SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

L domain-like alignments in Homo sapiens

These alignments are sequences aligned to the 0051010 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1xkua_                             gp..............................................................
gi|16904383|ref|NP_065845.1|      vldyshcslqqvpkevfnfertleelyldanqieelpkqlfncqalrklsipdndlsn......
gi|110825984|ref|NP_004216.2|     an..............................................................
gi|76880480|ref|NP_055632.2|      epvcpercdcqhpqhllctnrglrvvpktsslpsphdvltyslggnfitnitaf..........
gi|288541297|ref|NP_570843.2|     qgldsleslllssnqllqi.............................................
gi|256217721|ref|NP_001073982.2|  pytkniifvetsfttletrafgsnpnltkvvflntqlcqfrpdafgglprledlevtgssflnl
gi|209862903|ref|NP_001129523.1|  dlshnrlsfika....................................................
gi|42544231|ref|NP_006329.2|      pwytprssyreattvdcndlfltavppalpagtqtlllqsnsivrvdqs...............
gi|42544233|ref|NP_963924.1|      pwytprssyreattvdcndlfltavppalpagtqtlllqsnsivrvdqs...............
gi|288541295|ref|NP_001128529.2|  p...............................................................
gi|54607118|ref|NP_056356.2|      sshvvslflqhnkirsvegsqlkayl......................................
gi|55770895|ref|NP_001006600.1|   ngiqefpeniknckvltiveasvnpiskl...................................
gi|13194201|ref|NP_075380.1|      pgacvcynepk.....................................................
gi|8923909|ref|NP_061165.1|       ngiqefpeniknckvltiveasvnpiskl...................................
gi|19743846|ref|NP_598010.1|      v...............................................................
gi|4503271|ref|NP_001911.1|       v...............................................................
gi|7662320|ref|NP_055628.1|       sqtlqevkmnynelteipyfgeptsnitllslvhniipeinaqalqfypalesldlssniisei
gi|238908508|ref|NP_001155000.1|  klnnlrklhvnrnnmv................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|188528675|ref|NP_003052.2|     c...............................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|157694513|ref|NP_060960.2|     pc..............................................................
gi|157426829|ref|NP_001094861.1|  c...............................................................
gi|153791330|ref|NP_065924.3|     qlcvceirpwftpqstyreattvdcndlrltripsnlssdtqvlllqsnniaktvd........
gi|41281398|ref|NP_031399.2|      ensmrldlskrsihi.................................................
gi|52138725|ref|NP_001004432.1|   c...............................................................
gi|62912474|ref|NP_001017404.1|   dls.............................................................
gi|21361633|ref|NP_060238.3|      gtsvpqgllkaarksgqlnlsgrnlsevpqcvwrinvdipeeanqnlsfgater..........
gi|30425563|ref|NP_848665.1|      s...............................................................
gi|50263044|ref|NP_116197.4|      c...............................................................
gi|156139147|ref|NP_079269.4|     a...............................................................
gi|4758460|ref|NP_004479.1|       kmvl............................................................
gi|197927168|ref|NP_001128217.1|  a...............................................................
gi|122937309|ref|NP_001073926.1|  c...............................................................
gi|22749183|ref|NP_689783.1|      c...............................................................
gi|7662102|ref|NP_056379.1|       a...............................................................
gi|198041768|ref|NP_852607.3|     lllhkeilgc......................................................
gi|15029530|ref|NP_071426.1|      n...............................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|4502403|ref|NP_001702.1|       m...............................................................
gi|62912470|ref|NP_001017403.1|   mls.............................................................
gi|30425553|ref|NP_848663.1|      g...............................................................
gi|4504379|ref|NP_003658.1|       l...............................................................
gi|153251229|ref|NP_001258.2|     ................................................................
gi|51317373|ref|NP_065980.1|      ................................................................
gi|4503743|ref|NP_002009.1|       nslknsgv........................................................
gi|301069322|ref|NP_060150.4|     p...............................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|153791507|ref|NP_001093130.1|  tprsiymeastvdcndlglltfparlpantqilllqtnniakieystdf...............
gi|153792227|ref|NP_060804.3|     tprsiymeastvdcndlglltfparlpantqilllqtnniakieystdf...............
gi|153792651|ref|NP_001093128.1|  tprsiymeastvdcndlglltfparlpantqilllqtnniakieystdf...............
gi|238908508|ref|NP_001155000.1|  tvnleakglqefpkdilkik............................................
gi|12007646|ref|NP_072089.1|      cstvergcsvrcdragllrvpael........................................
gi|4826772|ref|NP_004961.1|       adel............................................................
gi|225579152|ref|NP_001139478.1|  adel............................................................
gi|109809759|ref|NP_821079.3|     c...............................................................
gi|226342935|ref|NP_001139727.1|  plr.............................................................
gi|40255157|ref|NP_700356.2|      q...............................................................
gi|4506013|ref|NP_002703.1|       ed..............................................................
gi|86990456|ref|NP_849161.2|      l...............................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|45505137|ref|NP_714914.2|      avscp...........................................................
gi|187829871|ref|NP_001120716.1|  lelhlfmlsgipdtvfdlvelevlklelipdvt...............................
gi|187829877|ref|NP_001120717.1|  lelhlfmlsgipdtvfdlvelevlklelipdvt...............................
gi|62241040|ref|NP_062540.2|      lelhlfmlsgipdtvfdlvelevlklelipdvt...............................
gi|225579152|ref|NP_001139478.1|  g...............................................................
gi|45827729|ref|NP_056171.2|      ipl.............................................................
gi|45827731|ref|NP_874365.2|      ipl.............................................................
gi|122937315|ref|NP_001073929.1|  ltgnhlkclpkeivnqtklreiylkrnqfevf................................
gi|197333706|ref|NP_001127951.1|  hlfmlsgvpdavfdltdldvlklelipeaki.................................
gi|34222199|ref|NP_060573.2|      hlfmlsgvpdavfdltdldvlklelipeaki.................................
gi|4826772|ref|NP_004961.1|       g...............................................................
gi|85986601|ref|NP_067647.2|      p...............................................................
gi|7019381|ref|NP_037363.1|       fp..............................................................
gi|119395738|ref|NP_001073285.1|  gpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylk
gi|119395736|ref|NP_000199.2|     gpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylk
gi|62912472|ref|NP_067649.2|      ................................................................
gi|88702793|ref|NP_612449.2|      qp..............................................................
gi|4557665|ref|NP_000866.1|       gpcpkvceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvk
gi|41349454|ref|NP_958505.1|      psa.............................................................
gi|4506041|ref|NP_002716.1|       psa.............................................................
gi|38202222|ref|NP_938205.1|      i...............................................................
gi|7019383|ref|NP_037413.1|       i...............................................................
gi|312283621|ref|NP_001186009.1|  rdc.............................................................
gi|312283625|ref|NP_001186010.1|  rdc.............................................................
gi|71040111|ref|NP_002014.2|      cdcppnf.........................................................
gi|312283627|ref|NP_001186011.1|  cprd............................................................
gi|19923729|ref|NP_115646.2|      nrlelplimlsglpdtvfeitelqslkleiiknvm.............................
gi|95113664|ref|NP_060684.4|      ipl.............................................................
gi|16418467|ref|NP_443204.1|      v...............................................................
gi|11321571|ref|NP_003053.1|      k...............................................................
gi|226342933|ref|NP_001139726.1|  plr.............................................................
gi|4826876|ref|NP_005005.1|       cfcptnf.........................................................
gi|54792100|ref|NP_001973.2|      pcgglcpkacegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipaldpekln
gi|18677729|ref|NP_570718.1|      pq..............................................................
gi|27363458|ref|NP_076941.2|      ................................................................
gi|34577057|ref|NP_037412.2|      qdlktk..........................................................
gi|8394456|ref|NP_059138.1|       f...............................................................
gi|40217803|ref|NP_079337.2|      rlelalcmlpglpdtvfelseveslrleaicditfppglsqlvhlqelsllhsparlpfslqvf
gi|291190772|ref|NP_000164.5|     vskva...........................................................
gi|171846278|ref|NP_940980.3|     slrssklqshmrhsdsisslasereyitsldlsanelrdidalsqkc.................
gi|260593673|ref|NP_001159530.1|  pq..............................................................
gi|45505137|ref|NP_714914.2|      h...............................................................
gi|308818206|ref|NP_001184225.1|  ................................................................
gi|4505047|ref|NP_002336.1|       gqsspncapecncpesyp..............................................
gi|312283621|ref|NP_001186009.1|  h...............................................................
gi|312283625|ref|NP_001186010.1|  h...............................................................
gi|41327732|ref|NP_958439.1|      kcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqe
gi|41327736|ref|NP_958441.1|      kcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqe
gi|7706093|ref|NP_057646.1|       fmsvne..........................................................
