1|  .......................................................-----.---
gi|66392157|ref|NP_001013860.1|   .......................................................ASEDS.GGL
gi|161333854|ref|NP_001104508.1|  .......................................................TNRTM.RLL
gi|16306580|ref|NP_036440.1|      .......................................................SAVSA.---
gi|341916269|ref|XP_003403438.1|  .......................................................SDFGS.--L
gi|119393876|ref|NP_075043.1|     .......................................................SDFGS.--L
gi|341916267|ref|XP_003403437.1|  .......................................................SDFGS.--L
gi|119393878|ref|NP_004527.2|     .......................................................SDFGS.--L
gi|341916263|ref|XP_003403435.1|  .......................................................SDFGS.--L
gi|40255157|ref|NP_700356.2|      .......................................................SFIKA.SSM
gi|16306576|ref|NP_036294.1|      .......................................................NSIPL.QLP
gi|302129689|ref|NP_001180464.1|  .......................................................SDSAF.DSW
gi|302129687|ref|NP_001180463.1|  .......................................................SDSAF.DSW
gi|16306572|ref|NP_036293.1|      .......................................................SDSAF.DSW
gi|341915644|ref|XP_003403561.1|  .......................................................-----.---
gi|341913879|ref|XP_003403707.1|  .......................................................-----.---
gi|61742136|ref|NP_078831.3|      .......................................................NSIPL.QLP
gi|38569471|ref|NP_006360.3|      .......................................................GAQPA.PLL
gi|16306591|ref|NP_036295.1|      .......................................................-----.---
gi|51873034|ref|NP_001004055.1|   .......................................................-----.---
gi|341916265|ref|XP_003403436.1|  .......................................................SDFGS.--L
gi|7661860|ref|NP_055480.1|       .......................................................SGSQL.APF
gi|122937351|ref|NP_001073947.1|  .......................................................VSLYP.STF
gi|46249367|ref|NP_996836.1|      .......................................................TDVSP.EPL
gi|46249369|ref|NP_996837.1|      .......................................................TDVSP.EPL
gi|46249371|ref|NP_996838.1|      .......................................................TDVSP.EPL
gi|46249373|ref|NP_996839.1|      .......................................................TDVSP.EPL
gi|5174641|ref|NP_006106.1|       .......................................................TDVSP.EPL
gi|88942379|ref|XP_933494.1|      .......................................................TNYSL.VPL
gi|148356236|ref|NP_001091846.1|  .......................................................TNYSL.VPL
gi|61102721|ref|NP_001010890.1|   .......................................................TNYSL.VPL
gi|153792112|ref|NP_001093322.1|  .......................................................ANFSL.VPL
gi|153945800|ref|NP_001093584.1|  .......................................................ANFSL.VPL
gi|61696142|ref|NP_001013425.1|   .......................................................TNYSL.VPL
gi|226437621|ref|NP_001139816.1|  .......................................................TNYSL.VPL
gi|59958373|ref|NP_001009611.1|   .......................................................TNYSL.VPL
gi|58219004|ref|NP_001010889.1|   .......................................................TNYSL.VPL
gi|153791443|ref|NP_001093320.1|  .......................................................RFIRL.EPL
gi|310118528|ref|XP_003118894.1|  .......................................................TNYSL.VPL
gi|310118526|ref|XP_001130065.3|  .......................................................TNYSL.VPL
gi|55742693|ref|NP_078922.1|      .......................................................-----.---
gi|194306635|ref|NP_001093260.2|  .......................................................RFIRL.EPL
gi|66954681|ref|NP_001019832.1|   .......................................................FRISL.EPL
gi|59676593|ref|NP_001012277.1|   .......................................................THFSP.EPL
gi|59676587|ref|NP_001012276.1|   .......................................................THFSP.EPL
gi|12738831|ref|NP_075389.1|      .......................................................FRISL.EPL
gi|194306638|ref|NP_001013714.3|  .......................................................RFIRL.EPL
gi|8923179|ref|NP_060173.1|       .......................................................SMVPI.T--
gi|124249372|ref|NP_001074299.1|  .......................................................THFSP.EPL
gi|154800493|ref|NP_001094101.1|  .......................................................RFIRL.EPL
gi|29789255|ref|NP_085132.1|      .......................................................GKRMY.EQL
gi|194018550|ref|NP_938204.2|     .......................................................GKRMY.EQL
gi|157426875|ref|NP_079239.3|     .......................................................DDIDS.SIL
gi|33589814|ref|NP_006327.2|      .......................................................---DW.VPV
gi|12738834|ref|NP_075390.1|      .......................................................FRISL.EPL
gi|341915238|ref|XP_938952.6|     .......................................................-----.---
gi|153792140|ref|NP_001093324.1|  .......................................................FRISL.EPL
gi|16506299|ref|NP_443172.1|      .......................................................-----.---
gi|194018546|ref|NP_001034450.2|  .......................................................WTTHL.EPL
gi|226437632|ref|NP_001004339.2|  .......................................................-DLPV.PDI
gi|113865933|ref|NP_001038945.1|  .......................................................WTTNL.EPL
gi|116268109|ref|NP_115582.3|     .......................................................-----.---
gi|157426839|ref|NP_001093321.1|  .......................................................WTTNL.EPL
gi|268832194|ref|NP_001161343.1|  .......................................................-----.---
gi|268832172|ref|NP_060505.2|     .......................................................-----.---
gi|268830752|ref|NP_001161339.1|  .......................................................-----.---
gi|165932385|ref|NP_001107039.1|  .......................................................-----.---
gi|134288867|ref|NP_997527.2|     .......................................................STQDV.QHI
gi|23397500|ref|NP_694962.1|      .......................................................RSSFI.SSL
gi|148922963|ref|NP_036291.2|     .......................................................DDPSL.KIL
gi|16306584|ref|NP_036290.1|      .......................................................-----.---
gi|45505155|ref|NP_110420.3|      .......................................................GGLIQ.HVV
gi|45545409|ref|NP_995308.1|      .......................................................GGLIQ.HVV
gi|22547146|ref|NP_060848.2|      .......................................................GSVGP.GSV
gi|51558774|ref|NP_001003803.1|   .......................................................-----.---
gi|289803020|ref|NP_001073879.2|  .......................................................SNRCL.QMI
gi|158321897|ref|NP_703148.4|     .......................................................-----.---
gi|28827813|ref|NP_789792.1|      .......................................................-----.---


                                    0                                                               
                                    |                                                               
d1a4ya_                             C....QG.........................................................
gi|21955154|ref|NP_653288.1|      C....EG.........................................................
gi|33519450|ref|NP_789790.2|      C....ET.........................................................
gi|28827813|ref|NP_789792.1|      C....EA.........................................................
gi|119395764|ref|NP_001073289.1|  C....VG.........................................................
gi|34878693|ref|NP_004886.3|      C....VG.........................................................
gi|158321897|ref|NP_703148.4|     S....DA.........................................................
gi|194018482|ref|NP_604393.2|     C....DA.........................................................
gi|110624785|ref|NP_789780.2|     L....KA.........................................................
gi|21361547|ref|NP_002930.2|      C....QG.........................................................
gi|42794608|ref|NP_976318.1|      C....QG.........................................................
gi|42822864|ref|NP_976322.1|      C....QG.........................................................
gi|42822866|ref|NP_976323.1|      C....QG.........................................................
gi|42822868|ref|NP_976321.1|      C....QG.........................................................
gi|42822870|ref|NP_976320.1|      C....QG.........................................................
gi|42822872|ref|NP_976317.1|      C....QG.........................................................
gi|42822874|ref|NP_976319.1|      C....QG.........................................................
gi|291463278|ref|NP_001167553.1|  C....EV.........................................................
gi|291463280|ref|NP_001167554.1|  C....EV.........................................................
gi|291463275|ref|NP_001167552.1|  C....EV.........................................................
gi|8923473|ref|NP_060322.1|       C....EV.........................................................
gi|194018484|ref|NP_659444.2|     H....DI.........................................................
gi|187937176|ref|NP_001120727.1|  C....DL.........................................................
gi|33667040|ref|NP_789781.2|      C....RV.........................................................
gi|46049100|ref|NP_631915.2|      C....DL.........................................................
gi|113205085|ref|NP_079003.2|     A....QG.........................................................
gi|188536116|ref|NP_001120933.1|  C....ET.........................................................
gi|338797736|ref|NP_061994.1|     A....TA.........................................................
gi|5174617|ref|NP_006083.1|       Q....--.........................................................
gi|188536002|ref|NP_001120934.1|  C....VG.........................................................
gi|116268109|ref|NP_115582.3|     A....TI.........................................................
gi|15193292|ref|NP_150639.1|      C....EG.........................................................
gi|118918429|ref|NP_849172.2|     G....SV.........................................................
gi|289666780|ref|NP_001166250.1|  A....KV.........................................................
gi|75709196|ref|NP_996611.2|      C....DL.........................................................
gi|168986655|ref|NP_919263.2|     A....IA.........................................................
gi|116268109|ref|NP_115582.3|     A....RV.........................................................
gi|11545912|ref|NP_071445.1|      L....PC.........................................................
gi|118918429|ref|NP_849172.2|     -....--.........................................................
gi|289666778|ref|NP_699184.2|     A....KV.........................................................
gi|27734755|ref|NP_116264.2|      V....--.........................................................
gi|4506411|ref|NP_002874.1|       E....AL.........................................................
gi|284447308|ref|NP_036289.3|     V....--.........................................................
gi|289666782|ref|NP_001166251.1|  A....KV.........................................................
gi|74271814|ref|NP_001028225.1|   C....QR.........................................................
gi|7662386|ref|NP_055737.1|       C....QR.........................................................
gi|14719829|ref|NP_127497.1|      C....QR.........................................................
gi|296531375|ref|NP_001171835.1|  V....--.........................................................
gi|226342931|ref|NP_079101.3|     -....--.........................................................
gi|308818204|ref|NP_001184224.1|  A....--.........................................................
gi|4557543|ref|NP_001384.1|       A....--.........................................................
gi|21389431|ref|NP_653221.1|      P....EF.........................................................
gi|14719835|ref|NP_127500.1|      C....QR.........................................................
gi|14719833|ref|NP_127499.1|      C....QR.........................................................
gi|34878690|ref|NP_899632.1|      C....VG.........................................................
gi|229577123|ref|NP_872345.2|     A....AA.........................................................
gi|6912466|ref|NP_036436.1|       S....PL.........................................................
gi|156415984|ref|NP_037485.2|     A....TV.........................................................
gi|7657647|ref|NP_055363.1|       -....--.........................................................
gi|7657649|ref|NP_055362.1|       -....--.........................................................
gi|289666746|ref|NP_699181.2|     T....AR.........................................................
gi|197333692|ref|NP_001127948.1|  -....NN.........................................................
gi|21245134|ref|NP_056165.1|      -....NN.........................................................
gi|161333852|ref|NP_659469.3|     S....--.........................................................
gi|284447314|ref|NP_001165184.1|  -....--.........................................................
gi|260763922|ref|NP_001159588.1|  -....--.........................................................
gi|4507553|ref|NP_003266.1|       -....--.........................................................
gi|21361547|ref|NP_002930.2|      L....PL.........................................................
gi|42794608|ref|NP_976318.1|      L....PL.........................................................
gi|42822864|ref|NP_976322.1|      L....PL.........................................................
gi|42822866|ref|NP_976323.1|      L....PL.........................................................
gi|42822868|ref|NP_976321.1|      L....PL.........................................................
gi|42822870|ref|NP_976320.1|      L....PL.........................................................
gi|42822872|ref|NP_976317.1|      L....PL.........................................................
gi|42822874|ref|NP_976319.1|      L....PL.........................................................
gi|62912470|ref|NP_001017403.1|   -....SA.........................................................
gi|38348406|ref|NP_940967.1|      -....TG.........................................................
gi|187608777|ref|NP_038460.4|     A....SL.........................................................
gi|16306595|ref|NP_005974.2|      Q....TL.........................................................
gi|22748931|ref|NP_689654.1|      AgmtrSA.........................................................
gi|150378503|ref|NP_997046.1|     -....--.........................................................
gi|4504379|ref|NP_003658.1|       -....SA.........................................................
gi|255683361|ref|NP_001156787.2|  -....--.........................................................
gi|61175232|ref|NP_001012992.1|   C....RG.........................................................
gi|54607116|ref|NP_938012.2|      -....--.........................................................
gi|20302168|ref|NP_619542.1|      -....--.........................................................
gi|21450705|ref|NP_659436.1|      -....--.........................................................
gi|112380630|ref|NP_036266.2|     -....--.........................................................
gi|291190783|ref|NP_001167448.1|  K....QF.........................................................
gi|291190781|ref|NP_060110.4|     K....QF.........................................................
gi|66392157|ref|NP_001013860.1|   Q....LF.........................................................
gi|19924149|ref|NP_612564.1|      S....E-.........................................................
gi|312433960|ref|NP_001186067.1|  T....DS.........................................................
gi|312433962|ref|NP_001186068.1|  T....DS.........................................................
gi|40788015|ref|NP_067032.3|      T....DS.........................................................
gi|16306588|ref|NP_036292.2|      L....SI.........................................................
gi|14249170|ref|NP_116026.1|      -....--.........................................................
gi|156938257|ref|NP_612369.3|     K....QF.........................................................
gi|161333854|ref|NP_001104508.1|  S....--.........................................................
gi|19718734|ref|NP_003255.2|      S....TGetnslikkftfrnvkitdeslfqvmkllnqisgllelefddctlngvgnfrasdndr
gi|149274651|ref|NP_115547.1|     -....--.........................................................
gi|149274621|ref|NP_001092272.1|  -....--.........................................................
gi|291190781|ref|NP_060110.4|     Y....NF.........................................................
gi|291190783|ref|NP_001167448.1|  Y....NF.........................................................
gi|163965441|ref|NP_653303.2|     S....KC.........................................................
gi|161333852|ref|NP_659469.3|     P....--.........................................................
gi|190194416|ref|NP_077302.3|     A....RL.........................................................
gi|21264320|ref|NP_612202.1|      C....AV.........................................................
gi|25777608|ref|NP_078894.2|      A....AV.........................................................
gi|218931148|ref|NP_001136357.1|  -....--.........................................................
gi|156938257|ref|NP_612369.3|     Y....SF.........................................................
gi|156938336|ref|NP_000237.2|     V....GLscvtrfraalsdtvalweslqqhgetkllqaaeekftiepfkakslkdvedlgklvq
gi|54112380|ref|NP_001005366.1|   -....--.........................................................
gi|54112382|ref|NP_115979.3|      -....--.........................................................
gi|157168349|ref|NP_001093254.2|  -....--.........................................................
gi|118442828|ref|NP_001072983.1|  A....--.........................................................
gi|4507375|ref|NP_003184.1|       A....--.........................................................
gi|116268109|ref|NP_115582.3|     A....NT.........................................................
gi|25777610|ref|NP_733840.1|      A....AV.........................................................
gi|164663798|ref|NP_001106873.1|  -....--.........................................................
gi|66392157|ref|NP_001013860.1|   Y....SF.........................................................
gi|161333854|ref|NP_001104508.1|  P....--.........................................................
gi|16306580|ref|NP_036440.1|      -....LS.........................................................
gi|341916269|ref|XP_003403438.1|  M....TM.........................................................
gi|119393876|ref|NP_075043.1|     M....TM.........................................................
gi|341916267|ref|XP_003403437.1|  M....TM.........................................................
gi|119393878|ref|NP_004527.2|     M....TM.........................................................
gi|341916263|ref|XP_003403435.1|  M....TM.........................................................
gi|40255157|ref|NP_700356.2|      S....--.........................................................
gi|16306576|ref|NP_036294.1|      V....EA.........................................................
gi|302129689|ref|NP_001180464.1|  -....SW.........................................................
gi|302129687|ref|NP_001180463.1|  -....SW.........................................................
gi|16306572|ref|NP_036293.1|      -....SW.........................................................
gi|341915644|ref|XP_003403561.1|  -....--.........................................................
gi|341913879|ref|XP_003403707.1|  -....--.........................................................
gi|61742136|ref|NP_078831.3|      V....EA.........................................................
gi|38569471|ref|NP_006360.3|      C....SV.........................................................
gi|16306591|ref|NP_036295.1|      -....--.........................................................
gi|51873034|ref|NP_001004055.1|   -....--.........................................................
gi|341916265|ref|XP_003403436.1|  M....TM.........................................................
gi|7661860|ref|NP_055480.1|       Q....GL.........................................................
gi|122937351|ref|NP_001073947.1|  F....RL.........................................................
gi|46249367|ref|NP_996836.1|      Q....AL.........................................................
gi|46249369|ref|NP_996837.1|      Q....AL.........................................................
gi|46249371|ref|NP_996838.1|      Q....AL.........................................................
gi|46249373|ref|NP_996839.1|      Q....AL.........................................................
gi|5174641|ref|NP_006106.1|       Q....AL.........................................................
gi|88942379|ref|XP_933494.1|      Q....IL.........................................................
gi|148356236|ref|NP_001091846.1|  Q....IL.........................................................
gi|61102721|ref|NP_001010890.1|   Q....IL.........................................................
gi|153792112|ref|NP_001093322.1|  Q....VL.........................................................
gi|153945800|ref|NP_001093584.1|  Q....VL.........................................................
gi|61696142|ref|NP_001013425.1|   Q....IL.........................................................
gi|226437621|ref|NP_001139816.1|  Q....IL.........................................................
gi|59958373|ref|NP_001009611.1|   Q....IL.........................................................
gi|58219004|ref|NP_001010889.1|   Q....IL.........................................................
gi|153791443|ref|NP_001093320.1|  R....AL.........................................................
gi|310118528|ref|XP_003118894.1|  Q....IL.........................................................
gi|310118526|ref|XP_001130065.3|  Q....IL.........................................................
gi|55742693|ref|NP_078922.1|      -....--.........................................................
gi|194306635|ref|NP_001093260.2|  R....AL.........................................................
gi|66954681|ref|NP_001019832.1|   G....AL.........................................................
gi|59676593|ref|NP_001012277.1|   T....GL.........................................................
gi|59676587|ref|NP_001012276.1|   T....GL.........................................................
gi|12738831|ref|NP_075389.1|      G....AL.........................................................
gi|194306638|ref|NP_001013714.3|  R....AL.........................................................
gi|8923179|ref|NP_060173.1|       -....--.........................................................
gi|124249372|ref|NP_001074299.1|  S....VL.........................................................
gi|154800493|ref|NP_001094101.1|  R....AL.........................................................
gi|29789255|ref|NP_085132.1|      C....DR.........................................................
gi|194018550|ref|NP_938204.2|     C....DR.........................................................
gi|157426875|ref|NP_079239.3|     E....TL.........................................................
gi|33589814|ref|NP_006327.2|      E....SL.........................................................
gi|12738834|ref|NP_075390.1|      G....AL.........................................................
gi|341915238|ref|XP_938952.6|     -....--.........................................................
gi|153792140|ref|NP_001093324.1|  G....AL.........................................................
gi|16506299|ref|NP_443172.1|      -....--.........................................................
gi|194018546|ref|NP_001034450.2|  G....VL.........................................................
gi|226437632|ref|NP_001004339.2|  I....SG.........................................................
gi|113865933|ref|NP_001038945.1|  G....AL.........................................................
gi|116268109|ref|NP_115582.3|     -....--.........................................................
gi|157426839|ref|NP_001093321.1|  G....AL.........................................................
gi|268832194|ref|NP_001161343.1|  -....--.........................................................
gi|268832172|ref|NP_060505.2|     -....--.........................................................
gi|268830752|ref|NP_001161339.1|  -....--.........................................................
gi|165932385|ref|NP_001107039.1|  -....--.........................................................
gi|134288867|ref|NP_997527.2|     T....RY.........................................................
gi|23397500|ref|NP_694962.1|      S....FF.........................................................
gi|148922963|ref|NP_036291.2|     V....--.........................................................
gi|16306584|ref|NP_036290.1|      -....--.........................................................
gi|45505155|ref|NP_110420.3|      E....DS.........................................................
gi|45545409|ref|NP_995308.1|      E....DS.........................................................
gi|22547146|ref|NP_060848.2|      L....EL.........................................................
gi|51558774|ref|NP_001003803.1|   -....--.........................................................
gi|289803020|ref|NP_001073879.2|  G....--.........................................................
gi|158321897|ref|NP_703148.4|     -....--.........................................................
gi|28827813|ref|NP_789792.1|      -....--.........................................................


                                                                                                  20
                                                                                                    
d1a4ya_                             .....................................................L.KDSPC...Q
gi|21955154|ref|NP_653288.1|      .....................................................L.RHPQC...R
gi|33519450|ref|NP_789790.2|      .....................................................L.KHPMC...K
gi|28827813|ref|NP_789792.1|      .....................................................L.RHPKC...Y
gi|119395764|ref|NP_001073289.1|  .....................................................L.KHLLC...N
gi|34878693|ref|NP_004886.3|      .....................................................L.KHLLC...N
gi|158321897|ref|NP_703148.4|     .....................................................L.RVSQC...A
gi|194018482|ref|NP_604393.2|     .....................................................L.NYPAG...N
gi|110624785|ref|NP_789780.2|     .....................................................L.RHSAC...N
gi|21361547|ref|NP_002930.2|      .....................................................L.KDSPC...Q
gi|42794608|ref|NP_976318.1|      .....................................................L.KDSPC...Q
gi|42822864|ref|NP_976322.1|      .....................................................L.KDSPC...Q
gi|42822866|ref|NP_976323.1|      .....................................................L.KDSPC...Q
gi|42822868|ref|NP_976321.1|      .....................................................L.KDSPC...Q
gi|42822870|ref|NP_976320.1|      .....................................................L.KDSPC...Q
gi|42822872|ref|NP_976317.1|      .....................................................L.KDSPC...Q
gi|42822874|ref|NP_976319.1|      .....................................................L.KDSPC...Q
gi|291463278|ref|NP_001167553.1|  .....................................................L.RHPEC...N
gi|291463280|ref|NP_001167554.1|  .....................................................L.RHPEC...N
gi|291463275|ref|NP_001167552.1|  .....................................................L.RHPEC...N
gi|8923473|ref|NP_060322.1|       .....................................................L.RHPEC...N
gi|194018484|ref|NP_659444.2|     .....................................................L.HEPTC...Q
gi|187937176|ref|NP_001120727.1|  .....................................................L.RNHKC...N
gi|33667040|ref|NP_789781.2|      .....................................................L.RSPRC...R
gi|46049100|ref|NP_631915.2|      .....................................................L.RNHKC...N
gi|113205085|ref|NP_079003.2|     .....................................................L.KSTS-...N
gi|188536116|ref|NP_001120933.1|  .....................................................L.QHPGC...N
gi|338797736|ref|NP_061994.1|     .....................................................L.KMNM-...N
gi|5174617|ref|NP_006083.1|       .....................................................-.-PCFS...R
gi|188536002|ref|NP_001120934.1|  .....................................................L.KHLLC...N
gi|116268109|ref|NP_115582.3|     .....................................................L.PGLP-...E
gi|15193292|ref|NP_150639.1|      .....................................................L.RHPQC...R
gi|118918429|ref|NP_849172.2|     .....................................................L.SGKDC...R
gi|289666780|ref|NP_001166250.1|  .....................................................L.HKNR-...T
gi|75709196|ref|NP_996611.2|      .....................................................L.RNHKC...N
gi|168986655|ref|NP_919263.2|     .....................................................L.VSNM-...A
gi|116268109|ref|NP_115582.3|     .....................................................A.VTCP-...T
gi|11545912|ref|NP_071445.1|      .....................................................L.GVCK-...-
gi|118918429|ref|NP_849172.2|     .....................................................L.CTNQ-...T
gi|289666778|ref|NP_699184.2|     .....................................................L.HKNR-...T
gi|27734755|ref|NP_116264.2|      .....................................................-.RGCG-...G
gi|4506411|ref|NP_002874.1|       .....................................................L.KSSACf..T
gi|284447308|ref|NP_036289.3|     .....................................................-.RGCR-...G
gi|289666782|ref|NP_001166251.1|  .....................................................L.HKNR-...T
gi|74271814|ref|NP_001028225.1|   .....................................................L.RQPSC...K
gi|7662386|ref|NP_055737.1|       .....................................................L.RQPSC...K
gi|14719829|ref|NP_127497.1|      .....................................................L.RQPSC...K
gi|296531375|ref|NP_001171835.1|  .....................................................-.RGCG-...G
gi|226342931|ref|NP_079101.3|     .....................................................-.-SLPP...S
gi|308818204|ref|NP_001184224.1|  .....................................................F.KPLK-...S
gi|4557543|ref|NP_001384.1|       .....................................................F.KPLK-...S
gi|21389431|ref|NP_653221.1|      .....................................................I.GRFQ-...N
gi|14719835|ref|NP_127500.1|      .....................................................L.RQPSC...K
gi|14719833|ref|NP_127499.1|      .....................................................L.RQPSC...K
gi|34878690|ref|NP_899632.1|      .....................................................L.KHLLC...N
gi|229577123|ref|NP_872345.2|     .....................................................I.KACH-...T
gi|6912466|ref|NP_036436.1|       .....................................................H.GKQI-...S
gi|156415984|ref|NP_037485.2|     .....................................................L.EQCP-...S
gi|7657647|ref|NP_055363.1|       .....................................................-.-----...-
gi|7657649|ref|NP_055362.1|       .....................................................-.-----...-
gi|289666746|ref|NP_699181.2|     .....................................................Q.GHST-...-
gi|197333692|ref|NP_001127948.1|  .....................................................L.KKMV-...N
gi|21245134|ref|NP_056165.1|      .....................................................L.KKMV-...N
gi|161333852|ref|NP_659469.3|     .....................................................-.ERCP-...N
gi|284447314|ref|NP_001165184.1|  .....................................................-.-----...-
gi|260763922|ref|NP_001159588.1|  .....................................................-.-----...-
gi|4507553|ref|NP_003266.1|       .....................................................-.-----...-
gi|21361547|ref|NP_002930.2|      .....................................................L.QQCQ-...-
gi|42794608|ref|NP_976318.1|      .....................................................L.QQCQ-...-
gi|42822864|ref|NP_976322.1|      .....................................................L.QQCQ-...-
gi|42822866|ref|NP_976323.1|      .....................................................L.QQCQ-...-
gi|42822868|ref|NP_976321.1|      .....................................................L.QQCQ-...-
gi|42822870|ref|NP_976320.1|      .....................................................L.QQCQ-...-
gi|42822872|ref|NP_976317.1|      .....................................................L.QQCQ-...-
gi|42822874|ref|NP_976319.1|      .....................................................L.QQCQ-...-
gi|62912470|ref|NP_001017403.1|   .....................................................F.QYLP-...K
gi|38348406|ref|NP_940967.1|      .....................................................G.EAAF-...E
gi|187608777|ref|NP_038460.4|     .....................................................L.HACP-...L
gi|16306595|ref|NP_005974.2|      .....................................................L.SSCS-...R
gi|22748931|ref|NP_689654.1|      .....................................................A.EGCL-...G
gi|150378503|ref|NP_997046.1|     .....................................................-.-----...-
gi|4504379|ref|NP_003658.1|       .....................................................F.QHLP-...E
gi|255683361|ref|NP_001156787.2|  .....................................................-.-GCL-...K
gi|61175232|ref|NP_001012992.1|   .....................................................L.RDNA-...-
gi|54607116|ref|NP_938012.2|      .....................................................-.-----...-
gi|20302168|ref|NP_619542.1|      .....................................................-.-KLPS...S
gi|21450705|ref|NP_659436.1|      .....................................................-.-----...-
gi|112380630|ref|NP_036266.2|     .....................................................-.-----...-
gi|291190783|ref|NP_001167448.1|  .....................................................F.SSSL-...A
gi|291190781|ref|NP_060110.4|     .....................................................F.SSSL-...A
gi|66392157|ref|NP_001013860.1|   .....................................................L.SRAR-...T
gi|19924149|ref|NP_612564.1|      .....................................................-.VDLP-...S
gi|312433960|ref|NP_001186067.1|  .....................................................L.GNLK-...N
gi|312433962|ref|NP_001186068.1|  .....................................................L.GNLK-...N
gi|40788015|ref|NP_067032.3|      .....................................................L.GNLK-...N
gi|16306588|ref|NP_036292.2|      .....................................................L.NFCS-...E
gi|14249170|ref|NP_116026.1|      .....................................................-.-----...-
gi|156938257|ref|NP_612369.3|     .....................................................F.SSAY-...T
gi|161333854|ref|NP_001104508.1|  .....................................................-.-PLK-...Q
gi|19718734|ref|NP_003255.2|      vidpgkvetltirrlhiprfylfydlstlysltervkritvenskvflvpcllS.QHLK-...S
gi|149274651|ref|NP_115547.1|     .....................................................-.-----...-
gi|149274621|ref|NP_001092272.1|  .....................................................-.-----...-
gi|291190781|ref|NP_060110.4|     .....................................................L.AQPN-...A
gi|291190783|ref|NP_001167448.1|  .....................................................L.AQPN-...A
gi|163965441|ref|NP_653303.2|     .....................................................L.PPLT-...Q
gi|161333852|ref|NP_659469.3|     .....................................................-.RHFH-...N
gi|190194416|ref|NP_077302.3|     .....................................................L.RDAE-...G
gi|21264320|ref|NP_612202.1|      .....................................................L.QHQGC...G
gi|25777608|ref|NP_078894.2|      .....................................................L.GSGRH...A
gi|218931148|ref|NP_001136357.1|  .....................................................-.-----...-
gi|156938257|ref|NP_612369.3|     .....................................................L.AQPN-...A
gi|156938336|ref|NP_000237.2|     ..........tqrtrsssedtagelpavrdlkklefalgpvsgpqafpklvriL.TAFS-...S
gi|54112380|ref|NP_001005366.1|   .....................................................-.--PT-...-
gi|54112382|ref|NP_115979.3|      .....................................................-.--PT-...-
gi|157168349|ref|NP_001093254.2|  .....................................................-.-----...Q
gi|118442828|ref|NP_001072983.1|  .....................................................-.DQLR-...H
gi|4507375|ref|NP_003184.1|       .....................................................-.DQLR-...H
gi|116268109|ref|NP_115582.3|     .....................................................L.SLCP-...R
gi|25777610|ref|NP_733840.1|      .....................................................L.GSGRH...A
gi|164663798|ref|NP_001106873.1|  .....................................................-.-----...-
gi|66392157|ref|NP_001013860.1|   .....................................................L.SRPN-...V
gi|161333854|ref|NP_001104508.1|  .....................................................-.RHFH-...N
gi|16306580|ref|NP_036440.1|      .....................................................T.SSCP-...L
gi|341916269|ref|XP_003403438.1|  .....................................................L.VSCK-...K
gi|119393876|ref|NP_075043.1|     .....................................................L.VSCK-...K
gi|341916267|ref|XP_003403437.1|  .....................................................L.VSCK-...K
gi|119393878|ref|NP_004527.2|     .....................................................L.VSCK-...K
gi|341916263|ref|XP_003403435.1|  .....................................................L.VSCK-...K
gi|40255157|ref|NP_700356.2|      .....................................................-.-HLQ-...S
gi|16306576|ref|NP_036294.1|      .....................................................LqKGCP-...Q
gi|302129689|ref|NP_001180464.1|  .....................................................L.GCCQ-...S
gi|302129687|ref|NP_001180463.1|  .....................................................L.GCCQ-...S
gi|16306572|ref|NP_036293.1|      .....................................................L.GCCQ-...S
gi|341915644|ref|XP_003403561.1|  .....................................................-.-----...N
gi|341913879|ref|XP_003403707.1|  .....................................................-.-----...N
gi|61742136|ref|NP_078831.3|      .....................................................LqKGCP-...Q
gi|38569471|ref|NP_006360.3|      .....................................................L.KASG-...S
gi|16306591|ref|NP_036295.1|      .....................................................L.LTLR-...A
gi|51873034|ref|NP_001004055.1|   .....................................................L.LTLR-...A
gi|341916265|ref|XP_003403436.1|  .....................................................L.VSCK-...K
gi|7661860|ref|NP_055480.1|       .....................................................L.QASAA...T
gi|122937351|ref|NP_001073947.1|  .....................................................L.SQASR...T
gi|46249367|ref|NP_996836.1|      .....................................................L.ERASA...T
gi|46249369|ref|NP_996837.1|      .....................................................L.ERASA...T
gi|46249371|ref|NP_996838.1|      .....................................................L.ERASA...T
gi|46249373|ref|NP_996839.1|      .....................................................L.ERASA...T
gi|5174641|ref|NP_006106.1|       .....................................................L.ERASA...T
gi|88942379|ref|XP_933494.1|      .....................................................L.EKVAA...T
gi|148356236|ref|NP_001091846.1|  .....................................................L.EKVAA...T
gi|61102721|ref|NP_001010890.1|   .....................................................L.EKVAA...T
gi|153792112|ref|NP_001093322.1|  .....................................................L.EKVAA...T
gi|153945800|ref|NP_001093584.1|  .....................................................L.EKVAA...T
gi|61696142|ref|NP_001013425.1|   .....................................................L.EKVAA...T
gi|226437621|ref|NP_001139816.1|  .....................................................L.EKVAA...T
gi|59958373|ref|NP_001009611.1|   .....................................................L.EKVAA...T
gi|58219004|ref|NP_001010889.1|   .....................................................L.EKVAA...T
gi|153791443|ref|NP_001093320.1|  .....................................................L.EKVAA...T
gi|310118528|ref|XP_003118894.1|  .....................................................L.EKVAA...T
gi|310118526|ref|XP_001130065.3|  .....................................................L.EKVAA...T
gi|55742693|ref|NP_078922.1|      .....................................................-.-----...-
gi|194306635|ref|NP_001093260.2|  .....................................................L.EKVAA...T
gi|66954681|ref|NP_001019832.1|   .....................................................L.EKIAA...S
gi|59676593|ref|NP_001012277.1|   .....................................................L.EQVVA...T
gi|59676587|ref|NP_001012276.1|   .....................................................L.EQVVA...T
gi|12738831|ref|NP_075389.1|      .....................................................L.EKIAA...S
gi|194306638|ref|NP_001013714.3|  .....................................................L.EKVAA...T
gi|8923179|ref|NP_060173.1|       .....................................................-.-SLPS...T
gi|124249372|ref|NP_001074299.1|  .....................................................L.EQAEA...T
gi|154800493|ref|NP_001094101.1|  .....................................................L.EKVAA...T
gi|29789255|ref|NP_085132.1|      .....................................................Q.RELK-...E
gi|194018550|ref|NP_938204.2|     .....................................................Q.RELK-...E
gi|157426875|ref|NP_079239.3|     .....................................................V.ASCC-...N
gi|33589814|ref|NP_006327.2|      .....................................................L.RPLN-...S
gi|12738834|ref|NP_075390.1|      .....................................................L.EKIAA...S
gi|341915238|ref|XP_938952.6|     .....................................................-.-----...-
gi|153792140|ref|NP_001093324.1|  .....................................................L.EKIAA...S
gi|16506299|ref|NP_443172.1|      .....................................................-.-----...-
gi|194018546|ref|NP_001034450.2|  .....................................................L.EKVAA...T
gi|226437632|ref|NP_001004339.2|  .....................................................L.CSNRWiqqN
gi|113865933|ref|NP_001038945.1|  .....................................................L.EKVAA...T
gi|116268109|ref|NP_115582.3|     .....................................................-.-----...-
gi|157426839|ref|NP_001093321.1|  .....................................................L.EKVAA...T
gi|268832194|ref|NP_001161343.1|  .....................................................-.-----...-
gi|268832172|ref|NP_060505.2|     .....................................................-.-----...-
gi|268830752|ref|NP_001161339.1|  .....................................................-.-----...-
gi|165932385|ref|NP_001107039.1|  .....................................................-.-----...-
gi|134288867|ref|NP_997527.2|     .....................................................L.SSHGA...V
gi|23397500|ref|NP_694962.1|      .....................................................L.KKMGK...R
gi|148922963|ref|NP_036291.2|     .....................................................-.ANNSD...T
gi|16306584|ref|NP_036290.1|      .....................................................-.-----...-
gi|45505155|ref|NP_110420.3|      .....................................................W.-----...-
gi|45545409|ref|NP_995308.1|      .....................................................W.-----...-
gi|22547146|ref|NP_060848.2|      .....................................................L.EACP-...R
gi|51558774|ref|NP_001003803.1|   .....................................................-.-----...-
gi|289803020|ref|NP_001073879.2|  .....................................................-.RCWP-...H
gi|158321897|ref|NP_703148.4|     .....................................................-.-----...-
gi|28827813|ref|NP_789792.1|      .....................................................-.-----...-


                                    0                                                               
                                    |                                                               
d1a4ya_                             LE......AL............................................KL...E..S.
gi|21955154|ref|NP_653288.1|      LQ......MI............................................QL...R..K.
gi|33519450|ref|NP_789790.2|      IE......EL............................................IL...G..K.
gi|28827813|ref|NP_789792.1|      LE......RL............................................SL...E..S.
gi|119395764|ref|NP_001073289.1|  LK......KL............................................WL...V..S.
gi|34878693|ref|NP_004886.3|      LK......KL............................................WL...V..S.
gi|158321897|ref|NP_703148.4|     LQ......KL............................................IL...E..D.
gi|194018482|ref|NP_604393.2|     VK......EL............................................AL...V..N.
gi|110624785|ref|NP_789780.2|     LK......YL............................................CL...E..K.
gi|21361547|ref|NP_002930.2|      LE......AL............................................KL...E..S.
gi|42794608|ref|NP_976318.1|      LE......AL............................................KL...E..S.
gi|42822864|ref|NP_976322.1|      LE......AL............................................KL...E..S.
gi|42822866|ref|NP_976323.1|      LE......AL............................................KL...E..S.
gi|42822868|ref|NP_976321.1|      LE......AL............................................KL...E..S.
gi|42822870|ref|NP_976320.1|      LE......AL............................................KL...E..S.
gi|42822872|ref|NP_976317.1|      LE......AL............................................KL...E..S.
gi|42822874|ref|NP_976319.1|      LE......AL............................................KL...E..S.
gi|291463278|ref|NP_001167553.1|  LR......YL............................................GL...V..S.
gi|291463280|ref|NP_001167554.1|  LR......YL............................................GL...V..S.
gi|291463275|ref|NP_001167552.1|  LR......YL............................................GL...V..S.
gi|8923473|ref|NP_060322.1|       LR......YL............................................GL...V..S.
gi|194018484|ref|NP_659444.2|     IS......HL............................................SL...M..K.
gi|187937176|ref|NP_001120727.1|  LQ......YL............................................RL...G..G.
gi|33667040|ref|NP_789781.2|      LQ......CL............................................RL...E..D.
gi|46049100|ref|NP_631915.2|      LQ......YL............................................RL...G..G.
gi|113205085|ref|NP_079003.2|     LK......VL............................................KL...H..S.
gi|188536116|ref|NP_001120933.1|  IR......RL............................................WL...G..R.
gi|338797736|ref|NP_061994.1|     LR......EL............................................YL...A..D.
gi|5174617|ref|NP_006083.1|       LT......VL............................................RL...S..V.
gi|188536002|ref|NP_001120934.1|  LK......KL............................................WL...V..S.
gi|116268109|ref|NP_115582.3|     LR......KI............................................DL...S..G.
gi|15193292|ref|NP_150639.1|      LQ......MI............................................QL...R..K.
gi|118918429|ref|NP_849172.2|     IQ......KI............................................SL...A..E.
gi|289666780|ref|NP_001166250.1|  LK......YL............................................RM...T..G.
gi|75709196|ref|NP_996611.2|      LQ......YL............................................RL...G..G.
gi|168986655|ref|NP_919263.2|     VT......KL............................................EL...E..D.
gi|116268109|ref|NP_115582.3|     VR......MLqareadlifllspptettaelqrapdlqesdgqrkgaqsrsltlRL...Q..K.
gi|11545912|ref|NP_071445.1|      --......AL............................................YL...R..D.
gi|118918429|ref|NP_849172.2|     LL......SL............................................SL...R..E.
gi|289666778|ref|NP_699184.2|     LK......YL............................................RM...T..G.
gi|27734755|ref|NP_116264.2|      LK......AL............................................FL...K..G.
gi|4506411|ref|NP_002874.1|       LQ......EL............................................KL...N..N.
gi|284447308|ref|NP_036289.3|     LK......AL............................................LL...R..G.
gi|289666782|ref|NP_001166251.1|  LK......YL............................................RM...T..G.
gi|74271814|ref|NP_001028225.1|   LQ......RL............................................QL...V..S.
gi|7662386|ref|NP_055737.1|       LQ......RL............................................QL...V..S.
gi|14719829|ref|NP_127497.1|      LQ......RL............................................QL...V..S.
gi|296531375|ref|NP_001171835.1|  LK......AL............................................FL...K..G.
gi|226342931|ref|NP_079101.3|     LE......RL............................................HL...Q..N.
gi|308818204|ref|NP_001184224.1|  LA......YL............................................RL...G..K.
gi|4557543|ref|NP_001384.1|       LA......YL............................................RL...G..K.