gi|29725609|ref|NP_005219.2|      kcegpcrkvcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqe
gi|31542244|ref|NP_689660.2|      l...............................................................
gi|110825958|ref|NP_001036064.1|  ralrkyyencevvmgnleitsiehnrdlsflrsvrevtgyvlvalnqfrylplenlri......
gi|4885215|ref|NP_005226.1|       ralrkyyencevvmgnleitsiehnrdlsflrsvrevtgyvlvalnqfrylplenlri......
gi|46094076|ref|NP_056331.2|      lf..............................................................
gi|5901992|ref|NP_008966.1|       vyevhdsddwtihdfecp..............................................
gi|54792100|ref|NP_001973.2|      vcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqwirevtgyvlvam
gi|4759146|ref|NP_004778.1|       fadl............................................................
gi|4507531|ref|NP_003256.1|       slaslpkidd......................................................
gi|38490688|ref|NP_849144.2|      te..............................................................
gi|65301141|ref|NP_055835.2|      evpehlfysqditylnlrhnfmqlerpggldtl...............................
gi|193083139|ref|NP_001122394.1|  pckmvdk.........................................................
gi|5031707|ref|NP_005503.1|       pckmvdk.........................................................
gi|4885215|ref|NP_005226.1|       pctdicpkacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaidpek
gi|110825958|ref|NP_001036064.1|  pctdicpkacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaidpek
gi|291219891|ref|NP_919431.2|     flq.............................................................
gi|20302168|ref|NP_619542.1|      ka..............................................................
gi|4507531|ref|NP_003256.1|       ct..............................................................
gi|13375646|ref|NP_078785.1|      l...............................................................
gi|167555127|ref|NP_005573.2|     sveslnlqehrfsdi.................................................
gi|31657140|ref|NP_055030.1|      glcpkeckvgtktidsiqaaqdlvgcthvegslilnlrqgynlepqlqhslglvetitgflkik
gi|41327734|ref|NP_958440.1|      cqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyvlialn
gi|229089140|ref|NP_001019849.2|  t...............................................................
gi|119395738|ref|NP_001073285.1|  evcpgmdirnnltrlhelencsvie.......................................
gi|119395736|ref|NP_000199.2|     evcpgmdirnnltrlhelencsvie.......................................
gi|31657138|ref|NP_000136.2|      ri..............................................................
gi|41327732|ref|NP_958439.1|      cqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyvlialn
gi|41327736|ref|NP_958441.1|      cqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyvlialn
gi|29725609|ref|NP_005219.2|      cqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyvlialn
gi|188536110|ref|NP_689824.2|     glpaad..........................................................
gi|109150416|ref|NP_036425.1|     pqt.............................................................
gi|6912638|ref|NP_036557.1|       evdmsdrgi.......................................................
gi|55741571|ref|NP_065788.1|      cpk.............................................................
gi|193083139|ref|NP_001122394.1|  rp..............................................................
gi|5031707|ref|NP_005503.1|       rp..............................................................
gi|41281398|ref|NP_031399.2|      st..............................................................
gi|54792096|ref|NP_004439.2|      rhlyqgcqvvqgnleltylptnaslsflqdiqevqgyvliahnqvrqvplqrlrivrgtqlfed
gi|4557665|ref|NP_000866.1|       cgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrvaglesl
gi|54792098|ref|NP_001005862.1|   rhlyqgcqvvqgnleltylptnaslsflqdiqevqgyvliahnqvrqvplqrlrivrgtqlfed
gi|54792096|ref|NP_004439.2|      pcarvcyglgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvf
gi|54792098|ref|NP_001005862.1|   pcarvcyglgmehlrevravtsaniqefagckkifgslaflpesfdgdpasntaplqpeqlqvf
gi|62912472|ref|NP_067649.2|      ................................................................
gi|149773484|ref|NP_065913.1|     icqnva..........................................................
gi|16751843|ref|NP_003259.2|      s...............................................................
gi|139948432|ref|NP_056234.2|     acphpcacyv......................................................
gi|90991702|ref|NP_078928.3|      vkwshlrlpwvdldwlidi.............................................
gi|153792305|ref|NP_001093148.1|  a...............................................................
gi|190014581|ref|NP_078788.2|     rqss............................................................
gi|120953300|ref|NP_001073379.1|  leilrcgpwd......................................................
gi|306140491|ref|NP_001182035.1|  t...............................................................
gi|306140493|ref|NP_001182036.1|  t...............................................................
gi|62865618|ref|NP_112218.2|      t...............................................................
gi|62865621|ref|NP_001017388.1|   t...............................................................
gi|262205665|ref|NP_001159864.1|  q...............................................................
gi|5729718|ref|NP_006661.1|       q...............................................................
gi|126517478|ref|NP_653252.3|     vr..............................................................
gi|306140495|ref|NP_001182037.1|  ................................................................
gi|72534676|ref|NP_001026862.1|   p...............................................................
gi|41350337|ref|NP_003254.2|      dr..............................................................
gi|52426787|ref|NP_002535.3|      c...............................................................
gi|193788651|ref|NP_001123362.1|  sgg.............................................................
gi|194306618|ref|NP_001123608.1|  lrevpeglpa......................................................
gi|194306621|ref|NP_001123609.1|  lrevpeglpa......................................................
gi|194306623|ref|NP_001123610.1|  lrevpeglpa......................................................
gi|39930401|ref|NP_065902.1|      lrevpeglpa......................................................
gi|157743290|ref|NP_001099051.1|  gmt.............................................................
gi|299782601|ref|NP_001010847.1|  hac.............................................................
gi|341915001|ref|XP_003403925.1|  mkh.............................................................
gi|255652962|ref|NP_001157397.1|  l...............................................................
gi|255652964|ref|NP_001157398.1|  l...............................................................
gi|84781739|ref|NP_001034118.1|   l...............................................................
gi|30181233|ref|NP_002310.2|      ................................................................
gi|194394161|ref|NP_694992.2|     fql.............................................................
gi|14249428|ref|NP_116162.1|      v...............................................................
gi|256017174|ref|NP_001157683.1|  ansg............................................................
gi|41582239|ref|NP_958934.1|      d...............................................................
gi|5031809|ref|NP_005536.1|       d...............................................................
gi|63003903|ref|NP_963844.2|      dlrempldkm......................................................
gi|223005922|ref|NP_001138549.1|  gdq.............................................................
gi|154091020|ref|NP_065922.3|     i...............................................................
gi|33859670|ref|NP_055931.1|      ansg............................................................
gi|8394456|ref|NP_059138.1|       lpcelqphgl......................................................
gi|256017180|ref|NP_001157685.1|  ansg............................................................
gi|27436867|ref|NP_775101.1|      cqekniq.........................................................
gi|296080773|ref|NP_001171678.1|  cqekniq.........................................................
gi|296080775|ref|NP_001171679.1|  cqekniq.........................................................
gi|34577083|ref|NP_689937.2|      p...............................................................
gi|167555127|ref|NP_005573.2|     kean............................................................
gi|33285015|ref|NP_653199.2|      lekhk...........................................................
gi|291575177|ref|NP_852111.2|     ri..............................................................
gi|24308207|ref|NP_065761.1|      lp..............................................................
gi|31657140|ref|NP_055030.1|      evcpsldirsevaelrqlencsvveghlqillmftatgedfrglsfprltqvtdylllfrvygl
gi|52353306|ref|NP_001005210.1|   gt..............................................................
gi|10190722|ref|NP_065729.1|      s...............................................................
gi|59823631|ref|NP_660333.2|      nrt.............................................................
gi|40217820|ref|NP_055741.2|      fnnisellprp.....................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|219521831|ref|NP_001137140.1|  ................................................................
gi|32469517|ref|NP_862830.1|      ................................................................
gi|21313638|ref|NP_060646.2|      di..............................................................
gi|21389483|ref|NP_653249.1|      ................................................................
gi|61742784|ref|NP_665893.2|      hlcvqqplqllqveflrlsthedpqlleatlaqlp.............................
gi|61742786|ref|NP_665894.2|      hlcvqqplqllqveflrlsthedpqlleatlaqlp.............................
gi|7706093|ref|NP_057646.1|       pk..............................................................
gi|61966761|ref|NP_001013675.1|   dcpevctcvpgglas.................................................
gi|153791466|ref|NP_065754.2|     vs..............................................................
gi|40217823|ref|NP_056382.1|      nlqisdlgln......................................................
gi|157694513|ref|NP_060960.2|     lgef............................................................
gi|221136957|ref|NP_001137475.1|  en..............................................................
gi|221136961|ref|NP_001137476.1|  en..............................................................
gi|221136965|ref|NP_001137477.1|  en..............................................................
gi|221136969|ref|NP_001137478.1|  en..............................................................