gi|21389431|ref|NP_653221.1|      LI......VL............................................DL...S..R.
gi|14719835|ref|NP_127500.1|      LQ......RL............................................QL...V..S.
gi|14719833|ref|NP_127499.1|      LQ......RL............................................QL...V..S.
gi|34878690|ref|NP_899632.1|      LK......KL............................................WL...V..N.
gi|229577123|ref|NP_872345.2|     LK......IF............................................KL...T..R.
gi|6912466|ref|NP_036436.1|       IR......YL............................................DM...T..D.
gi|156415984|ref|NP_037485.2|     I-......--............................................--...-..-.
gi|7657647|ref|NP_055363.1|       --......--............................................--...-..-.
gi|7657649|ref|NP_055362.1|       --......--............................................--...-..-.
gi|289666746|ref|NP_699181.2|     -H......TL............................................RL...L..S.
gi|197333692|ref|NP_001127948.1|  LK......SL............................................EL...I..S.
gi|21245134|ref|NP_056165.1|      LK......SL............................................EL...I..S.
gi|161333852|ref|NP_659469.3|     LN......YL............................................SL...R..N.
gi|284447314|ref|NP_001165184.1|  --......--............................................--...-..-.
gi|260763922|ref|NP_001159588.1|  --......--............................................--...-..-.
gi|4507553|ref|NP_003266.1|       --......--............................................--...-..-.
gi|21361547|ref|NP_002930.2|      --......VV............................................RL...D..D.
gi|42794608|ref|NP_976318.1|      --......VV............................................RL...D..D.
gi|42822864|ref|NP_976322.1|      --......VV............................................RL...D..D.
gi|42822866|ref|NP_976323.1|      --......VV............................................RL...D..D.
gi|42822868|ref|NP_976321.1|      --......VV............................................RL...D..D.
gi|42822870|ref|NP_976320.1|      --......VV............................................RL...D..D.
gi|42822872|ref|NP_976317.1|      --......VV............................................RL...D..D.
gi|42822874|ref|NP_976319.1|      --......VV............................................RL...D..D.
gi|62912470|ref|NP_001017403.1|   LH......TL............................................SL...N..G.
gi|38348406|ref|NP_940967.1|      LE......TL............................................DL...S..H.
gi|187608777|ref|NP_038460.4|     LS......TL............................................RL...Q..A.
gi|16306595|ref|NP_005974.2|      LD......EL............................................NL...S..W.
gi|22748931|ref|NP_689654.1|      LE......QL............................................TL...Q..D.
gi|150378503|ref|NP_997046.1|     --......--............................................--...-..-.
gi|4504379|ref|NP_003658.1|       LR......TL............................................TL...N..G.
gi|255683361|ref|NP_001156787.2|  LQ......RI............................................YM...Q..E.
gi|61175232|ref|NP_001012992.1|   VR......LL............................................SL...R..G.
gi|54607116|ref|NP_938012.2|      --......--............................................--...-..-.
gi|20302168|ref|NP_619542.1|      LR......KL............................................FL...S..N.
gi|21450705|ref|NP_659436.1|      --......--............................................--...-..-.
gi|112380630|ref|NP_036266.2|     --......--............................................--...-..-.
gi|291190783|ref|NP_001167448.1|  LM......HI............................................NL...S..G.
gi|291190781|ref|NP_060110.4|     LM......HI............................................NL...S..G.
gi|66392157|ref|NP_001013860.1|   LR......HL............................................GL...A..G.
gi|19924149|ref|NP_612564.1|      LE......FL............................................DL...S..R.
gi|312433960|ref|NP_001186067.1|  LT......KL............................................IM...D..N.
gi|312433962|ref|NP_001186068.1|  LT......KL............................................IM...D..N.
gi|40788015|ref|NP_067032.3|      LT......KL............................................IM...D..N.
gi|16306588|ref|NP_036292.2|      LQ......HL............................................SL...G..S.
gi|14249170|ref|NP_116026.1|      VQ......HM............................................DL...S..N.
gi|156938257|ref|NP_612369.3|     LS......HV............................................NL...S..A.
gi|161333854|ref|NP_001104508.1|  LT......VL............................................NL...A..N.
gi|19718734|ref|NP_003255.2|      LE......YL............................................DL...S..E.
gi|149274651|ref|NP_115547.1|     --......--............................................--...-..-.
gi|149274621|ref|NP_001092272.1|  --......--............................................--...-..-.
gi|291190781|ref|NP_060110.4|     IV......HL............................................DL...S..N.
gi|291190783|ref|NP_001167448.1|  IV......HL............................................DL...S..N.
gi|163965441|ref|NP_653303.2|     LQ......AI............................................NL...W..K.
gi|161333852|ref|NP_659469.3|     LQ......NL............................................SL...A..Y.
gi|190194416|ref|NP_077302.3|     LQ......EL............................................AL...A..P.
gi|21264320|ref|NP_612202.1|      LQ......TL............................................SL...A..S.
gi|25777608|ref|NP_078894.2|      LD......EV............................................NL...A..S.
gi|218931148|ref|NP_001136357.1|  --......--............................................--...-..-.
gi|156938257|ref|NP_612369.3|     LV......HL............................................DL...SgtD.
gi|156938336|ref|NP_000237.2|     LQ......HL............................................DLdalS..E.
gi|54112380|ref|NP_001005366.1|   --......--............................................--...-..D.
gi|54112382|ref|NP_115979.3|      --......--............................................--...-..D.
gi|157168349|ref|NP_001093254.2|  LR......EL............................................LL...PppD.
gi|118442828|ref|NP_001072983.1|  LE......VL............................................NV...S..E.
gi|4507375|ref|NP_003184.1|       LE......VL............................................NV...S..E.
gi|116268109|ref|NP_115582.3|     VK......KV............................................DL...R..Sl
gi|25777610|ref|NP_733840.1|      LD......EV............................................NL...A..S.
gi|164663798|ref|NP_001106873.1|  --......--............................................--...-..-.
gi|66392157|ref|NP_001013860.1|   LS......FL............................................NL...A..G.
gi|161333854|ref|NP_001104508.1|  LQ......NL............................................SL...A..Y.
gi|16306580|ref|NP_036440.1|      LR......TL............................................DL...R..W.
gi|341916269|ref|XP_003403438.1|  LT......EI............................................KF...S..D.
gi|119393876|ref|NP_075043.1|     LT......EI............................................KF...S..D.
gi|341916267|ref|XP_003403437.1|  LT......EI............................................KF...S..D.
gi|119393878|ref|NP_004527.2|     LT......EI............................................KF...S..D.
gi|341916263|ref|XP_003403435.1|  LT......EI............................................KF...S..D.
gi|40255157|ref|NP_700356.2|      LR......EV............................................KL...N..N.
gi|16306576|ref|NP_036294.1|      LQ......VL............................................RL...L..N.
gi|302129689|ref|NP_001180464.1|  LR......HL............................................DL...S..G.
gi|302129687|ref|NP_001180463.1|  LR......HL............................................DL...S..G.
gi|16306572|ref|NP_036293.1|      LR......HL............................................DL...S..G.
gi|341915644|ref|XP_003403561.1|  LK......GF............................................FI...L..N.
gi|341913879|ref|XP_003403707.1|  LK......GF............................................FI...L..N.
gi|61742136|ref|NP_078831.3|      LQ......VL............................................RL...L..N.
gi|38569471|ref|NP_006360.3|      LQ......QL............................................SL...D..S.
gi|16306591|ref|NP_036295.1|      LQ......EL............................................DL...T..A.
gi|51873034|ref|NP_001004055.1|   LQ......EL............................................DL...T..A.
gi|341916265|ref|XP_003403436.1|  LT......EI............................................KF...S..D.
gi|7661860|ref|NP_055480.1|       LL......HL............................................EL...T..E.
gi|122937351|ref|NP_001073947.1|  LR......IL............................................TL...E..E.
gi|46249367|ref|NP_996836.1|      LQ......DL............................................VF...D..E.
gi|46249369|ref|NP_996837.1|      LQ......DL............................................VF...D..E.
gi|46249371|ref|NP_996838.1|      LQ......DL............................................VF...D..E.
gi|46249373|ref|NP_996839.1|      LQ......DL............................................VF...D..E.
gi|5174641|ref|NP_006106.1|       LQ......DL............................................VF...D..E.
gi|88942379|ref|XP_933494.1|      LE......YL............................................DL...D..D.
gi|148356236|ref|NP_001091846.1|  LE......YL............................................DL...D..D.
gi|61102721|ref|NP_001010890.1|   LE......YL............................................DL...D..D.
gi|153792112|ref|NP_001093322.1|  LE......YL............................................DL...D..D.
gi|153945800|ref|NP_001093584.1|  LE......YL............................................DL...D..D.
gi|61696142|ref|NP_001013425.1|   LE......YL............................................DL...D..D.
gi|226437621|ref|NP_001139816.1|  LE......YL............................................DL...D..D.
gi|59958373|ref|NP_001009611.1|   LE......YL............................................DL...D..D.
gi|58219004|ref|NP_001010889.1|   LE......YL............................................DL...D..D.
gi|153791443|ref|NP_001093320.1|  LQ......TL............................................FL...V..D.
gi|310118528|ref|XP_003118894.1|  LE......YL............................................DL...D..D.
gi|310118526|ref|XP_001130065.3|  LE......YL............................................DL...D..D.
gi|55742693|ref|NP_078922.1|      --......--............................................--...-..-.
gi|194306635|ref|NP_001093260.2|  LQ......TL............................................FL...V..D.
gi|66954681|ref|NP_001019832.1|   LE......TL............................................IL...E..G.
gi|59676593|ref|NP_001012277.1|   LQ......TL............................................DL...E..D.
gi|59676587|ref|NP_001012276.1|   LQ......TL............................................DL...E..D.
gi|12738831|ref|NP_075389.1|      LK......TL............................................IL...E..G.
gi|194306638|ref|NP_001013714.3|  LQ......TL............................................FL...V..D.
gi|8923179|ref|NP_060173.1|       LR......TL............................................EL...H..S.
gi|124249372|ref|NP_001074299.1|  LQ......TL............................................DL...E..D.
gi|154800493|ref|NP_001094101.1|  LQ......TL............................................FL...V..D.
gi|29789255|ref|NP_085132.1|      LQrkggptRL............................................TL...P..S.
gi|194018550|ref|NP_938204.2|     LQrkggptRL............................................TL...P..S.
gi|157426875|ref|NP_079239.3|     LR......HL............................................NL...SaaH.
gi|33589814|ref|NP_006327.2|      LA......AL............................................DL...S..G.
gi|12738834|ref|NP_075390.1|      LE......TL............................................VL...E..G.
gi|341915238|ref|XP_938952.6|     --......--............................................--...-..-.
gi|153792140|ref|NP_001093324.1|  LE......TL............................................IL...E..G.
gi|16506299|ref|NP_443172.1|      --......--............................................--...-..-.
gi|194018546|ref|NP_001034450.2|  LK......TL............................................VL...K..D.
gi|226437632|ref|NP_001004339.2|  LQ......CL............................................LL...D..S.
gi|113865933|ref|NP_001038945.1|  LE......IL............................................TL...K..D.
gi|116268109|ref|NP_115582.3|     --......-L............................................RL...A..H.
gi|157426839|ref|NP_001093321.1|  LE......IL............................................TL...K..D.
gi|268832194|ref|NP_001161343.1|  --......--............................................--...-..-.
gi|268832172|ref|NP_060505.2|     --......--............................................--...-..-.
gi|268830752|ref|NP_001161339.1|  --......--............................................--...-..-.
gi|165932385|ref|NP_001107039.1|  --......--............................................--...-..-.
gi|134288867|ref|NP_997527.2|     LA......VL............................................DL...S..F.
gi|23397500|ref|NP_694962.1|      LD......YL............................................NL...K..G.
gi|148922963|ref|NP_036291.2|     LR......LP............................................KM...S..S.
gi|16306584|ref|NP_036290.1|      --......--............................................--...-..-.
gi|45505155|ref|NP_110420.3|      --......--............................................--...-..-.
gi|45545409|ref|NP_995308.1|      --......--............................................--...-..-.
gi|22547146|ref|NP_060848.2|      LR......AL............................................GL...H..L.
gi|51558774|ref|NP_001003803.1|   --......--............................................--...-..-.
gi|289803020|ref|NP_001073879.2|  LR......AL............................................GV...G..G.
gi|158321897|ref|NP_703148.4|     --......--............................................--...-..-.
gi|28827813|ref|NP_789792.1|      --......--............................................--...-..-.


                                                             210        220                         
                                                               |          |                         
d1a4ya_                             .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|21955154|ref|NP_653288.1|      .......................C..QLES.GACQEMASV.L.........GTN..........
gi|33519450|ref|NP_789790.2|      .......................C..DISS.EVCEDIASV.L.........ACN..........
gi|28827813|ref|NP_789792.1|      .......................C..GLTE.AGCEYLSLA.L.........ISN..........
gi|119395764|ref|NP_001073289.1|  .......................C..CLTS.ACCQDLASV.L.........STS..........
gi|34878693|ref|NP_004886.3|      .......................C..CLTS.ACCQDLASV.L.........STS..........
gi|158321897|ref|NP_703148.4|     .......................C..GITA.TGCQSLASA.L.........VSN..........
gi|194018482|ref|NP_604393.2|     .......................C..HLSP.IDCEVLAGL.L.........TNN..........
gi|110624785|ref|NP_789780.2|     .......................C..NLSA.ASCQDLALF.L.........TSI..........
gi|21361547|ref|NP_002930.2|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42794608|ref|NP_976318.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42822864|ref|NP_976322.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42822866|ref|NP_976323.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42822868|ref|NP_976321.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42822870|ref|NP_976320.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42822872|ref|NP_976317.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|42822874|ref|NP_976319.1|      .......................C..GVTS.DNCRDLCGI.V.........ASK..........
gi|291463278|ref|NP_001167553.1|  .......................C..SATT.QQWADLSLA.L.........EVN..........
gi|291463280|ref|NP_001167554.1|  .......................C..SATT.QQWADLSLA.L.........EVN..........
gi|291463275|ref|NP_001167552.1|  .......................C..SATT.QQWADLSLA.L.........EVN..........
gi|8923473|ref|NP_060322.1|       .......................C..SATT.QQWADLSLA.L.........EVN..........
gi|194018484|ref|NP_659444.2|     .......................C..DLRA.SECEEIASL.L.........ISG..........
gi|187937176|ref|NP_001120727.1|  .......................H..CATP.EQWAEFFYV.L.........KAN..........
gi|33667040|ref|NP_789781.2|      .......................C..LATP.RIWTDLGNN.L.........QGN..........
gi|46049100|ref|NP_631915.2|      .......................H..CATP.EQWAEFFYV.L.........KAN..........
gi|113205085|ref|NP_079003.2|     .......................C..GLSQ.KSVKILDAA.F.........RYL..........
gi|188536116|ref|NP_001120933.1|  .......................C..GLSH.ECCFDISLV.L.........SSN..........
gi|338797736|ref|NP_061994.1|     .......................N..KLNGlQDSAQLGNL.L.........KFN..........
gi|5174617|ref|NP_006083.1|       .......................N..QITD.GGVKVLSEE.L.........TKY..........
gi|188536002|ref|NP_001120934.1|  .......................C..CLTS.ACCQDLASV.L.........STS..........
gi|116268109|ref|NP_115582.3|     .......................N..SISS.AGGVQLAES.L.........VLC..........
gi|15193292|ref|NP_150639.1|      .......................C..QLES.GACQEMASV.L.........GTN..........
gi|118918429|ref|NP_849172.2|     .......................N..QISN.KGAKALARS.L.........LVN..........
gi|289666780|ref|NP_001166250.1|  .......................N..KIEN.KGGMFFAAM.L.........QIN..........
gi|75709196|ref|NP_996611.2|      .......................H..CATP.EQWAEFFYV.L.........KAN..........
gi|168986655|ref|NP_919263.2|     .......................N..CIME.EGVLSLVEM.L.........QEN..........
gi|116268109|ref|NP_115582.3|     .......................C..QLQV.HDAEALIAL.L.........QEG..........
gi|11545912|ref|NP_071445.1|      .......................N..NISD.RGICKLIEC.A.........LHC..........
gi|118918429|ref|NP_849172.2|     .......................N..SISP.EGAQAIAHA.L.........CAN..........
gi|289666778|ref|NP_699184.2|     .......................N..KIEN.KGGMFFAAM.L.........QIN..........
gi|27734755|ref|NP_116264.2|      .......................Ct.QLED.EALKYIG--.-.........AHC..........
gi|4506411|ref|NP_002874.1|       .......................C..GMGI.GGGKILAAA.L.........TEChrkssaqgkp
gi|284447308|ref|NP_036289.3|     .......................Ct.QLED.EALKHIQ--.-.........NYC..........
gi|289666782|ref|NP_001166251.1|  .......................N..KIEN.KGGMFFAAM.L.........QIN..........
gi|74271814|ref|NP_001028225.1|   .......................C..GLTS.DCCQDLASV.L.........SAS..........
gi|7662386|ref|NP_055737.1|       .......................C..GLTS.DCCQDLASV.L.........SAS..........
gi|14719829|ref|NP_127497.1|      .......................C..GLTS.DCCQDLASV.L.........SAS..........
gi|296531375|ref|NP_001171835.1|  .......................Ct.QLED.EALKYIG--.-.........AHC..........
gi|226342931|ref|NP_079101.3|     .......................N..LISK.----VPRGA.L.........SRQ..........
gi|308818204|ref|NP_001184224.1|  .......................N..KFRI.-----IPQG.L.........P--..........
gi|4557543|ref|NP_001384.1|       .......................N..KFRI.-----IPQG.L.........P--..........
gi|21389431|ref|NP_653221.1|      .......................N..TISE.-----IPPG.I.........GLL..........
gi|14719835|ref|NP_127500.1|      .......................C..GLTS.DCCQDLASV.L.........SAS..........
gi|14719833|ref|NP_127499.1|      .......................C..GLTS.DCCQDLASV.L.........SAS..........
gi|34878690|ref|NP_899632.1|      .......................S..GLTS.VCCSALSSV.L.........STN..........
gi|229577123|ref|NP_872345.2|     .......................S..KVDD.DKARIIIRS.L.........LDH..........
gi|6912466|ref|NP_036436.1|       .......................Cf.VLED.EGLHTIA--.-.........AHC..........
gi|156415984|ref|NP_037485.2|     .......................-..----.---------.-.........---..........
gi|7657647|ref|NP_055363.1|       .......................-..----.---------.-.........---..........
gi|7657649|ref|NP_055362.1|       .......................-..----.---------.-.........---..........
gi|289666746|ref|NP_699181.2|     .......................Cw.EITN.HGVVNVVHS.-.........---..........
gi|197333692|ref|NP_001127948.1|  .......................C..DLER.-----IPHS.I.........FSL..........
gi|21245134|ref|NP_056165.1|      .......................C..DLER.-----IPHS.I.........FSL..........
gi|161333852|ref|NP_659469.3|     .......................Ce.HLTA.QGIGYIVNI.-.........---..........
gi|284447314|ref|NP_001165184.1|  .......................-..----.---------.-.........NYC..........
gi|260763922|ref|NP_001159588.1|  .......................-..----.---------.-.........---..........
gi|4507553|ref|NP_003266.1|       .......................-..----.---------.-.........---..........
gi|21361547|ref|NP_002930.2|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42794608|ref|NP_976318.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42822864|ref|NP_976322.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42822866|ref|NP_976323.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42822868|ref|NP_976321.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42822870|ref|NP_976320.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42822872|ref|NP_976317.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|42822874|ref|NP_976319.1|      .......................C..GLTE.ARCKDISSA.L.........RVN..........
gi|62912470|ref|NP_001017403.1|   .......................Am.DIQE.------FPD.L.........KGT..........
gi|38348406|ref|NP_940967.1|      .......................N..QLLF.------FPL.L.........PQY..........
gi|187608777|ref|NP_038460.4|     .......................C..GFGP.SFFL-----.-.........SH-..........
gi|16306595|ref|NP_005974.2|      .......................Cf.DFTE.---------.-.........---..........
gi|22748931|ref|NP_689654.1|      .......................Cq.KLTD.LSLKHIS--.-.........RGL..........
gi|150378503|ref|NP_997046.1|     .......................-..----.---------.-.........---..........
gi|4504379|ref|NP_003658.1|       .......................As.QITE.------FPD.L.........TGT..........
gi|255683361|ref|NP_001156787.2|  .......................Nk.LVTD.QSVKAFA--.-.........EHC..........
gi|61175232|ref|NP_001012992.1|   .......................C..RLCD.RDFGRICRA.L.........AGA..........
gi|54607116|ref|NP_938012.2|      .......................-..----.---------.-.........---..........
gi|20302168|ref|NP_619542.1|      .......................T..QIKY.-----ISEEdF.........KGL..........
gi|21450705|ref|NP_659436.1|      .......................-..----.---------.-.........---..........
gi|112380630|ref|NP_036266.2|     .......................-..----.---------.-.........---..........
gi|291190783|ref|NP_001167448.1|  .......................T..KLSP.EPLKALLLG.L.........ACN..........
gi|291190781|ref|NP_060110.4|     .......................T..KLSP.EPLKALLLG.L.........ACN..........
gi|66392157|ref|NP_001013860.1|   .......................C..KLPP.DALRALLDG.L.........ALN..........
gi|19924149|ref|NP_612564.1|      .......................N..GLSF.KGCCSQSD-.-.........FGT..........
gi|312433960|ref|NP_001186067.1|  .......................I..KMNE.EDAIKLAEG.L.........KNL..........
gi|312433962|ref|NP_001186068.1|  .......................I..KMNE.EDAIKLAEG.L.........KNL..........
gi|40788015|ref|NP_067032.3|      .......................I..KMNE.EDAIKLAEG.L.........KNL..........
gi|16306588|ref|NP_036292.2|      .......................Cv.MIED.--YDVIASM.Ig........AKC..........
gi|14249170|ref|NP_116026.1|      .......................S..VIEV.---STLHGI.L.........SQC..........
gi|156938257|ref|NP_612369.3|     .......................T..KLPL.EALRALLQG.L.........SLN..........
gi|161333854|ref|NP_001104508.1|  .......................Cv.RIGD.MGLKQFLDG.-.........PAS..........
gi|19718734|ref|NP_003255.2|      .......................N..LMVE.EYLKNSACE.-.........DAW..........
gi|149274651|ref|NP_115547.1|     .......................-..----.---------.-.........---..........
gi|149274621|ref|NP_001092272.1|  .......................-..----.---------.-.........---..........
gi|291190781|ref|NP_060110.4|     .......................TecSLDM.VCGALLR--.-.........GCL..........
gi|291190783|ref|NP_001167448.1|  .......................TecSLDM.VCGALLR--.-.........GCL..........
gi|163965441|ref|NP_653303.2|     .......................V..GLTD.KTLTTFIEL.L.........PLC..........
gi|161333852|ref|NP_659469.3|     .......................Cr.RFTD.KGLQYLNLG.-.........NGC..........
gi|190194416|ref|NP_077302.3|     .......................CheWLSD.---EDLVPV.L.........ARN..........
gi|21264320|ref|NP_612202.1|      .......................V..ELSE.QSLQEL---.-.........---..........
gi|25777608|ref|NP_078894.2|      .......................C..QLDP.AGLRTLL--.-.........PVF..........
gi|218931148|ref|NP_001136357.1|  .......................-..----.---------.-.........---..........
gi|156938257|ref|NP_612369.3|     .......................C..VIDL.-----LLGA.Llh.......GCC..........
gi|156938336|ref|NP_000237.2|     .......................N..KIGD.EGVSQLSAT.F.........PQL..........
gi|54112380|ref|NP_001005366.1|   .......................N..RPGQ.------MDN.R.........SKL..........
gi|54112382|ref|NP_115979.3|      .......................N..RPGQ.------MDN.R.........SKL..........
gi|157168349|ref|NP_001093254.2|  .......................T..KPGQ.------TES.R.........GRL..........
gi|118442828|ref|NP_001072983.1|  .......................N..KLKF.PSGSVLT--.-.........GTL..........
gi|4507375|ref|NP_003184.1|       .......................N..KLKF.PSGSVLT--.-.........GTL..........
gi|116268109|ref|NP_115582.3|     hhatlhfrsneeeegvccgrftgC..SLSQ.EHVESLCWL.L.........SKC..........
gi|25777610|ref|NP_733840.1|      .......................C..QLDP.AGLRTLL--.-.........PVF..........
gi|164663798|ref|NP_001106873.1|  .......................-..----.---------.-.........---..........
gi|66392157|ref|NP_001013860.1|   .......................-..----.---------.-.........---..........
gi|161333854|ref|NP_001104508.1|  .......................Cr.RFTD.KGLQYLNLG.-.........NGC..........
gi|16306580|ref|NP_036440.1|      .......................Av.GIKD.PQIRDLLTP.PadkpgqdnrSKL..........
gi|341916269|ref|XP_003403438.1|  .......................S..FFQA.---VPFVAS.L.........PNF..........
gi|119393876|ref|NP_075043.1|     .......................S..FFQA.---VPFVAS.L.........PNF..........
gi|341916267|ref|XP_003403437.1|  .......................S..FFQA.---VPFVAS.L.........PNF..........
gi|119393878|ref|NP_004527.2|     .......................S..FFQA.---VPFVAS.L.........PNF..........
gi|341916263|ref|XP_003403435.1|  .......................S..FFQA.---VPFVAS.L.........PNF..........
gi|40255157|ref|NP_700356.2|      .......................N..ELET.-----IPNL.G.........PVS..........
gi|16306576|ref|NP_036294.1|      .......................Lm.WLPK.PPGRGVAPG.-.........PGF..........
gi|302129689|ref|NP_001180464.1|  .......................Ce.KITD.VALEKISRA.L.........GIL..........
gi|302129687|ref|NP_001180463.1|  .......................Ce.KITD.VALEKISRA.L.........GIL..........
gi|16306572|ref|NP_036293.1|      .......................Ce.KITD.VALEKISRA.L.........GIL..........
gi|341915644|ref|XP_003403561.1|  .......................Cp.DLTP.-----LA--.-.........---..........
gi|341913879|ref|XP_003403707.1|  .......................Cp.DLTP.-----LA--.-.........---..........
gi|61742136|ref|NP_078831.3|      .......................Lm.WLPK.PPGRGVAPG.-.........PGF..........
gi|38569471|ref|NP_006360.3|      .......................A..T---.---------.-.........---..........
gi|16306591|ref|NP_036295.1|      .......................Cs.KLTD.ASLAKVLQF.-.........---..........
gi|51873034|ref|NP_001004055.1|   .......................Cs.KLTD.ASLAKVLQF.-.........---..........
gi|341916265|ref|XP_003403436.1|  .......................S..FFQA.---VPFVAS.L.........PNF..........
gi|7661860|ref|NP_055480.1|       .......................C..QLAD.TQLLATLPI.L.........TQC..........
gi|122937351|ref|NP_001073947.1|  .......................C..GIVD.SHVGMLILG.L.........SPC..........
gi|46249367|ref|NP_996836.1|      .......................C..GITD.DQLLALLPS.L.........SHC..........
gi|46249369|ref|NP_996837.1|      .......................C..GITD.DQLLALLPS.L.........SHC..........
gi|46249371|ref|NP_996838.1|      .......................C..GITD.DQLLALLPS.L.........SHC..........
gi|46249373|ref|NP_996839.1|      .......................C..GITD.DQLLALLPS.L.........SHC..........
gi|5174641|ref|NP_006106.1|       .......................C..GITD.DQLLALLPS.L.........SHC..........
gi|88942379|ref|XP_933494.1|      .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|148356236|ref|NP_001091846.1|  .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|61102721|ref|NP_001010890.1|   .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|153792112|ref|NP_001093322.1|  .......................C..GIVD.SQVNAILPA.L.........SRC..........
gi|153945800|ref|NP_001093584.1|  .......................C..GIVD.SQVNAILPA.L.........SRC..........
gi|61696142|ref|NP_001013425.1|   .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|226437621|ref|NP_001139816.1|  .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|59958373|ref|NP_001009611.1|   .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|58219004|ref|NP_001010889.1|   .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|153791443|ref|NP_001093320.1|  .......................C..GIGD.SKLRVILPA.L.........SRC..........
gi|310118528|ref|XP_003118894.1|  .......................C..GIID.SQVNAILPA.L.........SRC..........
gi|310118526|ref|XP_001130065.3|  .......................C..GIID.SQVNAILPA.L.........SCC..........
gi|55742693|ref|NP_078922.1|      .......................-..--TD.-----IISG.L.........GSN..........
gi|194306635|ref|NP_001093260.2|  .......................C..GIGY.SKLRVILPA.L.........SRC..........
gi|66954681|ref|NP_001019832.1|   .......................C..QIHY.SQLSAILPG.L.........SHC..........
gi|59676593|ref|NP_001012277.1|   .......................C..GIMD.SQLSAILPV.L.........SRC..........
gi|59676587|ref|NP_001012276.1|   .......................C..GIMD.SQLSAILPV.L.........SRC..........
gi|12738831|ref|NP_075389.1|      .......................C..QIHY.SQLSAILPA.L.........SRC..........
gi|194306638|ref|NP_001013714.3|  .......................C..GIRD.SKLRVILPA.L.........SCC..........
gi|8923179|ref|NP_060173.1|       .......................C..EISM.AWLHKQQDP.-.........TV-..........
gi|124249372|ref|NP_001074299.1|  .......................C..GIVD.SQLSAILPA.L.........SRC..........
gi|154800493|ref|NP_001094101.1|  .......................C..GIRD.SKLRVILPA.L.........SCC..........
gi|29789255|ref|NP_085132.1|      .......................K..STDA.DLARLLSS-.-.........GSF..........
gi|194018550|ref|NP_938204.2|     .......................K..STDA.DLARLLSS-.-.........GSF..........
gi|157426875|ref|NP_079239.3|     .......................H..HSSE.GLGRHLCQL.L.........ARL..........
gi|33589814|ref|NP_006327.2|      .......................I..QTSD.------AAF.L.........TQW..........
gi|12738834|ref|NP_075390.1|      .......................C..QIHY.SQLSAILPG.L.........SCC..........
gi|341915238|ref|XP_938952.6|     .......................-..----.---------.-.........---..........
gi|153792140|ref|NP_001093324.1|  .......................C..QIHY.SQLSAILPG.L.........SHC..........
gi|16506299|ref|NP_443172.1|      .......................-..----.--------E.I.........KSF..........
gi|194018546|ref|NP_001034450.2|  .......................C..RIQD.PQLRVLLPA.L.........SHC..........
gi|226437632|ref|NP_001004339.2|  .......................T..SIPQ.NSRLLFF--.-.........SQL..........
gi|113865933|ref|NP_001038945.1|  .......................C..QIQD.SQLRVLLPA.L.........SRC..........
gi|116268109|ref|NP_115582.3|     .......................C..DLGA.HHSLLVGQL.M.........ETC..........
gi|157426839|ref|NP_001093321.1|  .......................C..QIQD.SQLRVLLPA.L.........SRC..........
gi|268832194|ref|NP_001161343.1|  .......................-..----.---------.-.........---..........
gi|268832172|ref|NP_060505.2|     .......................-..----.---------.-.........---..........
gi|268830752|ref|NP_001161339.1|  .......................-..----.---------.-.........---..........
gi|165932385|ref|NP_001107039.1|  .......................-..----.---------.-.........---..........
gi|134288867|ref|NP_997527.2|     .......................T..GLSD.ELLHLLLPS.L.........WAL..........
gi|23397500|ref|NP_694962.1|      .......................A..RLTV.EQGCQILDS.L.........SYM..........
gi|148922963|ref|NP_036291.2|     .......................Cp.HVSS.DGILCVA--.-.........DRC..........
gi|16306584|ref|NP_036290.1|      .......................-..----.---------.-.........---..........
gi|45505155|ref|NP_110420.3|      .......................-..--RS.GGFRNLHTIvL.........GAC..........
gi|45545409|ref|NP_995308.1|      .......................-..--RS.GGFRNLHTIvL.........GAC..........
gi|22547146|ref|NP_060848.2|      .......................A..SLSH.AILEAL---.-.........---..........
gi|51558774|ref|NP_001003803.1|   .......................-..----.---------.-.........---..........
gi|289803020|ref|NP_001073879.2|  .......................A..GCGV.QGLASLA--.-.........RNC..........
gi|158321897|ref|NP_703148.4|     .......................-..----.---------.-.........---..........
gi|28827813|ref|NP_789792.1|      .......................-..----.---------.-.........---..........


                                            230                                240               250
                                              |                                  |                 |
d1a4ya_                             A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|21955154|ref|NP_653288.1|      P....HLV..ELDLT.GN...ALE.....................DLGLRLLC........QGL
gi|33519450|ref|NP_789790.2|      S....KLK..HLSLV.EN...PLR.....................DEGMTLLC........EAL
gi|28827813|ref|NP_789792.1|      K....RLT..HLCLA.DN...VLG.....................DGGVKLMS........DAL
gi|119395764|ref|NP_001073289.1|  H....SLT..RLYVG.EN...ALG.....................DSGVAILC........EKA
gi|34878693|ref|NP_004886.3|      H....SLT..RLYVG.EN...ALG.....................DSGVAILC........EKA
gi|158321897|ref|NP_703148.4|     R....SLT..HLCLS.NN...SLG.....................NEGVNLLC........RSM
gi|194018482|ref|NP_604393.2|     K....KLT..YLNVS.CN...QL-.....................DTGVPLLC........EAL
gi|110624785|ref|NP_789780.2|     Q....HVT..RLCLG.FN...RLQ.....................DDGIKLLC........AAL
gi|21361547|ref|NP_002930.2|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42794608|ref|NP_976318.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42822864|ref|NP_976322.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42822866|ref|NP_976323.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42822868|ref|NP_976321.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42822870|ref|NP_976320.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42822872|ref|NP_976317.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|42822874|ref|NP_976319.1|      A....SLR..ELALG.SN...KLG.....................DVGMAELC........PGL
gi|291463278|ref|NP_001167553.1|  Q....SLT..CVNLS.DN...ELL.....................DEGAKLLY........TTL
gi|291463280|ref|NP_001167554.1|  Q....SLT..CVNLS.DN...ELL.....................DEGAKLLY........TTL
gi|291463275|ref|NP_001167552.1|  Q....SLT..CVNLS.DN...ELL.....................DEGAKLLY........TTL
gi|8923473|ref|NP_060322.1|       Q....SLT..CVNLS.DN...ELL.....................DEGAKLLY........TTL
gi|194018484|ref|NP_659444.2|     G....SLR..KLTLS.SN...PLR.....................SDGMNILC........DAL
gi|187937176|ref|NP_001120727.1|  Q....SLK..HLRLS.AN...VLL.....................DEGAMLLY........KTM
gi|33667040|ref|NP_789781.2|      G....HLK..TLILR.KN...SLE.....................NCGAYYLS........---
gi|46049100|ref|NP_631915.2|      Q....SLK..HLRLS.AN...VLL.....................DEGAMLLY........KTM
gi|113205085|ref|NP_079003.2|     G....ELR..KLDLS.CN...KDL.....................GGGFEDSP........AQL
gi|188536116|ref|NP_001120933.1|  Q....KLV..ELDLS.DN...ALG.....................DFGIRLLC........VGL
gi|338797736|ref|NP_061994.1|     C....SLQ..ILDLR.NN...HVL.....................DSGLAYIC........EGL
gi|5174617|ref|NP_006083.1|       K....IVT..YLGLY.NN...QIT.....................DVGARYVT........KIL
gi|188536002|ref|NP_001120934.1|  H....SLT..RLYVG.EN...ALG.....................DSGVAILC........EKA
gi|116268109|ref|NP_115582.3|     R....RLE..ELMLG.CN...ALG.....................DPTALGLA........QEL
gi|15193292|ref|NP_150639.1|      P....HLV..ELDLT.GN...ALE.....................DLGLRLLC........QGL
gi|118918429|ref|NP_849172.2|     R....SLT..SLDLR.GN...SIG.....................PQGAKALA........DAL
gi|289666780|ref|NP_001166250.1|  S....SLE..KLDLG.DC...DLG.....................MQSVIAFA........TVL
gi|75709196|ref|NP_996611.2|      Q....SLK..HLRLS.AN...VLL.....................DEGAMLLY........KTM
gi|168986655|ref|NP_919263.2|     Y....YLQ..EMNIS.NN...HLG.....................LEGARIIS........DFF
gi|116268109|ref|NP_115582.3|     P....HLE..EVDLS.GN...QLE.....................DEGCRLMA........EAA
gi|11545912|ref|NP_071445.1|      E....QLQ..KLALF.NN...KLT.....................DGCAHSMA........KLL
gi|118918429|ref|NP_849172.2|     S....TLK..NLDLT.AN...LLH.....................DQGARAIA........VAV
gi|289666778|ref|NP_699184.2|     S....SLE..KLDLG.DC...DL-.....................--------........---
gi|27734755|ref|NP_116264.2|      P....ELV..TLNLQ.TCl..QIT.....................DEGLITIC........RG-
gi|4506411|ref|NP_002874.1|       L....ALK..VFVAG.RN...RLE.....................NDGATALA........EAF
gi|284447308|ref|NP_036289.3|     H....ELV..SLNLQ.SCs..RIT.....................DEGVVQIC........RG-
gi|289666782|ref|NP_001166251.1|  S....SLE..KLDLG.DC...DLG.....................MQSVIAFA........TVL
gi|74271814|ref|NP_001028225.1|   P....SLK..ELDLQ.QN...NLD.....................DVGVRLLC........EGL
gi|7662386|ref|NP_055737.1|       P....SLK..ELDLQ.QN...NLD.....................DVGVRLLC........EGL
gi|14719829|ref|NP_127497.1|      P....SLK..ELDLQ.QN...NLD.....................DVGVRLLC........EGL
gi|296531375|ref|NP_001171835.1|  P....ELV..TLNLQ.TCl..QIT.....................DEGLITIC........RG-
gi|226342931|ref|NP_079101.3|     T....QLR..ELYLQ.HN...QLT.....................DSGLDATT........F--
gi|308818204|ref|NP_001184224.1|  G....SIE..ELYLE.NN...QI-.....................----EEIT........EIC
gi|4557543|ref|NP_001384.1|       G....SIE..ELYLE.NN...QI-.....................----EEIT........EIC
gi|21389431|ref|NP_653221.1|      T....RLQ..ELILS.YN...KI-.....................----KTVP........KEL
gi|14719835|ref|NP_127500.1|      P....SLK..ELDLQ.QN...NLD.....................DVGVRLLC........EGL
gi|14719833|ref|NP_127499.1|      P....SLK..ELDLQ.QN...NLD.....................DVGVRLLC........EGL
gi|34878690|ref|NP_899632.1|      Q....NLT..HLYLR.GN...TLG.....................DKGIKLLC........EGL
gi|229577123|ref|NP_872345.2|     P....VLE..ELDLS.QN...LIG.....................DRGARGAA........KLL
gi|6912466|ref|NP_036436.1|       T....QLT..HLYLR.RCv..RLT.....................DEGLRYLV........IY-
gi|156415984|ref|NP_037485.2|     -....---..-----.--...---.....................--------........---
gi|7657647|ref|NP_055363.1|       -....---..-----.--...---.....................--------........---
gi|7657649|ref|NP_055362.1|       -....---..-----.--...---.....................--------........---
gi|289666746|ref|NP_699181.2|     -....---..-----.--...---.....................--------........---
gi|197333692|ref|NP_001127948.1|  N....NLH..ELDLR.EN...NLK.....................T---VEEI........ISF
gi|21245134|ref|NP_056165.1|      N....NLH..ELDLR.EN...NLK.....................T---VEEI........ISF
gi|161333852|ref|NP_659469.3|     F....SLV..SIDLS.GT...DIS.....................NEGLNVLS........R--
gi|284447314|ref|NP_001165184.1|  H....ELV..SLNLQ.SCs..RIT.....................DEGVVQIC........RG-
gi|260763922|ref|NP_001159588.1|  -....---..-----.--...---.....................--------........---
gi|4507553|ref|NP_003266.1|       -....---..-----.--...---.....................--------........---
gi|21361547|ref|NP_002930.2|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42794608|ref|NP_976318.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42822864|ref|NP_976322.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42822866|ref|NP_976323.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42822868|ref|NP_976321.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42822870|ref|NP_976320.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42822872|ref|NP_976317.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|42822874|ref|NP_976319.1|      P....ALA..ELNLR.SN...ELG.....................DVGVHCVL........QGL
gi|62912470|ref|NP_001017403.1|   T....SLE..ILTLT.RA...GI-.....................----RLLP........SGM
gi|38348406|ref|NP_940967.1|      S....KLR..TLLLR.DN...NMGfyrdlyntsspremvaqfllvD-------........---
gi|187608777|ref|NP_038460.4|     -....---..-----.--...---.....................---QTALG........SAF
gi|16306595|ref|NP_005974.2|      -....---..-----.--...---.....................----KHVQ........VAV
gi|22748931|ref|NP_689654.1|      T....GLR..LLNLS.FCg..GIS.....................DAGLLHLS........H--
gi|150378503|ref|NP_997046.1|     -....---..-----.--...---.....................--------........---
gi|4504379|ref|NP_003658.1|       A....NLE..SLTLT.GA...QI-.....................----SSLP........QTV
gi|255683361|ref|NP_001156787.2|  P....ELQ..YVGFM.GC...SVT.....................SKGVIHLT........K--