gi|221136977|ref|NP_001137480.1|  en..............................................................
gi|221136981|ref|NP_001137481.1|  en..............................................................
gi|221136985|ref|NP_001137482.1|  en..............................................................
gi|33504581|ref|NP_115928.1|      en..............................................................
gi|221136957|ref|NP_001137475.1|  ngl.............................................................
gi|221136961|ref|NP_001137476.1|  ngl.............................................................
gi|221136965|ref|NP_001137477.1|  ngl.............................................................
gi|221136969|ref|NP_001137478.1|  ngl.............................................................
gi|221136977|ref|NP_001137480.1|  ngl.............................................................
gi|221136981|ref|NP_001137481.1|  ngl.............................................................
gi|221136985|ref|NP_001137482.1|  ngl.............................................................
gi|33504581|ref|NP_115928.1|      ngl.............................................................
gi|194018474|ref|NP_001005214.2|  sk..............................................................
gi|40217817|ref|NP_443142.1|      nnr.............................................................
gi|40217825|ref|NP_115605.2|      ycpipcnckvlsps..................................................
gi|291219891|ref|NP_919431.2|     asqr............................................................
gi|4826816|ref|NP_005088.1|       pp..............................................................
gi|38454322|ref|NP_942015.1|      lh..............................................................
gi|40217817|ref|NP_443142.1|      hvdcekkgf.......................................................
gi|164607156|ref|NP_113615.2|     piekmd..........................................................
gi|191252816|ref|NP_001122108.1|  sti.............................................................
gi|40217823|ref|NP_056382.1|      lseispprfp......................................................
gi|27436867|ref|NP_775101.1|      ven.............................................................
gi|296080773|ref|NP_001171678.1|  ven.............................................................
gi|296080775|ref|NP_001171679.1|  ven.............................................................
gi|40217825|ref|NP_115605.2|      q...............................................................
gi|21281681|ref|NP_644807.1|      pse.............................................................
gi|300934750|ref|NP_116166.9|     gt..............................................................
gi|21281673|ref|NP_644813.1|      s...............................................................
gi|66912176|ref|NP_001019782.1|   q...............................................................
gi|301069324|ref|NP_001180264.1|  p...............................................................
gi|116268101|ref|NP_443138.2|     ipqhinstvhd.....................................................
gi|318984125|ref|NP_001188295.1|  da..............................................................
gi|40217820|ref|NP_055741.2|      pc..............................................................
gi|312222719|ref|NP_001185947.1|  hinlvssslssfpilqrsseekilysd.....................................
gi|106067657|ref|NP_000224.2|     tag.............................................................
gi|206725447|ref|NP_001128689.1|  klevkerd........................................................
gi|42542396|ref|NP_964013.1|      klevkerd........................................................
gi|15487670|ref|NP_006353.2|      lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee.....
gi|20143971|ref|NP_006059.2|      m...............................................................
gi|55743114|ref|NP_060161.2|      gdhinlvssslssfpilqrsseekilysd...................................
gi|312222716|ref|NP_001185946.1|  gdhinlvssslssfpilqrsseekilysd...................................
gi|193083136|ref|NP_940908.2|     elptnlpvdtv.....................................................
gi|254039592|ref|NP_116564.2|     lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkite......
gi|87298937|ref|NP_008949.4|      kyie............................................................
gi|13430854|ref|NP_071336.1|      lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkiie......
gi|14277694|ref|NP_060279.2|      lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkiie......
gi|153791282|ref|NP_001093156.1|  lkpgqmemlkltmnkrynvsqqaldlqnlrfdpdlmgrdidiilnrrncmaatlkiie......
gi|194272226|ref|NP_001123563.1|  ldfrni..........................................................
gi|194272228|ref|NP_001123564.1|  ldfrni..........................................................
gi|194272222|ref|NP_001123562.1|  ldfrni..........................................................
gi|194272224|ref|NP_112584.3|     ldfrni..........................................................
gi|62988340|ref|NP_001017924.1|   rtlqctsv........................................................
gi|68800360|ref|NP_004941.2|      f...............................................................
gi|167466264|ref|NP_001006940.3|  k...............................................................
gi|31377705|ref|NP_078824.2|      glqklgpnlpcead..................................................
gi|21361633|ref|NP_060238.3|      ihaiit..........................................................
gi|122937315|ref|NP_001073929.1|  ff..............................................................
gi|299758423|ref|NP_001177652.1|  ................................................................
gi|53729359|ref|NP_612370.3|      ................................................................
gi|53729361|ref|NP_001005373.1|   ................................................................
gi|53729363|ref|NP_001005374.1|   ................................................................
gi|14149694|ref|NP_056428.1|      ppdtsr..........................................................
gi|45439342|ref|NP_689542.2|      lahrgcnvdtpvstltpvktsefenfktkmvitskkdy..........................
gi|217330610|ref|NP_001136098.1|  frvtckdiq.......................................................
gi|288541295|ref|NP_001128529.2|  pse.............................................................
gi|117414162|ref|NP_208325.3|     n...............................................................
gi|19743848|ref|NP_598011.1|      v...............................................................
gi|64085121|ref|NP_000360.2|      vtckdiq.........................................................
gi|31621309|ref|NP_036604.2|      vif.............................................................
gi|64085161|ref|NP_001018046.1|   frvtckdiq.......................................................
gi|50593002|ref|NP_003081.2|      elieqaaqytnavrd.................................................
gi|5454088|ref|NP_006392.1|       krrihlelrnrtpaav................................................
gi|7657419|ref|NP_055174.1|       l...............................................................
gi|5453880|ref|NP_006296.1|       rihlelrnrtpsdvkelvldnsrsnegk....................................
gi|45827729|ref|NP_056171.2|      l...............................................................
gi|45827731|ref|NP_874365.2|      l...............................................................
gi|306922420|ref|NP_001182457.1|  pcpfqcycfggpkl..................................................
gi|226342933|ref|NP_001139726.1|  l...............................................................
gi|239582714|ref|NP_005815.2|     kyldcqerklvyv...................................................
gi|125625324|ref|NP_001074960.1|  lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee.....
gi|54792102|ref|NP_001005915.1|   vcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqwirevtgyvlvam
gi|39930571|ref|NP_932341.1|      lgnfgv..........................................................
gi|16751843|ref|NP_003259.2|      scsfdgriafy.....................................................
gi|12597641|ref|NP_075052.1|      ytlipadikkdv....................................................
gi|4826651|ref|NP_004919.1|       se..............................................................
gi|15529980|ref|NP_219481.1|      ekm.............................................................
gi|40254924|ref|NP_060979.2|      e...............................................................
gi|14916498|ref|NP_148935.1|      pt..............................................................
gi|7661704|ref|NP_054776.1|       pt..............................................................
gi|16418445|ref|NP_443185.1|      ................................................................
gi|13569879|ref|NP_112182.1|      lelrnrspeev.....................................................
gi|5901898|ref|NP_008923.1|       klevkerd........................................................
gi|306966160|ref|NP_001182474.1|  tf..............................................................
gi|194239699|ref|NP_689928.3|     svlv............................................................
gi|194239701|ref|NP_001123519.1|  svlv............................................................
gi|13027616|ref|NP_076431.1|      esill...........................................................
gi|218931217|ref|NP_001136400.1|  esill...........................................................
gi|289547512|ref|NP_055649.4|     thngt...........................................................
gi|28872863|ref|NP_056270.2|      sls.............................................................
gi|116325993|ref|NP_001006608.2|  thngt...........................................................
gi|61966709|ref|NP_001013648.1|   q...............................................................
gi|305632814|ref|NP_001182209.1|  dvf.............................................................
gi|13562088|ref|NP_112153.1|      v...............................................................
gi|75677612|ref|NP_955372.2|      nthngt..........................................................
gi|53829385|ref|NP_443120.2|      t...............................................................
gi|150378449|ref|NP_892014.1|     hfhsviyinasenll.................................................
gi|59889558|ref|NP_001012331.1|   lpgae...........................................................
gi|4585712|ref|NP_002520.2|       lpgae...........................................................
gi|19743850|ref|NP_598012.1|      p...............................................................
gi|148664213|ref|NP_001091989.1|  vtlvdkd.........................................................
gi|210147571|ref|NP_001129951.1|  nvelss..........................................................
gi|115583679|ref|NP_653172.2|     sl..............................................................
gi|157785649|ref|NP_001099129.1|  regqkdfvfvkf....................................................
gi|288541297|ref|NP_570843.2|     pwn.............................................................
gi|46397369|ref|NP_997002.1|      t...............................................................
gi|239735605|ref|NP_060766.5|     ldeegirrlgaltl..................................................
gi|33469951|ref|NP_878256.1|      lhlah...........................................................
gi|53828918|ref|NP_004572.3|      lhlah...........................................................
gi|205360954|ref|NP_001009944.2|  dat.............................................................
gi|205360962|ref|NP_000287.3|     dat.............................................................
gi|38348406|ref|NP_940967.1|      d...............................................................
gi|4758460|ref|NP_004479.1|       g...............................................................
gi|219555702|ref|NP_001137230.1|  i...............................................................
gi|219555704|ref|NP_001137231.1|  i...............................................................
gi|219555700|ref|NP_001137229.1|  i...............................................................
gi|55741567|ref|NP_085129.1|      i...............................................................
gi|62899065|ref|NP_060610.2|      dlae............................................................
gi|56118210|ref|NP_001007793.1|   hl..............................................................
gi|6912604|ref|NP_036535.1|       lrnrapsdvkelaldnsrsnegklealtdefee...............................
gi|55956794|ref|NP_001007157.1|   rn..............................................................
gi|59889560|ref|NP_002521.2|      rn..............................................................
gi|59889562|ref|NP_001012338.1|   rn..............................................................
gi|4503743|ref|NP_002009.1|       lpfvr...........................................................
gi|55770895|ref|NP_001006600.1|   v...............................................................
gi|226342931|ref|NP_079101.3|     dr..............................................................
gi|8923909|ref|NP_061165.1|       v...............................................................
gi|20143971|ref|NP_006059.2|      a...............................................................
gi|14042939|ref|NP_114413.1|      ky..............................................................
gi|21071028|ref|NP_036536.2|      gkwihlelrnrtpsdvk...............................................
gi|23097240|ref|NP_690852.1|      ksdr............................................................
gi|65301141|ref|NP_055835.2|      ldrvv...........................................................
gi|19743852|ref|NP_598013.1|      ................................................................
gi|223718151|ref|NP_001138779.1|  qs..............................................................
gi|55956790|ref|NP_001007098.1|   en..............................................................
gi|65506779|ref|NP_001018076.1|   en..............................................................
gi|312283627|ref|NP_001186011.1|  l...............................................................
gi|65506769|ref|NP_001018075.1|   en..............................................................
gi|21361306|ref|NP_006171.2|      en..............................................................
gi|65506745|ref|NP_001018074.1|   en..............................................................
gi|291575163|ref|NP_001167575.1|  s...............................................................
gi|291575165|ref|NP_001167576.1|  s...............................................................
gi|4557417|ref|NP_000582.1|       s...............................................................
gi|91105159|ref|NP_001035110.1|   s...............................................................
gi|4504077|ref|NP_000165.1|       t...............................................................
gi|41327734|ref|NP_958440.1|      kcegpcrkvcngigigefkdslsinatnikhfk...............................
gi|148664188|ref|NP_689972.3|     ag..............................................................
gi|4504073|ref|NP_000398.1|       t...............................................................
gi|54607118|ref|NP_056356.2|      aa..............................................................
gi|239582714|ref|NP_005815.2|     vfp.............................................................
gi|7706093|ref|NP_057646.1|       ls..............................................................
gi|210147569|ref|NP_001129950.1|  te..............................................................
gi|45593138|ref|NP_660299.2|      clnfsglslslph...................................................
gi|34577057|ref|NP_037412.2|      t...............................................................
gi|19718734|ref|NP_003255.2|      sl..............................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|8922644|ref|NP_060675.1|       t...............................................................


                                                                                              10    
                                                                                               |    
d1xkua_                             ..................................................--VCPFRCQCHLRV
gi|16904383|ref|NP_065845.1|      ..................................................--------------
gi|110825984|ref|NP_004216.2|     ..................................................--------LGDIEA
gi|76880480|ref|NP_055632.2|      ..................................................----DFHRLGQLRR
gi|288541297|ref|NP_570843.2|     ..................................................-QPAHFSQCSNLKE
gi|256217721|ref|NP_001073982.2|  .................................................s--TNIFSNLTSLGK
gi|209862903|ref|NP_001129523.1|  ..................................................---SSMSHLQSLRE
gi|42544231|ref|NP_006329.2|      ..................................................----ELGYLANLTE
gi|42544233|ref|NP_963924.1|      ..................................................----ELGYLANLTE
gi|288541295|ref|NP_001128529.2|  ..................................................---AHFSQCSNLKE
gi|54607118|ref|NP_056356.2|      ..................................................----------SLEV
gi|55770895|ref|NP_001006600.1|   ..................................................--PDGFSQLLNLTQ
gi|13194201|ref|NP_075380.1|      ..................................................------------VT
gi|8923909|ref|NP_061165.1|       ..................................................--PDGFSQLLNLTQ
gi|19743846|ref|NP_598010.1|      ..................................................---CPFRCQCHLRV
gi|4503271|ref|NP_001911.1|       ..................................................---CPFRCQCHLRV
gi|7662320|ref|NP_055628.1|       ............................................ktssfp--------RMQLKY
gi|238908508|ref|NP_001155000.1|  ..................................................--------------
gi|11321571|ref|NP_003053.1|      ..................................................---CPTKCTCSAAS
gi|188528675|ref|NP_003052.2|     ..................................................----PALCTCTGTT
gi|4759146|ref|NP_004778.1|       ..................................................---CPAQCSCSGST
gi|157694513|ref|NP_060960.2|     ..................................................-------SCDGDRR
gi|157426829|ref|NP_001094861.1|  ..................................................------ECTVQTRA
gi|153791330|ref|NP_065924.3|     ..................................................----ELQQLFNLTE
gi|41281398|ref|NP_031399.2|      ..................................................-LPSSIKELTQLTE
gi|52138725|ref|NP_001004432.1|   ..................................................------DCTSQPQA
gi|62912474|ref|NP_001017404.1|   ..................................................--------------
gi|21361633|ref|NP_060238.3|      ..................................................-----WWEQTDLTK
gi|30425563|ref|NP_848665.1|      ..................................................-CPMLCTCYSSPPT
gi|50263044|ref|NP_116197.4|      ..................................................------ECSAQDRA
gi|156139147|ref|NP_079269.4|     ..................................................---CPKNCRCDGKI
gi|4758460|ref|NP_004479.1|       ..................................................-----------LEQ
gi|197927168|ref|NP_001128217.1|  ..................................................---CPKNCRCDGKI
gi|122937309|ref|NP_001073926.1|  ..................................................--PVACSCSNQASR
gi|22749183|ref|NP_689783.1|      ..................................................------ECSAQNKS
gi|7662102|ref|NP_056379.1|       ..................................................---CPPKCRCEKLL
gi|198041768|ref|NP_852607.3|     ..................................................---SSVCQLCTGRQ
gi|15029530|ref|NP_071426.1|      ..................................................-CPSVCSCSNQFSK
gi|194440719|ref|NP_612490.1|     ..................................................-CPQACICDNSRRH
gi|4502403|ref|NP_001702.1|       ..................................................---CPFGCHCHLRV
gi|62912470|ref|NP_001017403.1|   ..................................................--------------
gi|30425553|ref|NP_848663.1|      ..................................................-CPRDCVCYPAPMT
gi|4504379|ref|NP_003658.1|       ..................................................------------LR
gi|153251229|ref|NP_001258.2|     ..................................................-CPQNCHCHSDLQH
gi|51317373|ref|NP_065980.1|      ..................................................-CPSVCSCSNQFSK
gi|4503743|ref|NP_002009.1|       ..................................................--PDDIFKLDDLSV
gi|301069322|ref|NP_060150.4|     ..................................................--MCPFGCQCYSRV
gi|188528675|ref|NP_003052.2|     ..................................................---CPHKCRCEANV
gi|153791507|ref|NP_001093130.1|  ..................................................--------PVNLTG
gi|153792227|ref|NP_060804.3|     ..................................................--------PVNLTG
gi|153792651|ref|NP_001093128.1|  ..................................................--------PVNLTG
gi|238908508|ref|NP_001155000.1|  ..................................................----------YVKY
gi|12007646|ref|NP_072089.1|      ..................................................--------PCEAVS
gi|4826772|ref|NP_004961.1|       ..................................................-------------S
gi|225579152|ref|NP_001139478.1|  ..................................................-------------S
gi|109809759|ref|NP_821079.3|     ..................................................----PKGCRCEGKM
gi|226342935|ref|NP_001139727.1|  ..................................................------CSCPRVDT
gi|40255157|ref|NP_700356.2|      ..................................................-----------LKY
gi|4506013|ref|NP_002703.1|       ..................................................--------------
gi|86990456|ref|NP_849161.2|      ..................................................-------CRCEGRL
gi|194440719|ref|NP_612490.1|     ..................................................-CPRACVCVPESRH
gi|45505137|ref|NP_714914.2|      ..................................................----RDCACSQEGV