gi|61175232|ref|NP_001012992.1|   T....SLA..QLNLNlGV...VSS.....................PSRIKQLA........EAL
gi|54607116|ref|NP_938012.2|      -....---..-----.--...---.....................--------........---
gi|20302168|ref|NP_619542.1|      I....NLT..LLDLS.GN...CPRcfnapfpcvpc..........D------GgasinidrFAF
gi|21450705|ref|NP_659436.1|      -....---..RLDLA.TQ...SLT.....................VETCRALG........KLL
gi|112380630|ref|NP_036266.2|     -....---..-----.--...---.....................--------........---
gi|291190783|ref|NP_001167448.1|  H....NLKgvSLDLS.NC...ELR.....................SGGAQVLE........GCI
gi|291190781|ref|NP_060110.4|     H....NLKgvSLDLS.NC...ELR.....................SGGAQVLE........GCI
gi|66392157|ref|NP_001013860.1|   T....HLRdlHLDLS.AC...ELR.....................SAGAQVIQ........DLV
gi|19924149|ref|NP_612564.1|      T....SLK..YLDLS.FN...GV-.....................----ITMS........SNF
gi|312433960|ref|NP_001186067.1|  K....KMC..LFHLT.HLs..DIG.....................-EGMDYIV........KSL
gi|312433962|ref|NP_001186068.1|  K....KMC..LFHLT.HLs..DIG.....................-EGMDYIV........KSL
gi|40788015|ref|NP_067032.3|      K....KMC..LFHLT.HLs..DIG.....................-EGMDYIV........KSL
gi|16306588|ref|NP_036292.2|      K....KLR..TLDLW.RCk..NIT.....................ENGIAELA........SG-
gi|14249170|ref|NP_116026.1|      S....KLQ..NLSLE.GL...RLS.....................DPIVNTLA........K--
gi|156938257|ref|NP_612369.3|     S....HLSdlHLDLS.SC...ELR.....................SAGAQALQ........EQL
gi|161333854|ref|NP_001104508.1|  M....RIR..ELNLS.NCv..RLS.....................DASVMKLS........ER-
gi|19718734|ref|NP_003255.2|      P....SLQ..TLILR.QN...HL-.....................-ASLEKTG........ETL
gi|149274651|ref|NP_115547.1|     -....---..-----.--...---.....................----KALK........GCL
gi|149274621|ref|NP_001092272.1|  -....---..-----.--...---.....................----KALK........GCL
gi|291190781|ref|NP_060110.4|     Q....YLA..VLNLS.RT...VFS.....................HRKGKEVP........PS-
gi|291190783|ref|NP_001167448.1|  Q....YLA..VLNLS.RT...VFS.....................HRKGKEVP........PS-
gi|163965441|ref|NP_653303.2|     Ss...TLR..KVSLE.GN...PLP.....................EQSYHKLM........AL-
gi|161333852|ref|NP_659469.3|     H....KLI..YLDLS.GCt..QIS.....................VQGFRYIA........NS-
gi|190194416|ref|NP_077302.3|     P....QLR..SVALG.GCg..QLS.....................RRALGALA........EG-
gi|21264320|ref|NP_612202.1|      -....---..-----.--...---.....................--------........---
gi|25777608|ref|NP_078894.2|      L....RAR..KLGLQ.LN...SLG.....................PEACKDLR........DLL
gi|218931148|ref|NP_001136357.1|  -....---..-----.--...---.....................--------........---
gi|156938257|ref|NP_612369.3|     S....HLT..YLNLA.RN...SC-.....................--------........---
gi|156938336|ref|NP_000237.2|     K....SLE..TLNLS.QN...NIT.....................DLGAYKLA........EAL
gi|54112380|ref|NP_001005366.1|   R....NIV..ELRLA.GL...DIT.....................DASLRLII........RH-
gi|54112382|ref|NP_115979.3|      R....NIV..ELRLA.GL...DIT.....................DASLRLII........RH-
gi|157168349|ref|NP_001093254.2|  Q....GVA..ELRLA.GL...ELT.....................DASLRLLL........RH-
gi|118442828|ref|NP_001072983.1|  S....VLK..VLVLN.QT...GIT.....................W---AEVL........RCV
gi|4507375|ref|NP_003184.1|       S....VLK..VLVLN.QT...GIT.....................W---AEVL........RCV
gi|116268109|ref|NP_115582.3|     K....DLS..QVDLS.AN...LLG.....................DSGLRCLL........ECL
gi|25777610|ref|NP_733840.1|      L....RAR..KLGLQ.LN...SLG.....................PEACKDLR........DLL
gi|164663798|ref|NP_001106873.1|  -....-VQ..TLDLR.SC...DIS.....................DAALLHLS........N--
gi|66392157|ref|NP_001013860.1|   -....---..-----.--...---.....................--------........---
gi|161333854|ref|NP_001104508.1|  H....KLI..YLDLS.GCt..QIS.....................VQGFRYIA........NS-
gi|16306580|ref|NP_036440.1|      R....NMT..DFRLA.GL...DIT.....................DATLRLII........RH-
gi|341916269|ref|XP_003403438.1|  I....SLK..ILNLE.GQ...QFP.....................DEETSEKF........AYI
gi|119393876|ref|NP_075043.1|     I....SLK..ILNLE.GQ...QFP.....................DEETSEKF........AYI
gi|341916267|ref|XP_003403437.1|  I....SLK..ILNLE.GQ...QFP.....................DEETSEKF........AYI
gi|119393878|ref|NP_004527.2|     I....SLK..ILNLE.GQ...QFP.....................DEETSEKF........AYI
gi|341916263|ref|XP_003403435.1|  I....SLK..ILNLE.GQ...QFP.....................DEETSEKF........AYI
gi|40255157|ref|NP_700356.2|      A....NIT..LLSLA.GN...RI-.....................---VEILP........EHL
gi|16306576|ref|NP_036294.1|      P....SLE..ELCLA.SS...TCN.....................FVSNEVLG........RLL
gi|302129689|ref|NP_001180464.1|  T....SHQ..-----.--...---.....................--------........---
gi|302129687|ref|NP_001180463.1|  T....SHQ..-----.--...---.....................--------........---
gi|16306572|ref|NP_036293.1|      T....SHQ..-----.--...---.....................--------........---
gi|341915644|ref|XP_003403561.1|  F....QLI..YLNLS.FN...DL-.....................----HYFP........TEI
gi|341913879|ref|XP_003403707.1|  F....QLI..YLNLS.FN...DL-.....................----HYFP........TEI
gi|61742136|ref|NP_078831.3|      P....SLE..ELCLA.SS...TCN.....................FVSNEVLG........RLL
gi|38569471|ref|NP_006360.3|      -....---..-----.--...FAS.....................PQDFGLVL........QTL
gi|16306591|ref|NP_036295.1|      L....QLR..QLSLS.LLp..ELT.....................DNGLVAVA........RG-
gi|51873034|ref|NP_001004055.1|   L....QLR..QLSLS.LLp..ELT.....................DNGLVAVA........RG-
gi|341916265|ref|XP_003403436.1|  I....SLK..ILNLE.GQ...QFP.....................DEETSEKF........AYI
gi|7661860|ref|NP_055480.1|       A....SLR..YLGLY.GN...PLS.....................MAGLKELL........---
gi|122937351|ref|NP_001073947.1|  H....RLR..QLKFL.GN...PLS.....................ARALRRLF........TAL
gi|46249367|ref|NP_996836.1|      S....QLT..TLSFY.GN...SIS.....................ISALQSLL........QHL
gi|46249369|ref|NP_996837.1|      S....QLT..TLSFY.GN...SIS.....................ISALQSLL........QHL
gi|46249371|ref|NP_996838.1|      S....QLT..TLSFY.GN...SIS.....................ISALQSLL........QHL
gi|46249373|ref|NP_996839.1|      S....QLT..TLSFY.GN...SIS.....................ISALQSLL........QHL
gi|5174641|ref|NP_006106.1|       S....QLT..TLSFY.GN...SIS.....................ISALQSLL........QHL
gi|88942379|ref|XP_933494.1|      F....ELN..TFSFC.GN...PIS.....................MATLENLL........SHT
gi|148356236|ref|NP_001091846.1|  F....ELN..TFSFC.GN...PIC.....................MATLENLL........SH-
gi|61102721|ref|NP_001010890.1|   F....ELN..TFSFC.GN...PIC.....................MATLENLL........SH-
gi|153792112|ref|NP_001093322.1|  F....ELT..TFSFR.GN...PIS.....................TATLENLL........CH-
gi|153945800|ref|NP_001093584.1|  F....ELT..TFSFR.GN...PIS.....................TATLENLL........CH-
gi|61696142|ref|NP_001013425.1|   F....ELN..TFSFC.GN...PIS.....................MATLENLL........SHT
gi|226437621|ref|NP_001139816.1|  F....ELN..TFSFC.GN...PIC.....................MATLENLL........S--
gi|59958373|ref|NP_001009611.1|   F....ELN..TFSFC.GN...PIC.....................MATLENLL........SH-
gi|58219004|ref|NP_001010889.1|   F....ELN..TFSFC.GN...PIS.....................MATLENLL........SHT
gi|153791443|ref|NP_001093320.1|  S....NLT..TFCFH.GN...DTS.....................MDGLKDLL........RHT
gi|310118528|ref|XP_003118894.1|  F....ELN..TFSFC.GN...PIS.....................MATLENLL........SHT
gi|310118526|ref|XP_001130065.3|  F....ELN..TFSFC.GN...PIS.....................MATLENLL........SHT
gi|55742693|ref|NP_078922.1|      KwiqqNLQ..CLVLN.SL...TLS.....................L---EDPY........ERC
gi|194306635|ref|NP_001093260.2|  S....NLT..TFCFH.GN...DTS.....................MDGLKDLL........RHT
gi|66954681|ref|NP_001019832.1|   S....QLT..TFYFG.RN...CMS.....................MGALKDLL........RH-
gi|59676593|ref|NP_001012277.1|   S....QLS..TFSFC.GN...LIS.....................MAALENLL........RH-
gi|59676587|ref|NP_001012276.1|   S....QLS..TFSFC.GN...LIS.....................MAALENLL........RH-
gi|12738831|ref|NP_075389.1|      S....QLT..TFYFG.RN...CMS.....................IDALKDL-........--L
gi|194306638|ref|NP_001013714.3|  S....NLT..TFCFH.GN...DTS.....................MDGLKDLL........RHT
gi|8923179|ref|NP_060173.1|       -....---..-----.--...---.....................--------........---
gi|124249372|ref|NP_001074299.1|  S....QLS..TFSFC.GN...LIS.....................MAALENLL........RH-
gi|154800493|ref|NP_001094101.1|  S....NLT..TFCFH.GN...DTS.....................MDGLKDLL........RHT
gi|29789255|ref|NP_085132.1|      G....NLE..NLSLA.FT...NVT.....................SACAEHLI........K--
gi|194018550|ref|NP_938204.2|     G....NLE..NLSLA.FT...NVT.....................SACAEHLI........K--
gi|157426875|ref|NP_079239.3|     R....HLR..SLSLP.VC...SVA.....................--------........---
gi|33589814|ref|NP_006327.2|      Kd...SLV..SLVLY.NM...DLS.....................DDHIRVIV........Q--
gi|12738834|ref|NP_075390.1|      S....QLT..TFYFG.SN...CMS.....................ID---ALK........DLL
gi|341915238|ref|XP_938952.6|     -....---..-----.--...---.....................--------........---
gi|153792140|ref|NP_001093324.1|  S....QLT..TFYFG.RN...CMS.....................M---GALK........DLL
gi|16506299|ref|NP_443172.1|      R....ELT..CLDLS.CC...KLG.....................DE--HELL........EHL
gi|194018546|ref|NP_001034450.2|  S....QLT..TFNFH.GN...ETS.....................MNALKDLL........RHT
gi|226437632|ref|NP_001004339.2|  T....GLR..ILSVF.NV...CFH.....................TEDLANVS........Q--
gi|113865933|ref|NP_001038945.1|  S....QLT..TFYFR.GN...ETS.....................TNALKDLL........---
gi|116268109|ref|NP_115582.3|     A....RLQ..QLSLS.QVnlcEDD.....................DASSLLLQ........SLL
gi|157426839|ref|NP_001093321.1|  S....QLT..TFYFR.GN...ETS.....................TNALKDLL........C--
gi|268832194|ref|NP_001161343.1|  -....---..-----.--...---.....................--------........---
gi|268832172|ref|NP_060505.2|     -....---..-----.--...---.....................--------........---
gi|268830752|ref|NP_001161339.1|  -....---..-----.--...---.....................--------........---
gi|165932385|ref|NP_001107039.1|  -....---..-----.--...---.....................--------........---
gi|134288867|ref|NP_997527.2|     P....RLT..QLLLN.GN...RLT.....................RATARKLT........DAI
gi|23397500|ref|NP_694962.1|      Rnen.VIS..ELNIE.DY...FSH.....................HLAVYNSPqfk.....KTM
gi|148922963|ref|NP_036291.2|     Q....GLR..ELALN.YY...ILT.....................DELFLALS........SET
gi|16306584|ref|NP_036290.1|      -....---..-----.--...---.....................--------........---
gi|45505155|ref|NP_110420.3|      K....NAL..EVDLG.YL...IIT.....................A-------........---
gi|45545409|ref|NP_995308.1|      K....NAL..EVDLG.YL...IIT.....................A-------........---
gi|22547146|ref|NP_060848.2|      -....---..-----.--...---.....................--------........---
gi|51558774|ref|NP_001003803.1|   -....---..-----.--...---.....................--------........---
gi|289803020|ref|NP_001073879.2|  M....RLQ..VLELD.HVs..EIT.....................QEVAAEVC........R--
gi|158321897|ref|NP_703148.4|     -....---..-----.--...---.....................--------........---
gi|28827813|ref|NP_789792.1|      -....---..-----.--...---.....................--------........---


                                                                                                    
                                                                                                    
d1a4ya_                             .LHP..SSRLRT....................................................
gi|21955154|ref|NP_653288.1|      .RHP..VCRLRT....................................................
gi|33519450|ref|NP_789790.2|      .KHS..HCALER....................................................
gi|28827813|ref|NP_789792.1|      .QHA..QCTLKS....................................................
gi|119395764|ref|NP_001073289.1|  .KNP..QCNLQK....................................................
gi|34878693|ref|NP_004886.3|      .KNP..QCNLQK....................................................
gi|158321897|ref|NP_703148.4|     .RLP..HCSLQR....................................................
gi|194018482|ref|NP_604393.2|     .CSP..DTVLVY....................................................
gi|110624785|ref|NP_789780.2|     .THP..KCALER....................................................
gi|21361547|ref|NP_002930.2|      .LHP..SSRLRT....................................................
gi|42794608|ref|NP_976318.1|      .LHP..SSRLRT....................................................
gi|42822864|ref|NP_976322.1|      .LHP..SSRLRT....................................................
gi|42822866|ref|NP_976323.1|      .LHP..SSRLRT....................................................
gi|42822868|ref|NP_976321.1|      .LHP..SSRLRT....................................................
gi|42822870|ref|NP_976320.1|      .LHP..SSRLRT....................................................
gi|42822872|ref|NP_976317.1|      .LHP..SSRLRT....................................................
gi|42822874|ref|NP_976319.1|      .LHP..SSRLRT....................................................
gi|291463278|ref|NP_001167553.1|  .RHP..KCFLQR....................................................
gi|291463280|ref|NP_001167554.1|  .RHP..KCFLQR....................................................
gi|291463275|ref|NP_001167552.1|  .RHP..KCFLQR....................................................
gi|8923473|ref|NP_060322.1|       .RHP..KCFLQR....................................................
gi|194018484|ref|NP_659444.2|     .LHP..NCTLIS....................................................
gi|187937176|ref|NP_001120727.1|  .TRP..KHFLQM....................................................
gi|33667040|ref|NP_789781.2|      .---..VAQLER....................................................
gi|46049100|ref|NP_631915.2|      .TRP..KHFLQM....................................................
gi|113205085|ref|NP_079003.2|     .VM-..LKHLQV....................................................
gi|188536116|ref|NP_001120933.1|  .KHL..LCNLKK....................................................
gi|338797736|ref|NP_061994.1|     .KEQ..RKGLVT....................................................
gi|5174617|ref|NP_006083.1|       .DE-..CKGLTH....................................................
gi|188536002|ref|NP_001120934.1|  .KNP..QCNLQK....................................................
gi|116268109|ref|NP_115582.3|     .---..PQHLRV....................................................
gi|15193292|ref|NP_150639.1|      .RHP..VCRLRT....................................................
gi|118918429|ref|NP_849172.2|     .KI-..NRTLTS....................................................
gi|289666780|ref|NP_001166250.1|  .TQ-..NQAIKA....................................................
gi|75709196|ref|NP_996611.2|      .TRP..KHFLQM....................................................
gi|168986655|ref|NP_919263.2|     .ERN..SSSIWS....................................................
gi|116268109|ref|NP_115582.3|     .SQ-..LHIARK....................................................
gi|11545912|ref|NP_071445.1|      .AC-..RQNFLA....................................................
gi|118918429|ref|NP_849172.2|     .RE-..NRTLTS....................................................
gi|289666778|ref|NP_699184.2|     .---..------....................................................
gi|27734755|ref|NP_116264.2|      .---..CHKLQS....................................................
gi|4506411|ref|NP_002874.1|       .RV-..------....................................................
gi|284447308|ref|NP_036289.3|     .---..CHRLQA....................................................
gi|289666782|ref|NP_001166251.1|  .TQ-..NQAIKA....................................................
gi|74271814|ref|NP_001028225.1|   .RHP..ACKLIR....................................................
gi|7662386|ref|NP_055737.1|       .RHP..ACKLIR....................................................
gi|14719829|ref|NP_127497.1|      .RHP..ACKLIR....................................................
gi|296531375|ref|NP_001171835.1|  .---..CHKLQS....................................................
gi|226342931|ref|NP_079101.3|     .SK-..LHSLEY....................................................
gi|308818204|ref|NP_001184224.1|  .FNH..TRKINV....................................................
gi|4557543|ref|NP_001384.1|       .FNH..TRKINV....................................................
gi|21389431|ref|NP_653221.1|      .SN-..CASLEK....................................................
gi|14719835|ref|NP_127500.1|      .RHP..ACKLIR....................................................
gi|14719833|ref|NP_127499.1|      .RHP..ACKLIR....................................................
gi|34878690|ref|NP_899632.1|      .LHP..DCKLQV....................................................
gi|229577123|ref|NP_872345.2|     .SH-..-SRLRV....................................................
gi|6912466|ref|NP_036436.1|       .---..CASIKE....................................................
gi|156415984|ref|NP_037485.2|     .---..------....................................................
gi|7657647|ref|NP_055363.1|       .---..------....................................................
gi|7657649|ref|NP_055362.1|       .---..------....................................................
gi|289666746|ref|NP_699181.2|     .---..LPNLTA....................................................
gi|197333692|ref|NP_001127948.1|  .QH-..LQNLSC....................................................
gi|21245134|ref|NP_056165.1|      .QH-..LQNLSC....................................................
gi|161333852|ref|NP_659469.3|     .---..HKKLKE....................................................
gi|284447314|ref|NP_001165184.1|  .---..CHRLQA....................................................
gi|260763922|ref|NP_001159588.1|  .---..------....................................................
gi|4507553|ref|NP_003266.1|       .---..------....................................................
gi|21361547|ref|NP_002930.2|      .QTP..SCKIQK....................................................
gi|42794608|ref|NP_976318.1|      .QTP..SCKIQK....................................................
gi|42822864|ref|NP_976322.1|      .QTP..SCKIQK....................................................
gi|42822866|ref|NP_976323.1|      .QTP..SCKIQK....................................................
gi|42822868|ref|NP_976321.1|      .QTP..SCKIQK....................................................
gi|42822870|ref|NP_976320.1|      .QTP..SCKIQK....................................................
gi|42822872|ref|NP_976317.1|      .QTP..SCKIQK....................................................
gi|42822874|ref|NP_976319.1|      .QTP..SCKIQK....................................................
gi|62912470|ref|NP_001017403.1|   .CQQ..LPRLRV....................................................
gi|38348406|ref|NP_940967.1|      .---..------....................................................