gi|187829871|ref|NP_001120716.1|  ..................................................-IPPSIAQLTGLKE
gi|187829877|ref|NP_001120717.1|  ..................................................-IPPSIAQLTGLKE
gi|62241040|ref|NP_062540.2|      ..................................................-IPPSIAQLTGLKE
gi|225579152|ref|NP_001139478.1|  ..................................................----AFLGLKALRW
gi|45827729|ref|NP_056171.2|      ..................................................-----WRCNRHVES
gi|45827731|ref|NP_874365.2|      ..................................................-----WRCNRHVES
gi|122937315|ref|NP_001073929.1|  ..................................................--PQELCVLYTLEI
gi|197333706|ref|NP_001127951.1|  ..................................................--PAKISQMTNLQE
gi|34222199|ref|NP_060573.2|      ..................................................--PAKISQMTNLQE
gi|4826772|ref|NP_004961.1|       ..................................................----AFLGLKALRW
gi|85986601|ref|NP_067647.2|      ..................................................-----VQCLCQGLE
gi|7019381|ref|NP_037363.1|       ..................................................---AELHNVQSVHT
gi|119395738|ref|NP_001073285.1|  ............................irrsyalvslsffrklrlirge--------------
gi|119395736|ref|NP_000199.2|     ............................irrsyalvslsffrklrlirge--------------
gi|62912472|ref|NP_067649.2|      ..................................................--------------
gi|88702793|ref|NP_612449.2|      ..................................................------------QT
gi|4557665|ref|NP_000866.1|       ..................................................--------------
gi|41349454|ref|NP_958505.1|      ..................................................--------------
gi|4506041|ref|NP_002716.1|       ..................................................--------------
gi|38202222|ref|NP_938205.1|      ..................................................--PSDLKNLLKVER
gi|7019383|ref|NP_037413.1|       ..................................................--PSDLKNLLKVER
gi|312283621|ref|NP_001186009.1|  ..................................................-------ACSQEGV
gi|312283625|ref|NP_001186010.1|  ..................................................-------ACSQEGV
gi|71040111|ref|NP_002014.2|      ..................................................-----------PTA
gi|312283627|ref|NP_001186011.1|  ..................................................------CACSQEGV
gi|19923729|ref|NP_115646.2|      ..................................................-IPATIAQLDNLQE
gi|95113664|ref|NP_060684.4|      ..................................................-----WRCNRHVES
gi|16418467|ref|NP_443204.1|      ..................................................--------------
gi|11321571|ref|NP_003053.1|      ..................................................-------CRCEGTI
gi|226342933|ref|NP_001139726.1|  ..................................................------CSCPRVDT
gi|4826876|ref|NP_005005.1|       ..................................................-----------PSS
gi|54792100|ref|NP_001973.2|      .......................vfrtvreitgylniqswpphmhnfsvf--------------
gi|18677729|ref|NP_570718.1|      ..................................................------CCDCKETE
gi|27363458|ref|NP_076941.2|      ..................................................--PCVCQNLSESLS
gi|34577057|ref|NP_037412.2|      ..................................................---------VNVQV
gi|8394456|ref|NP_059138.1|       ..................................................-------------T
gi|40217803|ref|NP_079337.2|      ..lrdhlkvmrvkceelrevplwvfglrgleelhleglfpqelaraatle----SLRELKQLKV
gi|291190772|ref|NP_000164.5|     ..................................................----------SHLE
gi|171846278|ref|NP_940980.3|     ..................................................---CISVHLEHLEK
gi|260593673|ref|NP_001159530.1|  ..................................................------CCDCKETE
gi|45505137|ref|NP_714914.2|      ..................................................--PLAFQGLKRLHT
gi|308818206|ref|NP_001184225.1|  ..................................................--------------
gi|4505047|ref|NP_002336.1|       ..................................................------------SA
gi|312283621|ref|NP_001186009.1|  ..................................................--PLAFQGLKRLHT
gi|312283625|ref|NP_001186010.1|  ..................................................--PLAFQGLKRLHT
gi|41327732|ref|NP_958439.1|      ldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavv--------------
gi|41327736|ref|NP_958441.1|      ldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavv--------------
gi|7706093|ref|NP_057646.1|       ..................................................------SCYKYGQT
gi|29725609|ref|NP_005219.2|      ldilktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavv--------------
gi|31542244|ref|NP_689660.2|      ..................................................--------------
gi|110825958|ref|NP_001036064.1|  ..................................................--------------
gi|4885215|ref|NP_005226.1|       ..................................................--------------
gi|46094076|ref|NP_056331.2|      ..................................................-------DSFSLTR
gi|5901992|ref|NP_008966.1|       ..................................................--MECFCPPSFPTA
gi|54792100|ref|NP_001973.2|      ........................nefstlplpnlrvvrgtqvydgkfai--------------
gi|4759146|ref|NP_004778.1|       ..................................................--ACPEKCRCEGTT
gi|4507531|ref|NP_003256.1|       ..................................................---FSFQWLKCLEH
gi|38490688|ref|NP_849144.2|      ..................................................--------------
gi|65301141|ref|NP_055835.2|      ..................................................------YKFSQLKG
gi|193083139|ref|NP_001122394.1|  ..................................................-------------K
gi|5031707|ref|NP_005503.1|       ..................................................-------------K
gi|4885215|ref|NP_005226.1|       ....................lnvfrtvreitgflniqswppnmtdfsvfs--------------
gi|110825958|ref|NP_001036064.1|  ....................lnvfrtvreitgflniqswppnmtdfsvfs--------------
gi|291219891|ref|NP_919431.2|     ..................................................----------HVTQ
gi|20302168|ref|NP_619542.1|      ..................................................--------------
gi|4507531|ref|NP_003256.1|       ..................................................---------VSHEV
gi|13375646|ref|NP_078785.1|      ..................................................-------------S
gi|167555127|ref|NP_005573.2|     ..................................................-SSTTFQCFTQLQE
gi|31657140|ref|NP_055030.1|      ......................hsfalvslgffknlklirgdamvdgnyt--------------
gi|41327734|ref|NP_958440.1|      ...................................tveriplenlqiirg--------------
gi|229089140|ref|NP_001019849.2|  ..................................................--------------
gi|119395738|ref|NP_001073285.1|  ..................................................--------------
gi|119395736|ref|NP_000199.2|     ..................................................--------------
gi|31657138|ref|NP_000136.2|      ..................................................-------CHCSNRV
gi|41327732|ref|NP_958439.1|      ...................................tveriplenlqiirg--------------
gi|41327736|ref|NP_958441.1|      ...................................tveriplenlqiirg--------------
gi|29725609|ref|NP_005219.2|      ...................................tveriplenlqiirg--------------
gi|188536110|ref|NP_689824.2|     ..................................................-----------ATA
gi|109150416|ref|NP_036425.1|     ..................................................--------------
gi|6912638|ref|NP_036557.1|       ..................................................--------------
gi|55741571|ref|NP_065788.1|      ..................................................--YCVCQNLSESLG
gi|193083139|ref|NP_001122394.1|  ..................................................--------------
gi|5031707|ref|NP_005503.1|       ..................................................--------------
gi|41281398|ref|NP_031399.2|      ..................................................--------------
gi|54792096|ref|NP_004439.2|      .........................................nyalavldn--------------
gi|4557665|ref|NP_000866.1|       .....................................gdlfpnltvirgw--------------
gi|54792098|ref|NP_001005862.1|   .........................................nyalavldn--------------
gi|54792096|ref|NP_004439.2|      .........etleeitgylyisawpdslpdlsvfqnlqvirgrilhngay--------------
gi|54792098|ref|NP_001005862.1|   .........etleeitgylyisawpdslpdlsvfqnlqvirgrilhngay--------------
gi|62912472|ref|NP_067649.2|      ..................................................--------------
gi|149773484|ref|NP_065913.1|     ..................................................----------PTLT
gi|16751843|ref|NP_003259.2|      ..................................................----------SVRH
gi|139948432|ref|NP_056234.2|     ..................................................-----------PSE
gi|90991702|ref|NP_078928.3|      ..................................................--------SCQITE
gi|153792305|ref|NP_001093148.1|  ..................................................--------------
gi|190014581|ref|NP_078788.2|     ..................................................--------------
gi|120953300|ref|NP_001073379.1|  ..................................................-------TLQQVTT
gi|306140491|ref|NP_001182035.1|  ..................................................--------------
gi|306140493|ref|NP_001182036.1|  ..................................................--------------
gi|62865618|ref|NP_112218.2|      ..................................................--------------
gi|62865621|ref|NP_001017388.1|   ..................................................--------------
gi|262205665|ref|NP_001159864.1|  ..................................................-CPALCECSEAART
gi|5729718|ref|NP_006661.1|       ..................................................-CPALCECSEAART
gi|126517478|ref|NP_653252.3|     ..................................................--------------
gi|306140495|ref|NP_001182037.1|  ..................................................--------------
gi|72534676|ref|NP_001026862.1|   ..................................................---CDVYTYLHEKY
gi|41350337|ref|NP_003254.2|      ..................................................--------------
gi|52426787|ref|NP_002535.3|      ..................................................------ICTERHRH
gi|193788651|ref|NP_001123362.1|  ..................................................--------------
gi|194306618|ref|NP_001123608.1|  ..................................................--------------
gi|194306621|ref|NP_001123609.1|  ..................................................--------------
gi|194306623|ref|NP_001123610.1|  ..................................................--------------
gi|39930401|ref|NP_065902.1|      ..................................................--------------
gi|157743290|ref|NP_001099051.1|  ..................................................--------------
gi|299782601|ref|NP_001010847.1|  ..................................................---PAGCACTDPHT
gi|341915001|ref|XP_003403925.1|  ..................................................--------------
gi|255652962|ref|NP_001157397.1|  ..................................................-------------E
gi|255652964|ref|NP_001157398.1|  ..................................................-------------E
gi|84781739|ref|NP_001034118.1|   ..................................................-------------E
gi|30181233|ref|NP_002310.2|      ..................................................-------------T
gi|194394161|ref|NP_694992.2|     ..................................................--------------
gi|14249428|ref|NP_116162.1|      ..................................................--------------
gi|256017174|ref|NP_001157683.1|  ..................................................-------------G
gi|41582239|ref|NP_958934.1|      ..................................................--------------
gi|5031809|ref|NP_005536.1|       ..................................................--------------
gi|63003903|ref|NP_963844.2|      ..................................................--------------
gi|223005922|ref|NP_001138549.1|  ..................................................--------------
gi|154091020|ref|NP_065922.3|     ..................................................--------------
gi|33859670|ref|NP_055931.1|      ..................................................-------------G
gi|8394456|ref|NP_059138.1|       ..................................................--------------
gi|256017180|ref|NP_001157685.1|  ..................................................-------------G
gi|27436867|ref|NP_775101.1|      ..................................................--------------
gi|296080773|ref|NP_001171678.1|  ..................................................--------------
gi|296080775|ref|NP_001171679.1|  ..................................................--------------
gi|34577083|ref|NP_689937.2|      ..................................................--------------
gi|167555127|ref|NP_005573.2|     ..................................................------------KT
gi|33285015|ref|NP_653199.2|      ..................................................-------------N
gi|291575177|ref|NP_852111.2|     ..................................................-------CHCSNRV
gi|24308207|ref|NP_065761.1|      ..................................................--------------
gi|31657140|ref|NP_055030.1|      ..................eslrdlfpnlavirgtrlflgyalvifemphl--------------
gi|52353306|ref|NP_001005210.1|   ..................................................--SCPVLCTCRNQV
gi|10190722|ref|NP_065729.1|      ..................................................-CPDKCYCQSSTNF
gi|59823631|ref|NP_660333.2|      ..................................................--------------
gi|40217820|ref|NP_055741.2|      ..................................................--------------
gi|95113664|ref|NP_060684.4|      ..................................................--------------
gi|219521831|ref|NP_001137140.1|  ..................................................---CPTACICATDI
gi|32469517|ref|NP_862830.1|      ..................................................---CPTACICATDI
gi|21313638|ref|NP_060646.2|      ..................................................--------------
gi|21389483|ref|NP_653249.1|      ..................................................--------------
gi|61742784|ref|NP_665893.2|      ..................................................--------------
gi|61742786|ref|NP_665894.2|      ..................................................--------------
gi|7706093|ref|NP_057646.1|       ..................................................----------NHVI
gi|61966761|ref|NP_001013675.1|   ..................................................--------------
gi|153791466|ref|NP_065754.2|     ..................................................---CPAACLCASNI
gi|40217823|ref|NP_056382.1|      ..................................................--------------
gi|157694513|ref|NP_060960.2|     ..................................................--------------
gi|221136957|ref|NP_001137475.1|  ..................................................-----------VLN
gi|221136961|ref|NP_001137476.1|  ..................................................-----------VLN
gi|221136965|ref|NP_001137477.1|  ..................................................-----------VLN
gi|221136969|ref|NP_001137478.1|  ..................................................-----------VLN
gi|221136977|ref|NP_001137480.1|  ..................................................-----------VLN
gi|221136981|ref|NP_001137481.1|  ..................................................-----------VLN
gi|221136985|ref|NP_001137482.1|  ..................................................-----------VLN
gi|33504581|ref|NP_115928.1|      ..................................................-----------VLN
gi|221136957|ref|NP_001137475.1|  ..................................................-------------N
gi|221136961|ref|NP_001137476.1|  ..................................................-------------N
gi|221136965|ref|NP_001137477.1|  ..................................................-------------N
gi|221136969|ref|NP_001137478.1|  ..................................................-------------N
gi|221136977|ref|NP_001137480.1|  ..................................................-------------N
gi|221136981|ref|NP_001137481.1|  ..................................................-------------N
gi|221136985|ref|NP_001137482.1|  ..................................................-------------N
gi|33504581|ref|NP_115928.1|      ..................................................-------------N
gi|194018474|ref|NP_001005214.2|  ..................................................---CPNNCLCQAQE
gi|40217817|ref|NP_443142.1|      ..................................................--------------
gi|40217825|ref|NP_115605.2|      ..................................................-----------GLL
gi|291219891|ref|NP_919431.2|     ..................................................-----------ISS
gi|4826816|ref|NP_005088.1|       ..................................................--------------
gi|38454322|ref|NP_942015.1|      ..................................................--NCPYKCICAADL
gi|40217817|ref|NP_443142.1|      ..................................................--------------
gi|164607156|ref|NP_113615.2|     ..................................................--------------
gi|191252816|ref|NP_001122108.1|  ..................................................--------------
gi|40217823|ref|NP_056382.1|      ..................................................--------------
gi|27436867|ref|NP_775101.1|      ..................................................-----------VLY
gi|296080773|ref|NP_001171678.1|  ..................................................-----------VLY
gi|296080775|ref|NP_001171679.1|  ..................................................-----------VLY
gi|40217825|ref|NP_115605.2|      ..................................................--------------
gi|21281681|ref|NP_644807.1|      ..................................................--------------
gi|300934750|ref|NP_116166.9|     ..................................................--------------
gi|21281673|ref|NP_644813.1|      ..................................................--------------
gi|66912176|ref|NP_001019782.1|   ..................................................-----------WNE
gi|301069324|ref|NP_001180264.1|  ..................................................--MCPFGCQCYSRV
gi|116268101|ref|NP_443138.2|     ..................................................--------------
gi|318984125|ref|NP_001188295.1|  ..................................................--------------
gi|40217820|ref|NP_055741.2|      ..................................................----YCEVKESLFH
gi|312222719|ref|NP_001185947.1|  ..................................................-------------R
gi|106067657|ref|NP_000224.2|     ..................................................--------------
gi|206725447|ref|NP_001128689.1|  ..................................................--------------
gi|42542396|ref|NP_964013.1|      ..................................................--------------
gi|15487670|ref|NP_006353.2|      ..................................................--------------
gi|20143971|ref|NP_006059.2|      ..................................................--------------
gi|55743114|ref|NP_060161.2|      ..................................................-------------R
gi|312222716|ref|NP_001185946.1|  ..................................................-------------R
gi|193083136|ref|NP_940908.2|     ..................................................--------------
gi|254039592|ref|NP_116564.2|     ..................................................--------------
gi|87298937|ref|NP_008949.4|      ..................................................--------------
gi|13430854|ref|NP_071336.1|      ..................................................--------------
gi|14277694|ref|NP_060279.2|      ..................................................--------------
gi|153791282|ref|NP_001093156.1|  ..................................................--------------
gi|194272226|ref|NP_001123563.1|  ..................................................--------------
gi|194272228|ref|NP_001123564.1|  ..................................................--------------
gi|194272222|ref|NP_001123562.1|  ..................................................--------------
gi|194272224|ref|NP_112584.3|     ..................................................--------------
gi|62988340|ref|NP_001017924.1|   ..................................................--------------
gi|68800360|ref|NP_004941.2|      ..................................................--PTCLLCTCISTT
gi|167466264|ref|NP_001006940.3|  ..................................................--------------
gi|31377705|ref|NP_078824.2|      ..................................................--------------
gi|21361633|ref|NP_060238.3|      ..................................................--------------
gi|122937315|ref|NP_001073929.1|  ..................................................--------------
gi|299758423|ref|NP_001177652.1|  ..................................................--------------
gi|53729359|ref|NP_612370.3|      ..................................................--------------
gi|53729361|ref|NP_001005373.1|   ..................................................--------------
gi|53729363|ref|NP_001005374.1|   ..................................................--------------
gi|14149694|ref|NP_056428.1|      ..................................................--------------
gi|45439342|ref|NP_689542.2|      ..................................................--------------