gi|187608777|ref|NP_038460.4|     .QD-..AEHLKT....................................................
gi|16306595|ref|NP_005974.2|      .AHV..SETITQ....................................................
gi|22748931|ref|NP_689654.1|      .---..MGSLRS....................................................
gi|150378503|ref|NP_997046.1|     .---..------....................................................
gi|4504379|ref|NP_003658.1|       .CNQ..LPNLQV....................................................
gi|255683361|ref|NP_001156787.2|  .---..LRNLSS....................................................
gi|61175232|ref|NP_001012992.1|   .RT-..NRSIQS....................................................
gi|54607116|ref|NP_938012.2|      .---..------....................................................
gi|20302168|ref|NP_619542.1|      .QN-..LTQLRY....................................................
gi|21450705|ref|NP_659436.1|      .PR-..ETLCTE....................................................
gi|112380630|ref|NP_036266.2|     .---..------....................................................
gi|291190783|ref|NP_001167448.1|  .AE-..IHNITS....................................................
gi|291190781|ref|NP_060110.4|     .AE-..IHNITS....................................................
gi|66392157|ref|NP_001013860.1|   .CD-..AGAVSS....................................................
gi|19924149|ref|NP_612564.1|      .LG-..LEQLEH....................................................
gi|312433960|ref|NP_001186067.1|  .SSE..PCDLEE....................................................
gi|312433962|ref|NP_001186068.1|  .SSE..PCDLEE....................................................
gi|40788015|ref|NP_067032.3|      .SSE..PCDLEE....................................................
gi|16306588|ref|NP_036292.2|      .---..CPLLEE....................................................
gi|14249170|ref|NP_116026.1|      .---..NSNLVR....................................................
gi|156938257|ref|NP_612369.3|     .GA-..VTCVGS....................................................
gi|161333854|ref|NP_001104508.1|  .---..CPNLNY....................................................
gi|19718734|ref|NP_003255.2|      .LT-..LKNLTN....................................................
gi|149274651|ref|NP_115547.1|     .SI-..SSVLKN....................................................
gi|149274621|ref|NP_001092272.1|  .SI-..SSVLKN....................................................
gi|291190781|ref|NP_060110.4|     .---..------....................................................
gi|291190783|ref|NP_001167448.1|  .---..------....................................................
gi|163965441|ref|NP_653303.2|     .---..DSTIAH....................................................
gi|161333852|ref|NP_659469.3|     .---..CTGIMH....................................................
gi|190194416|ref|NP_077302.3|     .---..CPRLQR....................................................
gi|21264320|ref|NP_612202.1|      .---..------....................................................
gi|25777608|ref|NP_078894.2|      .LHD..QCQITT....................................................
gi|218931148|ref|NP_001136357.1|  .---..------....................................................
gi|156938257|ref|NP_612369.3|     .---..------....................................................
gi|156938336|ref|NP_000237.2|     .PSL..AASLLR....................................................
gi|54112380|ref|NP_001005366.1|   .---..MPLLSK....................................................
gi|54112382|ref|NP_115979.3|      .---..MPLLSK....................................................
gi|157168349|ref|NP_001093254.2|  .---..APQLSA....................................................
gi|118442828|ref|NP_001072983.1|  .AG-..CPGLEE....................................................
gi|4507375|ref|NP_003184.1|       .AG-..CPGLEE....................................................
gi|116268109|ref|NP_115582.3|     .PQ-..VPISGL....................................................
gi|25777610|ref|NP_733840.1|      .LHD..QCQITT....................................................
gi|164663798|ref|NP_001106873.1|  .---..CRKLKK....................................................
gi|66392157|ref|NP_001013860.1|   .---..------....................................................
gi|161333854|ref|NP_001104508.1|  .---..CTGIMH....................................................
gi|16306580|ref|NP_036440.1|      .---..MPLLSR....................................................
gi|341916269|ref|XP_003403438.1|  .LGS..LSNLEE....................................................
gi|119393876|ref|NP_075043.1|     .LGS..LSNLEE....................................................
gi|341916267|ref|XP_003403437.1|  .LGS..LSNLEE....................................................
gi|119393878|ref|NP_004527.2|     .LGS..LSNLEE....................................................
gi|341916263|ref|XP_003403435.1|  .LGS..LSNLEE....................................................
gi|40255157|ref|NP_700356.2|      .KE-..FQSLET....................................................
gi|16306576|ref|NP_036294.1|      .HG-..SPNLRL....................................................
gi|302129689|ref|NP_001180464.1|  .---..-----Sgflktstskitstawknkditmqstkqyaclhdltnkgigeeidnehpwtkp
gi|302129687|ref|NP_001180463.1|  .---..-----Sgflktstskitstawknkditmqstkqyaclhdltnkgigeeidnehpwtkp
gi|16306572|ref|NP_036293.1|      .---..-----Sgflktstskitstawknkditmqstkqyaclhdltnkgigeeidnehpwtkp
gi|341915644|ref|XP_003403561.1|  .LC-..LKNLQI....................................................
gi|341913879|ref|XP_003403707.1|  .LC-..LKNLQI....................................................
gi|61742136|ref|NP_078831.3|      .HG-..SPNLRL....................................................
gi|38569471|ref|NP_006360.3|      .KEY..NLALKR....................................................
gi|16306591|ref|NP_036295.1|      .---..CPSLEH....................................................
gi|51873034|ref|NP_001004055.1|   .---..CPSLEH....................................................
gi|341916265|ref|XP_003403436.1|  .LGS..LSNLEE....................................................
gi|7661860|ref|NP_055480.1|       .---..------....................................................
gi|122937351|ref|NP_001073947.1|  .CE-..LPEL--....................................................
gi|46249367|ref|NP_996836.1|      .IG-..LSNLTH....................................................
gi|46249369|ref|NP_996837.1|      .IG-..LSNLTH....................................................
gi|46249371|ref|NP_996838.1|      .IG-..LSNLTH....................................................
gi|46249373|ref|NP_996839.1|      .IG-..LSNLTH....................................................
gi|5174641|ref|NP_006106.1|       .IG-..LSNLTH....................................................
gi|88942379|ref|XP_933494.1|      .I--..------....................................................
gi|148356236|ref|NP_001091846.1|  .---..------....................................................
gi|61102721|ref|NP_001010890.1|   .---..------....................................................
gi|153792112|ref|NP_001093322.1|  .---..TIRLNN....................................................
gi|153945800|ref|NP_001093584.1|  .---..TIRLNN....................................................
gi|61696142|ref|NP_001013425.1|   .I--..------....................................................
gi|226437621|ref|NP_001139816.1|  .-H-..TIILKN....................................................
gi|59958373|ref|NP_001009611.1|   .---..------....................................................
gi|58219004|ref|NP_001010889.1|   .---..------....................................................
gi|153791443|ref|NP_001093320.1|  .GR-..LSNL--....................................................
gi|310118528|ref|XP_003118894.1|  .I--..------....................................................
gi|310118526|ref|XP_001130065.3|  .---..------....................................................
gi|55742693|ref|NP_078922.1|      .FSR..LSGLRA....................................................
gi|194306635|ref|NP_001093260.2|  .GR-..LSNL--....................................................
gi|66954681|ref|NP_001019832.1|   .---..TSGLSK....................................................
gi|59676593|ref|NP_001012277.1|   .---..TVGLSK....................................................
gi|59676587|ref|NP_001012276.1|   .---..TVGLSK....................................................
gi|12738831|ref|NP_075389.1|      .RH-..TSGLSK....................................................
gi|194306638|ref|NP_001013714.3|  .GR-..LSNL--....................................................
gi|8923179|ref|NP_060173.1|       .---..LPLLEC....................................................
gi|124249372|ref|NP_001074299.1|  .---..TVGLSK....................................................
gi|154800493|ref|NP_001094101.1|  .GR-..LSNL--....................................................
gi|29789255|ref|NP_085132.1|      .---..LPSLKQ....................................................
gi|194018550|ref|NP_938204.2|     .---..LPSLKQ....................................................
gi|157426875|ref|NP_079239.3|     .---..------....................................................
gi|33589814|ref|NP_006327.2|      .---..LHKLRH....................................................
gi|12738834|ref|NP_075390.1|      .RH-..TSGLSK....................................................
gi|341915238|ref|XP_938952.6|     .---..------....................................................
gi|153792140|ref|NP_001093324.1|  .CH-..TSGLSK....................................................
gi|16506299|ref|NP_443172.1|      tNEA..LSSVTQ....................................................
gi|194018546|ref|NP_001034450.2|  .GG-..------....................................................
gi|226437632|ref|NP_001004339.2|  .---..LPRLES....................................................
gi|113865933|ref|NP_001038945.1|  .---..------....................................................
gi|116268109|ref|NP_115582.3|     .LS-..LSELKT....................................................
gi|157426839|ref|NP_001093321.1|  .---..------....................................................
gi|268832194|ref|NP_001161343.1|  .---..------....................................................
gi|268832172|ref|NP_060505.2|     .---..------....................................................
gi|268830752|ref|NP_001161339.1|  .---..------....................................................
gi|165932385|ref|NP_001107039.1|  .---..------....................................................
gi|134288867|ref|NP_997527.2|     .KDTtkFPALAW....................................................
gi|23397500|ref|NP_694962.1|      .ST-..FHNLVS....................................................
gi|148922963|ref|NP_036291.2|     .---..HVNLEH....................................................
gi|16306584|ref|NP_036290.1|      .---..NCSLKT....................................................
gi|45505155|ref|NP_110420.3|      .---..ARRLHE....................................................
gi|45545409|ref|NP_995308.1|      .---..ARRLHE....................................................
gi|22547146|ref|NP_060848.2|      .---..------....................................................
gi|51558774|ref|NP_001003803.1|   .---..--HVEK....................................................
gi|289803020|ref|NP_001073879.2|  .-EG..LKGLEM....................................................
gi|158321897|ref|NP_703148.4|     .---..------....................................................
gi|28827813|ref|NP_789792.1|      .---..------....................................................


                                                                                                    
                                                                                                    
d1a4ya_                             ................................................................
gi|21955154|ref|NP_653288.1|      ................................................................
gi|33519450|ref|NP_789790.2|      ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................
gi|119395764|ref|NP_001073289.1|  ................................................................
gi|34878693|ref|NP_004886.3|      ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|194018482|ref|NP_604393.2|     ................................................................
gi|110624785|ref|NP_789780.2|     ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|291463278|ref|NP_001167553.1|  ................................................................
gi|291463280|ref|NP_001167554.1|  ................................................................
gi|291463275|ref|NP_001167552.1|  ................................................................
gi|8923473|ref|NP_060322.1|       ................................................................
gi|194018484|ref|NP_659444.2|     ................................................................
gi|187937176|ref|NP_001120727.1|  ................................................................
gi|33667040|ref|NP_789781.2|      ................................................................
gi|46049100|ref|NP_631915.2|      ................................................................
gi|113205085|ref|NP_079003.2|     ................................................................
gi|188536116|ref|NP_001120933.1|  ................................................................
gi|338797736|ref|NP_061994.1|     ................................................................
gi|5174617|ref|NP_006083.1|       ................................................................
gi|188536002|ref|NP_001120934.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|15193292|ref|NP_150639.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666780|ref|NP_001166250.1|  ................................................................
gi|75709196|ref|NP_996611.2|      ................................................................
gi|168986655|ref|NP_919263.2|     ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|11545912|ref|NP_071445.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666778|ref|NP_699184.2|     ................................................................
gi|27734755|ref|NP_116264.2|      ................................................................
gi|4506411|ref|NP_002874.1|       ................................................................
gi|284447308|ref|NP_036289.3|     ................................................................
gi|289666782|ref|NP_001166251.1|  ................................................................
gi|74271814|ref|NP_001028225.1|   ................................................................
gi|7662386|ref|NP_055737.1|       ................................................................
gi|14719829|ref|NP_127497.1|      ................................................................
gi|296531375|ref|NP_001171835.1|  ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|308818204|ref|NP_001184224.1|  ................................................................
gi|4557543|ref|NP_001384.1|       ................................................................
gi|21389431|ref|NP_653221.1|      ................................................................
gi|14719835|ref|NP_127500.1|      ................................................................
gi|14719833|ref|NP_127499.1|      ................................................................
gi|34878690|ref|NP_899632.1|      ................................................................
gi|229577123|ref|NP_872345.2|     ................................................................
gi|6912466|ref|NP_036436.1|       ................................................................
gi|156415984|ref|NP_037485.2|     ................................................................
gi|7657647|ref|NP_055363.1|       ................................................................
gi|7657649|ref|NP_055362.1|       ................................................................
gi|289666746|ref|NP_699181.2|     ................................................................
gi|197333692|ref|NP_001127948.1|  ................................................................
gi|21245134|ref|NP_056165.1|      ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|284447314|ref|NP_001165184.1|  ................................................................
gi|260763922|ref|NP_001159588.1|  ................................................................
gi|4507553|ref|NP_003266.1|       ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|187608777|ref|NP_038460.4|     ................................................................
gi|16306595|ref|NP_005974.2|      ................................................................
gi|22748931|ref|NP_689654.1|      ................................................................
gi|150378503|ref|NP_997046.1|     ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|255683361|ref|NP_001156787.2|  ................................................................
gi|61175232|ref|NP_001012992.1|   ................................................................
gi|54607116|ref|NP_938012.2|      ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|21450705|ref|NP_659436.1|      ................................................................
gi|112380630|ref|NP_036266.2|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|19924149|ref|NP_612564.1|      ................................................................
gi|312433960|ref|NP_001186067.1|  ................................................................
gi|312433962|ref|NP_001186068.1|  ................................................................
gi|40788015|ref|NP_067032.3|      ................................................................
gi|16306588|ref|NP_036292.2|      ................................................................
gi|14249170|ref|NP_116026.1|      ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|149274651|ref|NP_115547.1|     ................................................................
gi|149274621|ref|NP_001092272.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|163965441|ref|NP_653303.2|     ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|190194416|ref|NP_077302.3|     ................................................................
gi|21264320|ref|NP_612202.1|      ................................................................
gi|25777608|ref|NP_078894.2|      ................................................................
gi|218931148|ref|NP_001136357.1|  ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|156938336|ref|NP_000237.2|     ................................................................
gi|54112380|ref|NP_001005366.1|   ................................................................
gi|54112382|ref|NP_115979.3|      ................................................................
gi|157168349|ref|NP_001093254.2|  ................................................................
gi|118442828|ref|NP_001072983.1|  ................................................................
gi|4507375|ref|NP_003184.1|       ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|25777610|ref|NP_733840.1|      ................................................................
gi|164663798|ref|NP_001106873.1|  ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|16306580|ref|NP_036440.1|      ................................................................
gi|341916269|ref|XP_003403438.1|  ................................................................
gi|119393876|ref|NP_075043.1|     ................................................................
gi|341916267|ref|XP_003403437.1|  ................................................................
gi|119393878|ref|NP_004527.2|     ................................................................
gi|341916263|ref|XP_003403435.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|16306576|ref|NP_036294.1|      ................................................................
gi|302129689|ref|NP_001180464.1|  vssenftspyvwmldaedladiedtvewrhrnveslcvmetasnfscstsgcfskdivglrtsv
gi|302129687|ref|NP_001180463.1|  vssenftspyvwmldaedladiedtvewrhrnveslcvmetasnfscstsgcfskdivglrtsv
gi|16306572|ref|NP_036293.1|      vssenftspyvwmldaedladiedtvewrhrnveslcvmetasnfscstsgcfskdivglrtsv
gi|341915644|ref|XP_003403561.1|  ................................................................
gi|341913879|ref|XP_003403707.1|  ................................................................
gi|61742136|ref|NP_078831.3|      ................................................................
gi|38569471|ref|NP_006360.3|      ................................................................
gi|16306591|ref|NP_036295.1|      ................................................................
gi|51873034|ref|NP_001004055.1|   ................................................................
gi|341916265|ref|XP_003403436.1|  ................................................................
gi|7661860|ref|NP_055480.1|       ................................................................
gi|122937351|ref|NP_001073947.1|  ................................................................
gi|46249367|ref|NP_996836.1|      ................................................................
gi|46249369|ref|NP_996837.1|      ................................................................
gi|46249371|ref|NP_996838.1|      ................................................................
gi|46249373|ref|NP_996839.1|      ................................................................
gi|5174641|ref|NP_006106.1|       ................................................................
gi|88942379|ref|XP_933494.1|      ................................................................
gi|148356236|ref|NP_001091846.1|  ................................................................
gi|61102721|ref|NP_001010890.1|   ................................................................
gi|153792112|ref|NP_001093322.1|  ................................................................
gi|153945800|ref|NP_001093584.1|  ................................................................
gi|61696142|ref|NP_001013425.1|   ................................................................
gi|226437621|ref|NP_001139816.1|  ................................................................
gi|59958373|ref|NP_001009611.1|   ................................................................
gi|58219004|ref|NP_001010889.1|   ................................................................
gi|153791443|ref|NP_001093320.1|  ................................................................
gi|310118528|ref|XP_003118894.1|  ................................................................
gi|310118526|ref|XP_001130065.3|  ................................................................
gi|55742693|ref|NP_078922.1|      ................................................................
gi|194306635|ref|NP_001093260.2|  ................................................................
gi|66954681|ref|NP_001019832.1|   ................................................................
gi|59676593|ref|NP_001012277.1|   ................................................................
gi|59676587|ref|NP_001012276.1|   ................................................................
gi|12738831|ref|NP_075389.1|      ................................................................
gi|194306638|ref|NP_001013714.3|  ................................................................
gi|8923179|ref|NP_060173.1|       ................................................................
gi|124249372|ref|NP_001074299.1|  ................................................................
gi|154800493|ref|NP_001094101.1|  ................................................................
gi|29789255|ref|NP_085132.1|      ................................................................
gi|194018550|ref|NP_938204.2|     ................................................................
gi|157426875|ref|NP_079239.3|     ................................................................
gi|33589814|ref|NP_006327.2|      ................................................................
gi|12738834|ref|NP_075390.1|      ................................................................
gi|341915238|ref|XP_938952.6|     ................................................................
gi|153792140|ref|NP_001093324.1|  ................................................................
gi|16506299|ref|NP_443172.1|      ................................................................
gi|194018546|ref|NP_001034450.2|  ................................................................
gi|226437632|ref|NP_001004339.2|  ................................................................
gi|113865933|ref|NP_001038945.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|157426839|ref|NP_001093321.1|  ................................................................
gi|268832194|ref|NP_001161343.1|  ................................................................
gi|268832172|ref|NP_060505.2|     ................................................................
gi|268830752|ref|NP_001161339.1|  ................................................................
gi|165932385|ref|NP_001107039.1|  ................................................................
gi|134288867|ref|NP_997527.2|     ................................................................
gi|23397500|ref|NP_694962.1|      ................................................................
gi|148922963|ref|NP_036291.2|     ................................................................
gi|16306584|ref|NP_036290.1|      ................................................................
gi|45505155|ref|NP_110420.3|      ................................................................
gi|45545409|ref|NP_995308.1|      ................................................................
gi|22547146|ref|NP_060848.2|      ................................................................
gi|51558774|ref|NP_001003803.1|   ................................................................
gi|289803020|ref|NP_001073879.2|  ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................


                                                                                                    
                                                                                                    
d1a4ya_                             ................................................................
gi|21955154|ref|NP_653288.1|      ................................................................
gi|33519450|ref|NP_789790.2|      ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................
gi|119395764|ref|NP_001073289.1|  ................................................................
gi|34878693|ref|NP_004886.3|      ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|194018482|ref|NP_604393.2|     ................................................................
gi|110624785|ref|NP_789780.2|     ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|291463278|ref|NP_001167553.1|  ................................................................
gi|291463280|ref|NP_001167554.1|  ................................................................
gi|291463275|ref|NP_001167552.1|  ................................................................
gi|8923473|ref|NP_060322.1|       ................................................................
gi|194018484|ref|NP_659444.2|     ................................................................
gi|187937176|ref|NP_001120727.1|  ................................................................
gi|33667040|ref|NP_789781.2|      ................................................................
gi|46049100|ref|NP_631915.2|      ................................................................
gi|113205085|ref|NP_079003.2|     ................................................................
gi|188536116|ref|NP_001120933.1|  ................................................................
gi|338797736|ref|NP_061994.1|     ................................................................
gi|5174617|ref|NP_006083.1|       ................................................................
gi|188536002|ref|NP_001120934.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|15193292|ref|NP_150639.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666780|ref|NP_001166250.1|  ................................................................
gi|75709196|ref|NP_996611.2|      ................................................................
gi|168986655|ref|NP_919263.2|     ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|11545912|ref|NP_071445.1|      ................................................................
gi|118918429|ref|NP_849172.2|     ................................................................
gi|289666778|ref|NP_699184.2|     ................................................................
gi|27734755|ref|NP_116264.2|      ................................................................
gi|4506411|ref|NP_002874.1|       ................................................................
gi|284447308|ref|NP_036289.3|     ................................................................
gi|289666782|ref|NP_001166251.1|  ................................................................
gi|74271814|ref|NP_001028225.1|   ................................................................
gi|7662386|ref|NP_055737.1|       ................................................................
gi|14719829|ref|NP_127497.1|      ................................................................
gi|296531375|ref|NP_001171835.1|  ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|308818204|ref|NP_001184224.1|  ................................................................
gi|4557543|ref|NP_001384.1|       ................................................................
gi|21389431|ref|NP_653221.1|      ................................................................
gi|14719835|ref|NP_127500.1|      ................................................................
gi|14719833|ref|NP_127499.1|      ................................................................
gi|34878690|ref|NP_899632.1|      ................................................................
gi|229577123|ref|NP_872345.2|     ................................................................
gi|6912466|ref|NP_036436.1|       ................................................................
gi|156415984|ref|NP_037485.2|     ................................................................
gi|7657647|ref|NP_055363.1|       ................................................................
gi|7657649|ref|NP_055362.1|       ................................................................
gi|289666746|ref|NP_699181.2|     ................................................................
gi|197333692|ref|NP_001127948.1|  ................................................................
gi|21245134|ref|NP_056165.1|      ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|284447314|ref|NP_001165184.1|  ................................................................
gi|260763922|ref|NP_001159588.1|  ................................................................
gi|4507553|ref|NP_003266.1|       ................................................................
gi|21361547|ref|NP_002930.2|      ................................................................
gi|42794608|ref|NP_976318.1|      ................................................................
gi|42822864|ref|NP_976322.1|      ................................................................
gi|42822866|ref|NP_976323.1|      ................................................................
gi|42822868|ref|NP_976321.1|      ................................................................
gi|42822870|ref|NP_976320.1|      ................................................................
gi|42822872|ref|NP_976317.1|      ................................................................
gi|42822874|ref|NP_976319.1|      ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|187608777|ref|NP_038460.4|     ................................................................
gi|16306595|ref|NP_005974.2|      ................................................................
gi|22748931|ref|NP_689654.1|      ................................................................
gi|150378503|ref|NP_997046.1|     ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|255683361|ref|NP_001156787.2|  ................................................................
gi|61175232|ref|NP_001012992.1|   ................................................................
gi|54607116|ref|NP_938012.2|      ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|21450705|ref|NP_659436.1|      ................................................................
gi|112380630|ref|NP_036266.2|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|19924149|ref|NP_612564.1|      ................................................................
gi|312433960|ref|NP_001186067.1|  ................................................................
gi|312433962|ref|NP_001186068.1|  ................................................................
gi|40788015|ref|NP_067032.3|      ................................................................
gi|16306588|ref|NP_036292.2|      ................................................................
gi|14249170|ref|NP_116026.1|      ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|149274651|ref|NP_115547.1|     ................................................................
gi|149274621|ref|NP_001092272.1|  ................................................................
gi|291190781|ref|NP_060110.4|     ................................................................
gi|291190783|ref|NP_001167448.1|  ................................................................
gi|163965441|ref|NP_653303.2|     ................................................................
gi|161333852|ref|NP_659469.3|     ................................................................
gi|190194416|ref|NP_077302.3|     ................................................................
gi|21264320|ref|NP_612202.1|      ................................................................
gi|25777608|ref|NP_078894.2|      ................................................................
gi|218931148|ref|NP_001136357.1|  ................................................................
gi|156938257|ref|NP_612369.3|     ................................................................
gi|156938336|ref|NP_000237.2|     ................................................................
gi|54112380|ref|NP_001005366.1|   ................................................................
gi|54112382|ref|NP_115979.3|      ................................................................
gi|157168349|ref|NP_001093254.2|  ................................................................
gi|118442828|ref|NP_001072983.1|  ................................................................
gi|4507375|ref|NP_003184.1|       ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|25777610|ref|NP_733840.1|      ................................................................
gi|164663798|ref|NP_001106873.1|  ................................................................
gi|66392157|ref|NP_001013860.1|   ................................................................
gi|161333854|ref|NP_001104508.1|  ................................................................
gi|16306580|ref|NP_036440.1|      ................................................................
gi|341916269|ref|XP_003403438.1|  ................................................................
gi|119393876|ref|NP_075043.1|     ................................................................
gi|341916267|ref|XP_003403437.1|  ................................................................
gi|119393878|ref|NP_004527.2|     ................................................................
gi|341916263|ref|XP_003403435.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|16306576|ref|NP_036294.1|      ................................................................
gi|302129689|ref|NP_001180464.1|  cwqqhcaspafaycghsfcctgtalrtmsslpessamcrkaartrlprgkdliyfgseksdqet
gi|302129687|ref|NP_001180463.1|  cwqqhcaspafaycghsfcctgtalrtmsslpessamcrkaartrlprgkdliyfgseksdqet
gi|16306572|ref|NP_036293.1|      cwqqhcaspafaycghsfcctgtalrtmsslpessamcrkaartrlprgkdliyfgseksdqet
gi|341915644|ref|XP_003403561.1|  ................................................................
gi|341913879|ref|XP_003403707.1|  ................................................................
gi|61742136|ref|NP_078831.3|      ................................................................
gi|38569471|ref|NP_006360.3|      ................................................................
gi|16306591|ref|NP_036295.1|      ................................................................
gi|51873034|ref|NP_001004055.1|   ................................................................
gi|341916265|ref|XP_003403436.1|  ................................................................
gi|7661860|ref|NP_055480.1|       ................................................................
gi|122937351|ref|NP_001073947.1|  ................................................................
gi|46249367|ref|NP_996836.1|      ................................................................
gi|46249369|ref|NP_996837.1|      ................................................................
gi|46249371|ref|NP_996838.1|      ................................................................
gi|46249373|ref|NP_996839.1|      ................................................................
gi|5174641|ref|NP_006106.1|       ................................................................
gi|88942379|ref|XP_933494.1|      ................................................................
gi|148356236|ref|NP_001091846.1|  ................................................................
gi|61102721|ref|NP_001010890.1|   ................................................................
gi|153792112|ref|NP_001093322.1|  ................................................................
gi|153945800|ref|NP_001093584.1|  ................................................................
gi|61696142|ref|NP_001013425.1|   ................................................................
gi|226437621|ref|NP_001139816.1|  ................................................................
gi|59958373|ref|NP_001009611.1|   ................................................................
gi|58219004|ref|NP_001010889.1|   ................................................................
gi|153791443|ref|NP_001093320.1|  ................................................................
gi|310118528|ref|XP_003118894.1|  ................................................................
gi|310118526|ref|XP_001130065.3|  ................................................................
gi|55742693|ref|NP_078922.1|      ................................................................
gi|194306635|ref|NP_001093260.2|  ................................................................
gi|66954681|ref|NP_001019832.1|   ................................................................
gi|59676593|ref|NP_001012277.1|   ................................................................
gi|59676587|ref|NP_001012276.1|   ................................................................
gi|12738831|ref|NP_075389.1|      ................................................................
gi|194306638|ref|NP_001013714.3|  ................................................................
gi|8923179|ref|NP_060173.1|       ................................................................
gi|124249372|ref|NP_001074299.1|  ................................................................
gi|154800493|ref|NP_001094101.1|  ................................................................
gi|29789255|ref|NP_085132.1|      ................................................................
gi|194018550|ref|NP_938204.2|     ................................................................
gi|157426875|ref|NP_079239.3|     ................................................................
gi|33589814|ref|NP_006327.2|      ................................................................
gi|12738834|ref|NP_075390.1|      ................................................................
gi|341915238|ref|XP_938952.6|     ................................................................
gi|153792140|ref|NP_001093324.1|  ................................................................
gi|16506299|ref|NP_443172.1|      ................................................................
gi|194018546|ref|NP_001034450.2|  ................................................................
gi|226437632|ref|NP_001004339.2|  ................................................................
gi|113865933|ref|NP_001038945.1|  ................................................................
gi|116268109|ref|NP_115582.3|     ................................................................
gi|157426839|ref|NP_001093321.1|  ................................................................
gi|268832194|ref|NP_001161343.1|  ................................................................
gi|268832172|ref|NP_060505.2|     ................................................................
gi|268830752|ref|NP_001161339.1|  ................................................................
gi|165932385|ref|NP_001107039.1|  ................................................................
gi|134288867|ref|NP_997527.2|     ................................................................
gi|23397500|ref|NP_694962.1|      ................................................................
gi|148922963|ref|NP_036291.2|     ................................................................
gi|16306584|ref|NP_036290.1|      ................................................................
gi|45505155|ref|NP_110420.3|      ................................................................
gi|45545409|ref|NP_995308.1|      ................................................................
gi|22547146|ref|NP_060848.2|      ................................................................
gi|51558774|ref|NP_001003803.1|   ................................................................
gi|289803020|ref|NP_001073879.2|  ................................................................
gi|158321897|ref|NP_703148.4|     ................................................................
gi|28827813|ref|NP_789792.1|      ................................................................


                                        260                     270                                 
                                          |                       |                                 
d1a4ya_                             ......LWI......WEC..GI......TAKGCGD.............................
gi|21955154|ref|NP_653288.1|      ......LWL......KIC..RL......TAAACDE.............................
gi|33519450|ref|NP_789790.2|      ......LML......MYC..CL......TSVSCDS.............................
gi|28827813|ref|NP_789792.1|      ......LVL......RRC..HF......TSLSSEY.............................
gi|119395764|ref|NP_001073289.1|  ......LGL......VNS..GL......TSVCCSA.............................
gi|34878693|ref|NP_004886.3|      ......LGL......VNS..GL......TSVCCSA.............................
gi|158321897|ref|NP_703148.4|     ......LML......NQC..HL......DTAGCGF.............................
gi|194018482|ref|NP_604393.2|     ......LML......AFC..HL......SEQCCEY.............................
gi|110624785|ref|NP_789780.2|     ......LEL......WFC..QL......AAPACKH.............................
gi|21361547|ref|NP_002930.2|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42794608|ref|NP_976318.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42822864|ref|NP_976322.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42822866|ref|NP_976323.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42822868|ref|NP_976321.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42822870|ref|NP_976320.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42822872|ref|NP_976317.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|42822874|ref|NP_976319.1|      ......LWI......WEC..GI......TAKGCGD.............................
gi|291463278|ref|NP_001167553.1|  ......LSL......ENC..HL......TEANCKD.............................
gi|291463280|ref|NP_001167554.1|  ......LSL......ENC..HL......TEANCKD.............................
gi|291463275|ref|NP_001167552.1|  ......LSL......ENC..HL......TEANCKD.............................
gi|8923473|ref|NP_060322.1|       ......LSL......ENC..HL......TEANCKD.............................
gi|194018484|ref|NP_659444.2|     ......LVL......VFC..CL......TENCCSA.............................
gi|187937176|ref|NP_001120727.1|  ......LSL......ENC..RL......TEASCKD.............................
gi|33667040|ref|NP_789781.2|      ......LSI......ENC..NL......TQLTCES.............................
gi|46049100|ref|NP_631915.2|      ......LSL......ENC..RL......TEASCKD.............................
gi|113205085|ref|NP_079003.2|     ......LDL......HQC..SL......TADDVMS.............................
gi|188536116|ref|NP_001120933.1|  ......LWL......VNS..GL......TSVCCSA.............................
gi|338797736|ref|NP_061994.1|     ......LVL......WNN..QL......THTGMAF.............................
gi|5174617|ref|NP_006083.1|       ......LKL......GKN..KI......TSEGGKY.............................
gi|188536002|ref|NP_001120934.1|  ......LGL......VNS..GL......TSVCCSA.............................
gi|116268109|ref|NP_115582.3|     ......LHL......PFS..HL......GPGGALS.............................
gi|15193292|ref|NP_150639.1|      ......LWL......KIC..RL......TAAACDE.............................
gi|118918429|ref|NP_849172.2|     ......LSL......QGN..TV......RDDGARS.............................
gi|289666780|ref|NP_001166250.1|  ......INL......NRP..ILyse...QEESTVH.............................
gi|75709196|ref|NP_996611.2|      ......LSL......ENC..RL......TEASCKD.............................
gi|168986655|ref|NP_919263.2|     ......LEL......SGN..DF......KEDSAAL.............................
gi|116268109|ref|NP_115582.3|     ......LDL......SDN..GL......SVAGVHC.............................
gi|11545912|ref|NP_071445.1|      ......LRL......GNN..YI......TAAGAQV.............................
gi|118918429|ref|NP_849172.2|     ......LHL......QWN..FI......QAGAAQA.............................
gi|289666778|ref|NP_699184.2|     ......---......---..--......EE-STVH.............................
gi|27734755|ref|NP_116264.2|      ......LCA......SGCs.NI......TDAILNA.............................
gi|4506411|ref|NP_002874.1|       ......---......---..--......-------.............................
gi|284447308|ref|NP_036289.3|     ......LCL......SGCs.NL......TDASLTA.............................
gi|289666782|ref|NP_001166251.1|  ......INL......NRP..ILyse...QEESTVH.............................
gi|74271814|ref|NP_001028225.1|   ......LGL......DQT..TL......SD-----.............................
gi|7662386|ref|NP_055737.1|       ......LGL......DQT..TL......SD-----.............................
gi|14719829|ref|NP_127497.1|      ......LGL......DQT..TL......SD-----.............................
gi|296531375|ref|NP_001171835.1|  ......LCA......SGCs.NI......TDAILNA.............................
gi|226342931|ref|NP_079101.3|     ......LDL......SHN..QL......TT-----.............................
gi|308818204|ref|NP_001184224.1|  ......IVL......RYN..KI......EENRIAP.............................
gi|4557543|ref|NP_001384.1|       ......IVL......RYN..KI......EENRIAP.............................
gi|21389431|ref|NP_653221.1|      ......LEL......AVNr.DI......CD-----.............................
gi|14719835|ref|NP_127500.1|      ......L--......---..--......-------.............................
gi|14719833|ref|NP_127499.1|      ......L--......---..--......-------.............................
gi|34878690|ref|NP_899632.1|      ......LEL......DNC..NL......TSHCCWD.............................
gi|229577123|ref|NP_872345.2|     ......LNL......ANN..QV......RAPGAQS.............................
gi|6912466|ref|NP_036436.1|       ......LSV......SDCr.FV......SDFGLRE.............................
gi|156415984|ref|NP_037485.2|     ......---......---..--......-------.............................
gi|7657647|ref|NP_055363.1|       ......---......---..--......-------.............................
gi|7657649|ref|NP_055362.1|       ......---......---..--......-------.............................
gi|289666746|ref|NP_699181.2|     ......LSL......SGCs.KV......TDDGVEL.............................
gi|197333692|ref|NP_001127948.1|  ......LKL......WHN..NI......AY-----.............................
gi|21245134|ref|NP_056165.1|      ......LKL......WHN..NI......AY-----.............................
gi|161333852|ref|NP_659469.3|     ......LSV......SECy.RI......TDDGIQA.............................
gi|284447314|ref|NP_001165184.1|  ......LCL......SGCs.NL......TDASLTA.............................
gi|260763922|ref|NP_001159588.1|  ......---......---..--......-------.............................
gi|4507553|ref|NP_003266.1|       ......---......---..--......-------.............................
gi|21361547|ref|NP_002930.2|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42794608|ref|NP_976318.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42822864|ref|NP_976322.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42822866|ref|NP_976323.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42822868|ref|NP_976321.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42822870|ref|NP_976320.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42822872|ref|NP_976317.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|42822874|ref|NP_976319.1|      ......LSL......QNC..CL......TGAGCGV.............................
gi|62912470|ref|NP_001017403.1|   ......LEL......SHN..QI......EE-----.............................
gi|38348406|ref|NP_940967.1|      ......---......--G..NV......TNITTVS.............................
gi|187608777|ref|NP_038460.4|     ......LSL......SYN..AL......GA---PA.............................
gi|16306595|ref|NP_005974.2|      ......LNL......SGYrkNL......QKSDLST.............................
gi|22748931|ref|NP_689654.1|      ......LNL......RSCd.NI......SDTGIMH.............................
gi|150378503|ref|NP_997046.1|     ......---......---..--......-------.............................
gi|4504379|ref|NP_003658.1|       ......LDL......SYN..LL......ED-----.............................
gi|255683361|ref|NP_001156787.2|  ......LDL......RHIt.EL......DNETVME.............................
gi|61175232|ref|NP_001012992.1|   ......LFL......HGS..PL......TDAGLAL.............................
gi|54607116|ref|NP_938012.2|      ......---......---..--......-------.............................
gi|20302168|ref|NP_619542.1|      ......LNL......SST..SL......RK-----.............................
gi|21450705|ref|NP_659436.1|      ......LVL......SDC..ML......SEEGATL.............................
gi|112380630|ref|NP_036266.2|     ......---......---..--......-------.............................
gi|291190783|ref|NP_001167448.1|  ......LDI......SDN..GL......ES-DLST.............................
gi|291190781|ref|NP_060110.4|     ......LDI......SDN..GL......ES-DLST.............................
gi|66392157|ref|NP_001013860.1|   ......LDL......ADN..GF......GS-DMVT.............................
gi|19924149|ref|NP_612564.1|      ......LDF......QHS..NL......KQ---MS.............................
gi|312433960|ref|NP_001186067.1|  ......IQL......VSC..CL......SANAVKI.............................
gi|312433962|ref|NP_001186068.1|  ......IQL......VSC..CL......SANAVKI.............................
gi|40788015|ref|NP_067032.3|      ......IQL......VSC..CL......SANAVKI.............................
gi|16306588|ref|NP_036292.2|      ......LDL......GWC..PT......LQSSTGC.............................
gi|14249170|ref|NP_116026.1|      ......LNL......SGCs.GF......SEFALQT.............................
gi|156938257|ref|NP_612369.3|     ......LDL......SDN..GF......DS-DLLT.............................
gi|161333854|ref|NP_001104508.1|  ......LSL......RNCe.HL......TAQGIGY.............................
gi|19718734|ref|NP_003255.2|      ......IDI......SKN..SF......HS-----.............................
gi|149274651|ref|NP_115547.1|     ......LEL......NGL..IL......RERDLTI.............................
gi|149274621|ref|NP_001092272.1|  ......LEL......NGL..IL......RERDLTI.............................
gi|291190781|ref|NP_060110.4|     ......---......---..--......-------.............................
gi|291190783|ref|NP_001167448.1|  ......---......---..--......-------.............................
gi|163965441|ref|NP_653303.2|     ......LSL......RNN..NI......DDRGAQL.............................
gi|161333852|ref|NP_659469.3|     ......LTI......NDMp.TL......TDNCVKA.............................
gi|190194416|ref|NP_077302.3|     ......LSL......AHCd.WV......DGLALRG.............................
gi|21264320|ref|NP_612202.1|      ......---......---..--......-------.............................
gi|25777608|ref|NP_078894.2|      ......LRL......SNN..PL......TAAGVAV.............................
gi|218931148|ref|NP_001136357.1|  ......---......---..--......-------.............................
gi|156938257|ref|NP_612369.3|     ......---......---..--......-------.............................
gi|156938336|ref|NP_000237.2|     ......LSL......YNN..CI......CDVGAES.............................
gi|54112380|ref|NP_001005366.1|   ......LHL......SYCn.HV......TDQSINL.............................
gi|54112382|ref|NP_115979.3|      ......LHL......SYCn.HV......TDQSINL.............................
gi|157168349|ref|NP_001093254.2|  ......LDL......SHCa.HV......GDPSVHL.............................
gi|118442828|ref|NP_001072983.1|  ......LYL......ESN..NIfiserpTD-----.............................
gi|4507375|ref|NP_003184.1|       ......LYL......ESN..NIfiserpTD-----.............................
gi|116268109|ref|NP_115582.3|     ......LDL......SHN..SI......SQESALY.............................
gi|25777610|ref|NP_733840.1|      ......LRL......SNN..PL......TAAGVAV.............................
gi|164663798|ref|NP_001106873.1|  ......LNLnas...KGNrvSV......TSEGIKA.............................
gi|66392157|ref|NP_001013860.1|   ......---......---..--......-------.............................
gi|161333854|ref|NP_001104508.1|  ......LTI......NDMp.TL......TDNCVKA.............................
gi|16306580|ref|NP_036440.1|      ......LDL......SHCs.HL......TDQSSNL.............................
gi|341916269|ref|XP_003403438.1|  ......LIL......PTGd.GI......YR-VAKL.............................
gi|119393876|ref|NP_075043.1|     ......LIL......PTGd.GI......YR-VAKL.............................