gi|217330610|ref|NP_001136098.1|  ..................................................--------------
gi|288541295|ref|NP_001128529.2|  ..................................................------CTCSRASQ
gi|117414162|ref|NP_208325.3|     ..................................................--------------
gi|19743848|ref|NP_598011.1|      ..................................................---CPFRCQCHLRV
gi|64085121|ref|NP_000360.2|      ..................................................--------------
gi|31621309|ref|NP_036604.2|      ..................................................--------------
gi|64085161|ref|NP_001018046.1|   ..................................................--------------
gi|50593002|ref|NP_003081.2|      ..................................................--------------
gi|5454088|ref|NP_006392.1|       ..................................................--------------
gi|7657419|ref|NP_055174.1|       ..................................................--PTCLVCVCLGSS
gi|5453880|ref|NP_006296.1|       ..................................................--------------
gi|45827729|ref|NP_056171.2|      ..................................................--------------
gi|45827731|ref|NP_874365.2|      ..................................................--------------
gi|306922420|ref|NP_001182457.1|  ..................................................------------LL
gi|226342933|ref|NP_001139726.1|  ..................................................--------------
gi|239582714|ref|NP_005815.2|     ..................................................--------------
gi|125625324|ref|NP_001074960.1|  ..................................................--------------
gi|54792102|ref|NP_001005915.1|   ...............................................nef--------------
gi|39930571|ref|NP_932341.1|      ..................................................--------------
gi|16751843|ref|NP_003259.2|      ..................................................--------------
gi|12597641|ref|NP_075052.1|      ..................................................--------------
gi|4826651|ref|NP_004919.1|       ..................................................--------------
gi|15529980|ref|NP_219481.1|      ..................................................--------------
gi|40254924|ref|NP_060979.2|      ..................................................--------------
gi|14916498|ref|NP_148935.1|      ..................................................----CLLCVCLSGS
gi|7661704|ref|NP_054776.1|       ..................................................----CLLCVCLSGS
gi|16418445|ref|NP_443185.1|      ..................................................--------------
gi|13569879|ref|NP_112182.1|      ..................................................--------------
gi|5901898|ref|NP_008923.1|       ..................................................--------------
gi|306966160|ref|NP_001182474.1|  ..................................................--------------
gi|194239699|ref|NP_689928.3|     ..................................................--------------
gi|194239701|ref|NP_001123519.1|  ..................................................--------------
gi|13027616|ref|NP_076431.1|      ..................................................--------------
gi|218931217|ref|NP_001136400.1|  ..................................................--------------
gi|289547512|ref|NP_055649.4|     ..................................................-----------FTI
gi|28872863|ref|NP_056270.2|      ..................................................--------------
gi|116325993|ref|NP_001006608.2|  ..................................................-----------FTI
gi|61966709|ref|NP_001013648.1|   ..................................................-------CLKKITH
gi|305632814|ref|NP_001182209.1|  ..................................................--------------
gi|13562088|ref|NP_112153.1|      ..................................................--------------
gi|75677612|ref|NP_955372.2|      ..................................................-----------FTI
gi|53829385|ref|NP_443120.2|      ..................................................-------------T
gi|150378449|ref|NP_892014.1|     ..................................................--------------
gi|59889558|ref|NP_001012331.1|   ..................................................--------------
gi|4585712|ref|NP_002520.2|       ..................................................--------------
gi|19743850|ref|NP_598012.1|      ..................................................--VCPFRCQCHLRV
gi|148664213|ref|NP_001091989.1|  ..................................................--------------
gi|210147571|ref|NP_001129951.1|  ..................................................--------------
gi|115583679|ref|NP_653172.2|     ..................................................--------------
gi|157785649|ref|NP_001099129.1|  ..................................................--------------
gi|288541297|ref|NP_570843.2|     ..................................................--------------
gi|46397369|ref|NP_997002.1|      ..................................................--------------
gi|239735605|ref|NP_060766.5|     ..................................................--------------
gi|33469951|ref|NP_878256.1|      ..................................................--------------
gi|53828918|ref|NP_004572.3|      ..................................................--------------
gi|205360954|ref|NP_001009944.2|  ..................................................--------------
gi|205360962|ref|NP_000287.3|     ..................................................--------------
gi|38348406|ref|NP_940967.1|      ..................................................--------------
gi|4758460|ref|NP_004479.1|       ..................................................--------------
gi|219555702|ref|NP_001137230.1|  ..................................................--------------
gi|219555704|ref|NP_001137231.1|  ..................................................--------------
gi|219555700|ref|NP_001137229.1|  ..................................................--------------
gi|55741567|ref|NP_085129.1|      ..................................................--------------
gi|62899065|ref|NP_060610.2|      ..................................................--------------
gi|56118210|ref|NP_001007793.1|   ..................................................--------------
gi|6912604|ref|NP_036535.1|       ..................................................--------------
gi|55956794|ref|NP_001007157.1|   ..................................................--------------
gi|59889560|ref|NP_002521.2|      ..................................................--------------
gi|59889562|ref|NP_001012338.1|   ..................................................--------------
gi|4503743|ref|NP_002009.1|       ..................................................--------------
gi|55770895|ref|NP_001006600.1|   ..................................................--------------
gi|226342931|ref|NP_079101.3|     ..................................................--------------
gi|8923909|ref|NP_061165.1|       ..................................................--------------
gi|20143971|ref|NP_006059.2|      ..................................................--------------
gi|14042939|ref|NP_114413.1|      ..................................................--------------
gi|21071028|ref|NP_036536.2|      ..................................................--------------
gi|23097240|ref|NP_690852.1|      ..................................................--------------
gi|65301141|ref|NP_055835.2|      ..................................................--------------
gi|19743852|ref|NP_598013.1|      ..................................................---CPFRCQCHLRV
gi|223718151|ref|NP_001138779.1|  ..................................................--------------
gi|55956790|ref|NP_001007098.1|   ..................................................--------------
gi|65506779|ref|NP_001018076.1|   ..................................................--------------
gi|312283627|ref|NP_001186011.1|  ..................................................--------------
gi|65506769|ref|NP_001018075.1|   ..................................................--------------
gi|21361306|ref|NP_006171.2|      ..................................................--------------
gi|65506745|ref|NP_001018074.1|   ..................................................--------------
gi|291575163|ref|NP_001167575.1|  ..................................................--------------
gi|291575165|ref|NP_001167576.1|  ..................................................--------------
gi|4557417|ref|NP_000582.1|       ..................................................--------------
gi|91105159|ref|NP_001035110.1|   ..................................................--------------
gi|4504077|ref|NP_000165.1|       ..................................................--------------
gi|41327734|ref|NP_958440.1|      ..................................................--------------
gi|148664188|ref|NP_689972.3|     ..................................................--------------
gi|4504073|ref|NP_000398.1|       ..................................................--------------
gi|54607118|ref|NP_056356.2|      ..................................................-------CTCAGDS
gi|239582714|ref|NP_005815.2|     ..................................................-----------IQT
gi|7706093|ref|NP_057646.1|       ..................................................--------------
gi|210147569|ref|NP_001129950.1|  ..................................................--------------
gi|45593138|ref|NP_660299.2|      ..................................................--------------
gi|34577057|ref|NP_037412.2|      ..................................................---CPSVCRCDNGF
gi|19718734|ref|NP_003255.2|      ..................................................--------------
gi|38202222|ref|NP_938205.1|      ..................................................---CPSVCRCDAGF
gi|7019383|ref|NP_037413.1|       ..................................................---CPSVCRCDAGF
gi|8922644|ref|NP_060675.1|       ..................................................--------------


                                        20                30        40                              
                                         |                 |         |                              
d1xkua_                             VQCSDLGLEK...VPK.....DLPPDTALLDLQNN...KITE...IK.................
gi|16904383|ref|NP_065845.1|      ----------...LPTti...ASLVNLKELDISKN...GVQE...FPenikcckcltiieasvn
gi|110825984|ref|NP_004216.2|     LNLGNNGLEE...VPEglg..SALGSLRVLVLRRN...RFAR...LP.................
gi|76880480|ref|NP_055632.2|      LDLQYNQIRS...LHPktf..EKLSRLEELYLGNN...LLQA...LA.................
gi|288541297|ref|NP_570843.2|     LQLHGNHLEY...IPDgaf..DHLVGLTKLNLGKN...SLTH...IS.................
gi|256217721|ref|NP_001073982.2|  LTLNFNMLEA...LPEglf..QHLAALESLHLQGN...QLQA...LP.................