gi|341916267|ref|XP_003403437.1|  ......LIL......PTGd.GI......YR-VAKL.............................
gi|119393878|ref|NP_004527.2|     ......LIL......PTGd.GI......YR-VAKL.............................
gi|341916263|ref|XP_003403435.1|  ......LIL......PTGd.GI......YR-VAKL.............................
gi|40255157|ref|NP_700356.2|      ......LDL......SSN..NI......SE-----.............................
gi|16306576|ref|NP_036294.1|      ......LDL......RGCa.RI......TPAGLQD.............................
gi|302129689|ref|NP_001180464.1|  grvllfLSL......SGCy.QI......TDHGLRV.............................
gi|302129687|ref|NP_001180463.1|  grvllfLSL......SGCy.QI......TDHGLRV.............................
gi|16306572|ref|NP_036293.1|      grvllfLSL......SGCy.QI......TDHGLRV.............................
gi|341915644|ref|XP_003403561.1|  ......LKL......RNN..PI......KE-----.............................
gi|341913879|ref|XP_003403707.1|  ......LKL......RNN..PI......KE-----.............................
gi|61742136|ref|NP_078831.3|      ......LDL......RGCa.RI......TPAGLQD.............................
gi|38569471|ref|NP_006360.3|      ......LSF......HDM..NL......AD--CQS.............................
gi|16306591|ref|NP_036295.1|      ......LAL......SHCs.RL......SDKGWAQ.............................
gi|51873034|ref|NP_001004055.1|   ......LAL......SHCs.RL......SDKGWAQ.............................
gi|341916265|ref|XP_003403436.1|  ......LIL......PTGd.GI......YR-VAKL.............................
gi|7661860|ref|NP_055480.1|       ......---......---..--......-------.............................
gi|122937351|ref|NP_001073947.1|  ......---......---..--......-------.............................
gi|46249367|ref|NP_996836.1|      ......---......---..--......-------.............................
gi|46249369|ref|NP_996837.1|      ......---......---..--......-------.............................
gi|46249371|ref|NP_996838.1|      ......---......---..--......-------.............................
gi|46249373|ref|NP_996839.1|      ......---......---..--......-------.............................
gi|5174641|ref|NP_006106.1|       ......---......---..--......-------.............................
gi|88942379|ref|XP_933494.1|      ......---......---..--......-------.............................
gi|148356236|ref|NP_001091846.1|  ......---......---..--......-------.............................
gi|61102721|ref|NP_001010890.1|   ......---......---..--......-------.............................
gi|153792112|ref|NP_001093322.1|  ......L--......---..--......-------.............................
gi|153945800|ref|NP_001093584.1|  ......L--......---..--......-------.............................
gi|61696142|ref|NP_001013425.1|   ......---......---..--......-------.............................
gi|226437621|ref|NP_001139816.1|  ......LC-......---..--......-------.............................
gi|59958373|ref|NP_001009611.1|   ......---......---..--......-------.............................
gi|58219004|ref|NP_001010889.1|   ......---......---..--......-------.............................
gi|153791443|ref|NP_001093320.1|  ......---......---..--......-------.............................
gi|310118528|ref|XP_003118894.1|  ......---......---..--......-------.............................
gi|310118526|ref|XP_001130065.3|  ......---......---..--......-------.............................
gi|55742693|ref|NP_078922.1|      ......LSI......TNV..LF......YNEDLAE.............................
gi|194306635|ref|NP_001093260.2|  ......---......---..--......-------.............................
gi|66954681|ref|NP_001019832.1|   ......LSL......ET-..--......-------.............................
gi|59676593|ref|NP_001012277.1|   ......LSL......---..--......-------.............................
gi|59676587|ref|NP_001012276.1|   ......LSL......---..--......-------.............................
gi|12738831|ref|NP_075389.1|      ......LSL......ETY..PA......PEESL--.............................
gi|194306638|ref|NP_001013714.3|  ......---......---..--......-------.............................
gi|8923179|ref|NP_060173.1|       ......IVL......DRVp.AF......RDEHLQG.............................
gi|124249372|ref|NP_001074299.1|  ......LSL......---..--......-------.............................
gi|154800493|ref|NP_001094101.1|  ......---......---..--......-------.............................
gi|29789255|ref|NP_085132.1|      ......LNL......WST..QF......GDAGLRL.............................
gi|194018550|ref|NP_938204.2|     ......LNL......WST..QF......GDAGLRL.............................
gi|157426875|ref|NP_079239.3|     ......---......---..--......-DSAPRAdrapaqpamhavprgfgkkvrvgvqscps
gi|33589814|ref|NP_006327.2|      ......LDI......SRD..RL......SSYYKFKltrev........................
gi|12738834|ref|NP_075390.1|      ......LSL......ETY..PA......PEESLNS.............................
gi|341915238|ref|XP_938952.6|     ......---......---..--......-------.............................
gi|153792140|ref|NP_001093324.1|  ......LSL......ETY..PA......PEESLNS.............................
gi|16506299|ref|NP_443172.1|      ......LHL......KDN..CL......SDAGVRK.............................
gi|194018546|ref|NP_001034450.2|  ......---......---..--......-------.............................
gi|226437632|ref|NP_001004339.2|  ......LDI......SNT..LV......TD-----.............................
gi|113865933|ref|NP_001038945.1|  ......---......---..--......-------.............................
gi|116268109|ref|NP_115582.3|     ......FRL......TSS..CV......STEGLAH.............................
gi|157426839|ref|NP_001093321.1|  ......---......---..--......-------.............................
gi|268832194|ref|NP_001161343.1|  ......---......---..DI......NYEGLDN.............................
gi|268832172|ref|NP_060505.2|     ......---......---..DI......NYEGLDN.............................
gi|268830752|ref|NP_001161339.1|  ......---......---..DI......NYEGLDN.............................
gi|165932385|ref|NP_001107039.1|  ......---......---..--......-------.............................
gi|134288867|ref|NP_997527.2|     ......VDL......GNN..--......-------.............................
gi|23397500|ref|NP_694962.1|      ......LNL......NYN..CI......SDELLEN.............................
gi|148922963|ref|NP_036291.2|     ......LRIdvv...SENpgQI......K-----Fhavkkhswdalikhsprvnvvmhfflyee
gi|16306584|ref|NP_036290.1|      ......LGListarpSFM..DLp.....KSHFISA.............................
gi|45505155|ref|NP_110420.3|      ......VRI......QPS..LT......KDGVFSA.............................
gi|45545409|ref|NP_995308.1|      ......VRI......QPS..LT......KDGVFSA.............................
gi|22547146|ref|NP_060848.2|      ......---......---..--......-------.............................
gi|51558774|ref|NP_001003803.1|   ......IRL......CKCh.YI......EDDCLLR.............................
gi|289803020|ref|NP_001073879.2|  ......LVL......TAT..PV......TPKALLH.............................
gi|158321897|ref|NP_703148.4|     ......---......---..--......-------.............................
gi|28827813|ref|NP_789792.1|      ......---......---..--......-------.............................


                                                                 280                                
                                                                   |                                
d1a4ya_                             .........................L.CRVLRAKE....SL.......................
gi|21955154|ref|NP_653288.1|      .........................L.ASTLSVNQ....SL.......................
gi|33519450|ref|NP_789790.2|      .........................I.SEVLLCSK....SL.......................
gi|28827813|ref|NP_789792.1|      .........................L.STSLLHNK....SL.......................
gi|119395764|ref|NP_001073289.1|  .........................L.SSVLSTNQ....NL.......................
gi|34878693|ref|NP_004886.3|      .........................L.SSVLSTNQ....NL.......................
gi|158321897|ref|NP_703148.4|     .........................L.ALALMGNS....WL.......................
gi|194018482|ref|NP_604393.2|     .........................I.SEMLLRNK....SV.......................
gi|110624785|ref|NP_789780.2|     .........................L.SDALLQNR....SL.......................
gi|21361547|ref|NP_002930.2|      .........................L.CRVLRAKE....SL.......................
gi|42794608|ref|NP_976318.1|      .........................L.CRVLRAKE....SL.......................
gi|42822864|ref|NP_976322.1|      .........................L.CRVLRAKE....SL.......................
gi|42822866|ref|NP_976323.1|      .........................L.CRVLRAKE....SL.......................
gi|42822868|ref|NP_976321.1|      .........................L.CRVLRAKE....SL.......................
gi|42822870|ref|NP_976320.1|      .........................L.CRVLRAKE....SL.......................
gi|42822872|ref|NP_976317.1|      .........................L.CRVLRAKE....SL.......................
gi|42822874|ref|NP_976319.1|      .........................L.CRVLRAKE....SL.......................
gi|291463278|ref|NP_001167553.1|  .........................L.AAVLVVSR....EL.......................
gi|291463280|ref|NP_001167554.1|  .........................L.AAVLVVSR....EL.......................
gi|291463275|ref|NP_001167552.1|  .........................L.AAVLVVSR....EL.......................
gi|8923473|ref|NP_060322.1|       .........................L.AAVLVVSR....EL.......................
gi|194018484|ref|NP_659444.2|     .........................L.GRVLLFSP....TL.......................
gi|187937176|ref|NP_001120727.1|  .........................L.AAVLVVSK....KL.......................
gi|33667040|ref|NP_789781.2|      .........................L.ASCLRQSK....ML.......................
gi|46049100|ref|NP_631915.2|      .........................L.AAVLVVSK....KL.......................
gi|113205085|ref|NP_079003.2|     .........................L.TQVIPLLS....NL.......................
gi|188536116|ref|NP_001120933.1|  .........................L.SSVLSTNQ....NL.......................
gi|338797736|ref|NP_061994.1|     .........................L.GMTLPHTQ....SL.......................
gi|5174617|ref|NP_006083.1|       .........................L.ALAVKNSK....SI.......................
gi|188536002|ref|NP_001120934.1|  .........................L.SSVLSTNQ....NL.......................
gi|116268109|ref|NP_115582.3|     .........................L.AQALDGSP....HL.......................
gi|15193292|ref|NP_150639.1|      .........................L.ASTLSVNQ....SL.......................
gi|118918429|ref|NP_849172.2|     .........................M.AEALASNR....TL.......................
gi|289666780|ref|NP_001166250.1|  .........................V.GRMLKENH....CL.......................
gi|75709196|ref|NP_996611.2|      .........................L.AAVLVVSK....KL.......................
gi|168986655|ref|NP_919263.2|     .........................L.CQALSTNY....QI.......................
gi|116268109|ref|NP_115582.3|     .........................V.LRAVSACW....TL.......................
gi|11545912|ref|NP_071445.1|      .........................L.AEGLRGNT....SL.......................
gi|118918429|ref|NP_849172.2|     .........................L.GQALQLNR....SL.......................
gi|289666778|ref|NP_699184.2|     .........................V.GRMLKENH....CL.......................
gi|27734755|ref|NP_116264.2|      .........................L.GQ---NCP....RL.......................
gi|4506411|ref|NP_002874.1|       .........................-.------IG....TL.......................
gi|284447308|ref|NP_036289.3|     .........................L.GL---NCP....RL.......................
gi|289666782|ref|NP_001166251.1|  .........................V.GRMLKENH....CL.......................
gi|74271814|ref|NP_001028225.1|   .........................-.--------....--.......................
gi|7662386|ref|NP_055737.1|       .........................-.--------....--.......................
gi|14719829|ref|NP_127497.1|      .........................-.--------....--.......................
gi|296531375|ref|NP_001171835.1|  .........................L.GQ---NCP....RL.......................
gi|226342931|ref|NP_079101.3|     .........................V.PAGLP--R....TL.......................
gi|308818204|ref|NP_001184224.1|  .........................L.AW--INQE....NL.......................
gi|4557543|ref|NP_001384.1|       .........................L.AW--INQE....NL.......................
gi|21389431|ref|NP_653221.1|      .........................L.PQELSNLL....KL.......................
gi|14719835|ref|NP_127500.1|      .........................-.--------....--.......................
gi|14719833|ref|NP_127499.1|      .........................-.--------....--.......................
gi|34878690|ref|NP_899632.1|      .........................L.STLLTSSQ....SL.......................
gi|229577123|ref|NP_872345.2|     .........................L.AHALAHNT....NL.......................
gi|6912466|ref|NP_036436.1|       .........................I.AK---LES....RL.......................
gi|156415984|ref|NP_037485.2|     .........................-.--------....--.......................
gi|7657647|ref|NP_055363.1|       .........................-.--------....--.......................
gi|7657649|ref|NP_055362.1|       .........................-.--------....--.......................
gi|289666746|ref|NP_699181.2|     .........................V.AE---NLR....KL.......................
gi|197333692|ref|NP_001127948.1|  .........................I.PAQIGALS....NL.......................
gi|21245134|ref|NP_056165.1|      .........................I.PAQIGALS....NL.......................
gi|161333852|ref|NP_659469.3|     .........................F.CK---SSL....IL.......................
gi|284447314|ref|NP_001165184.1|  .........................L.GL---NCP....RL.......................
gi|260763922|ref|NP_001159588.1|  .........................-.--------....--.......................
gi|4507553|ref|NP_003266.1|       .........................-.--------....--.......................
gi|21361547|ref|NP_002930.2|      .........................L.SSTLRTLP....TL.......................
gi|42794608|ref|NP_976318.1|      .........................L.SSTLRTLP....TL.......................
gi|42822864|ref|NP_976322.1|      .........................L.SSTLRTLP....TL.......................
gi|42822866|ref|NP_976323.1|      .........................L.SSTLRTLP....TL.......................
gi|42822868|ref|NP_976321.1|      .........................L.SSTLRTLP....TL.......................
gi|42822870|ref|NP_976320.1|      .........................L.SSTLRTLP....TL.......................
gi|42822872|ref|NP_976317.1|      .........................L.SSTLRTLP....TL.......................
gi|42822874|ref|NP_976319.1|      .........................L.SSTLRTLP....TL.......................
gi|62912470|ref|NP_001017403.1|   .........................-.LPSLHRCQ....KL.......................
gi|38348406|ref|NP_940967.1|      .........................L.WEEFSSSDla..DL.......................
gi|187608777|ref|NP_038460.4|     .........................L.ARTLQSLPag..TL.......................
gi|16306595|ref|NP_005974.2|      .........................L.VR---RCP....NL.......................
gi|22748931|ref|NP_689654.1|      .........................L.AMG---SL....RL.......................
gi|150378503|ref|NP_997046.1|     .........................-.--------....--.......................
gi|4504379|ref|NP_003658.1|       .........................-.LPSFSVCQ....KL.......................
gi|255683361|ref|NP_001156787.2|  .........................I.VK---RCK....NL.......................
gi|61175232|ref|NP_001012992.1|   .........................L.NPALALHP....AL.......................
gi|54607116|ref|NP_938012.2|      .........................-.--------....--.......................
gi|20302168|ref|NP_619542.1|      .........................InAAWFKNMP....HL.......................
gi|21450705|ref|NP_659436.1|      .........................L.LRGLCANT....VL.......................
gi|112380630|ref|NP_036266.2|     .........................-.--------....--.......................
gi|291190783|ref|NP_001167448.1|  .........................L.IVWLSKNR....SI.......................
gi|291190781|ref|NP_060110.4|     .........................L.IVWLSKNR....SI.......................
gi|66392157|ref|NP_001013860.1|   .........................L.VLAIGRSR....SL.......................
gi|19924149|ref|NP_612564.1|      .........................E.FSVFLSLR....NL.......................
gi|312433960|ref|NP_001186067.1|  .........................L.AQNLHNLV....KL.......................
gi|312433962|ref|NP_001186068.1|  .........................L.AQNLHNLV....KL.......................
gi|40788015|ref|NP_067032.3|      .........................L.AQNLHNLV....KL.......................
gi|16306588|ref|NP_036292.2|      .........................F.TRLAHQLP....NL.......................
gi|14249170|ref|NP_116026.1|      .........................L.LS---SCS....RL.......................
gi|156938257|ref|NP_612369.3|     .........................L.VPALGKNK....SL.......................
gi|161333854|ref|NP_001104508.1|  .........................I.VN----IF....SL.......................
gi|19718734|ref|NP_003255.2|      .........................M.PETCQWPE....KM.......................
gi|149274651|ref|NP_115547.1|     .........................L.AKGLNKSA....SL.......................
gi|149274621|ref|NP_001092272.1|  .........................L.AKGLNKSA....SL.......................
gi|291190781|ref|NP_060110.4|     .........................-.--------....--.......................
gi|291190783|ref|NP_001167448.1|  .........................-.--------....--.......................
gi|163965441|ref|NP_653303.2|     .........................L.GQALSTLH....SC.......................
gi|161333852|ref|NP_659469.3|     .........................L.VE---KCS....RI.......................
gi|190194416|ref|NP_077302.3|     .........................L.AD---RCP....AL.......................
gi|21264320|ref|NP_612202.1|      .........................-.--------....--.......................
gi|25777608|ref|NP_078894.2|      .........................L.MEGLAGNT....SV.......................
gi|218931148|ref|NP_001136357.1|  .........................-.-----N--....--.......................
gi|156938257|ref|NP_612369.3|     .........................-.--------....--.......................
gi|156938336|ref|NP_000237.2|     .........................L.ARVLPDMV....SL.......................
gi|54112380|ref|NP_001005366.1|   .........................L.TAVGTTTRd...SL.......................
gi|54112382|ref|NP_115979.3|      .........................L.TAVGTTTRd...SL.......................
gi|157168349|ref|NP_001093254.2|  .........................L.TAPTSPLRe...TL.......................
gi|118442828|ref|NP_001072983.1|  .........................-.-----VLQ....TV.......................
gi|4507375|ref|NP_003184.1|       .........................-.-----VLQ....TV.......................
gi|116268109|ref|NP_115582.3|     .........................L.LETLPSCP....RVreasvnlgseqsfrihfsredqa
gi|25777610|ref|NP_733840.1|      .........................L.MEGLAGNT....SV.......................
gi|164663798|ref|NP_001106873.1|  .........................V.AS---SCS....YL.......................
gi|66392157|ref|NP_001013860.1|   .........................-.--------....--.......................
gi|161333854|ref|NP_001104508.1|  .........................L.VE---KCS....RI.......................
gi|16306580|ref|NP_036440.1|      .........................L.TAVGSSTRy...SL.......................
gi|341916269|ref|XP_003403438.1|  .........................I.IQQCQQLH....CL.......................
gi|119393876|ref|NP_075043.1|     .........................I.IQQCQQLH....CL.......................
gi|341916267|ref|XP_003403437.1|  .........................I.IQQCQQLH....CL.......................
gi|119393878|ref|NP_004527.2|     .........................I.IQQCQQLH....CL.......................
gi|341916263|ref|XP_003403435.1|  .........................I.IQQCQQLH....CL.......................
gi|40255157|ref|NP_700356.2|      .........................L.QTAFPA-L....QL.......................
gi|16306576|ref|NP_036294.1|      .........................L.P-----CR....EL.......................
gi|302129689|ref|NP_001180464.1|  .........................L.TLG-GGLP....YL.......................
gi|302129687|ref|NP_001180463.1|  .........................L.TLG-GGLP....YL.......................
gi|16306572|ref|NP_036293.1|      .........................L.TLG-GGLP....YL.......................
gi|341915644|ref|XP_003403561.1|  .........................I.PSEIQQLE....FL.......................
gi|341913879|ref|XP_003403707.1|  .........................I.PSEIQQLE....FL.......................
gi|61742136|ref|NP_078831.3|      .........................L.P-------....--.......................
gi|38569471|ref|NP_006360.3|      .........................E.VLFLLQNL....TL.......................
gi|16306591|ref|NP_036295.1|      .........................A.AS---SWP....RL.......................
gi|51873034|ref|NP_001004055.1|   .........................A.AS---SWP....RL.......................
gi|341916265|ref|XP_003403436.1|  .........................I.IQQCQQLH....CL.......................
gi|7661860|ref|NP_055480.1|       .........................-.--------....--.......................
gi|122937351|ref|NP_001073947.1|  .........................-.--------....--.......................
gi|46249367|ref|NP_996836.1|      .........................-.--------....--.......................
gi|46249369|ref|NP_996837.1|      .........................-.--------....--.......................
gi|46249371|ref|NP_996838.1|      .........................-.--------....--.......................
gi|46249373|ref|NP_996839.1|      .........................-.--------....--.......................
gi|5174641|ref|NP_006106.1|       .........................-.--------....--.......................
gi|88942379|ref|XP_933494.1|      .........................-.--------....--.......................
gi|148356236|ref|NP_001091846.1|  .........................-.--------....--.......................
gi|61102721|ref|NP_001010890.1|   .........................-.--------....--.......................
gi|153792112|ref|NP_001093322.1|  .........................-.--------..