gi|209862903|ref|NP_001129523.1|  VKLNNNELET...IPNlg...PVSANITLLSLAGN...RIVE...IL.................
gi|42544231|ref|NP_006329.2|      LDLSQNSFSD...ARDcdf..HALPQLLSLHLEEN...QLTR...LE.................
gi|42544233|ref|NP_963924.1|      LDLSQNSFSD...ARDcdf..HALPQLLSLHLEEN...QLTR...LE.................
gi|288541295|ref|NP_001128529.2|  LQLHGNHLEY...IPDgaf..DHLVGLTKLNLGKN...SLTH...IS.................
gi|54607118|ref|NP_056356.2|      LDLSLNNITE...VRNtcf..PHGPPIKELNLAGN...RIGT...LE.................
gi|55770895|ref|NP_001006600.1|   LYLNDAFLEF...LPAnf...GRLTKLQILELREN...QLKM...L-.................
gi|13194201|ref|NP_075380.1|      TSCPQQGLQA...VPV.....GIPAASQRIFLHGN...RISH...VP.................
gi|8923909|ref|NP_061165.1|       LYLNDAFLEF...LPAnf...GRLTKLQILELREN...QLKM...L-.................
gi|19743846|ref|NP_598010.1|      VQCSDLGLDK...VPK.....DLPPDTTLLDLQNN...KITE...IK.................
gi|4503271|ref|NP_001911.1|       VQCSDLGLDK...VPK.....DLPPDTTLLDLQNN...KITE...IK.................
gi|7662320|ref|NP_055628.1|       LNLSNNRITT...LEAgcfd.NLSSSLLVVKLNRN...RMSM...I-.................
gi|238908508|ref|NP_001155000.1|  ---------K...ITDci...SHLNNICSLEFSGN...IITD...V-.................
gi|11321571|ref|NP_003053.1|      VDCHGLGLRA...VPR.....GIPRNAERLDLDRN...NITR...IT.................
gi|188528675|ref|NP_003052.2|     VDCHGTGLQA...IPK.....NIPRNTERLELNGN...NITR...IH.................
gi|4759146|ref|NP_004778.1|       VDCHGLALRS...VPR.....NIPRNTERLDLNGN...NITR...IT.................
gi|157694513|ref|NP_060960.2|     VDCSGKGLTA...VPE.....GLSAFTQALDISMN...NITQ...LP.................
gi|157426829|ref|NP_001094861.1|  VACTRRRLTA...VPD.....GIPAETRLLELSRN...RIRC...LN.................
gi|153791330|ref|NP_065924.3|     LDFSQNNFTN...IKEvgl..ANLTQLTTLHLEEN...QITE...MT.................
gi|41281398|ref|NP_031399.2|      LYLYSNKLQS...LPAev...GCLVNLMTLALSEN...SLTS...L-.................
gi|52138725|ref|NP_001004432.1|   VLCGHRQLEA...VPG.....GLPLDTELLDLSGN...RLWG...LQ.................
gi|62912474|ref|NP_001017404.1|   ----MNNLTE...LQPglf..HHLRFLEELRLSGN...HLSH...IP.................
gi|21361633|ref|NP_060238.3|      LIISNNKLQS...LTDdl...RLLPALTVLDIHDN...QLTS...L-.................
gi|30425563|ref|NP_848665.1|      VSCQANNFSS...VPL.....SLPPSTQRLFLQNN...LIRT...LR.................
gi|50263044|ref|NP_116197.4|      VLCHRKRFVA...VPE.....GIPTETRLLDLGKN...RIKT...LN.................
gi|156139147|ref|NP_079269.4|     VYCESHAFAD...IPE.....NISGGSQGLSLRFN...SIQK...LK.................
gi|4758460|ref|NP_004479.1|       LFLDHNALRG...IDQnmf..QKLVNLQELALNQN...QLDF...LP.................
gi|197927168|ref|NP_001128217.1|  VYCESHAFAD...IPE.....NISGGSQGLSLRFN...SIQK...LK.................
gi|122937309|ref|NP_001073926.1|  VICTRRDLAE...VPA.....SIPVNTRYLNLQEN...GIQV...IR.................
gi|22749183|ref|NP_689783.1|      VSCHRRRLIA...IPE.....GIPIETKILDLSKN...RLKS...VN.................
gi|7662102|ref|NP_056379.1|       FYCDSQGFHS...VPN.....ATDKGSLGLSLRHN...HITE...LE.................
gi|198041768|ref|NP_852607.3|     INCRNLGLSS...IPK.....NFPESTVFLYLTGN...NISY...INeseltglhslvalyldn
gi|15029530|ref|NP_071426.1|      VVCTRRGLSE...VPQ.....GIPSNTRYLNLMEN...NIQM...IQ.................
gi|194440719|ref|NP_612490.1|     VACRYQNLTE...VPD.....AIPELTQRLDLQGN...LLKV...IP.................
gi|4502403|ref|NP_001702.1|       VQCSDLGLKS...VPK.....EISPDTTLLDLQNN...DISE...LR.................
gi|62912470|ref|NP_001017403.1|   ADCSELGLSA...VPG.....DLDPLTAYLDLSMN...NLTE...LQ.................
gi|30425553|ref|NP_848663.1|      VSCQAHNFAA...IPE.....GIPVDSERVFLQNN...RIGL...LQ.................
gi|4504379|ref|NP_003658.1|       VDCSDLGLSE...LPS.....NLSVFTSYLDLSMN...NISQ...LL.................
gi|153251229|ref|NP_001258.2|     VICDKVGLQK...IPK.....-VSEKTKLLNLQRN...NFPV...LA.................
gi|51317373|ref|NP_065980.1|      VICVRKNLRE...VPD.....GISTNTRLLNLHEN...QIQI...IK.................
gi|4503743|ref|NP_002009.1|       LDLSHNQLTE...CPRel...ENAKNMLVLNLSHN...SIDT...IP.................
gi|301069322|ref|NP_060150.4|     VHCSDLGLTS...VPT.....NIPFDTRMLDLQNN...KIKE...IK.................
gi|188528675|ref|NP_003052.2|     VECSSLKLTK...IPE.....RIPQSTAELRLNNN...EISIl..EA.................
gi|153791507|ref|NP_001093130.1|  LDLSQNNLSS...VTNinv..KKMPQLLSVYLEEN...KLTE...LP.................
gi|153792227|ref|NP_060804.3|     LDLSQNNLSS...VTNinv..KKMPQLLSVYLEEN...KLTE...LP.................
gi|153792651|ref|NP_001093128.1|  LDLSQNNLSS...VTNinv..KKMPQLLSVYLEEN...KLTE...LP.................
gi|238908508|ref|NP_001155000.1|  LYLDKNQIKT...FQGads..GDLLGLEILSLQEN...GLSS...L-.................
gi|12007646|ref|NP_072089.1|      IDLDRNGLRF...LGEraf..GTLPSLRRLSLRHN...NLSF...IT.................
gi|4826772|ref|NP_004961.1|       VFCSSRNLTR...LPD.....GVPGGTQALWLDGN...NLSS...VP.................
gi|225579152|ref|NP_001139478.1|  VFCSSRNLTR...LPD.....GVPGGTQALWLDGN...NLSS...VP.................
gi|109809759|ref|NP_821079.3|     VYCESQKLQE...IPS.....SISAGCLGLSLRYN...SLQK...LK.................
gi|226342935|ref|NP_001139727.1|  VDCDGLDLRV...FPD.....NITRAAQHLSLQNN...QLQE...LP.................
gi|40255157|ref|NP_700356.2|      LYLNSNRVTS...MEPgyfd.NLANTLLVLKLNRN...RISA...I-.................
gi|4506013|ref|NP_002703.1|       VDLNHYRIGK...IEGf....EVLKKVKTLCLRQN...LIKC...I-.................
gi|86990456|ref|NP_849161.2|      LYCEALNLTE...APH.....-NLSGLLGLSLRYN...SLSE...LR.................
gi|194440719|ref|NP_612490.1|     SSCEGCGLQA...VPR.....GFPSDTQLLDLRRN...HFPS...VP.................
gi|45505137|ref|NP_714914.2|      VDCGGIDLRE...FPG.....DLPEHTNHLSLQNN...QLEK...IY.................
gi|187829871|ref|NP_001120716.1|  LWLYHTAAKIe..APAla...FLRENLRALHIKFT...DIKE...I-.................
gi|187829877|ref|NP_001120717.1|  LWLYHTAAKIe..APAla...FLRENLRALHIKFT...DIKE...I-.................
gi|62241040|ref|NP_062540.2|      LWLYHTAAKIe..APAla...FLRENLRALHIKFT...DIKE...I-.................
gi|225579152|ref|NP_001139478.1|  LDLSHNRVAGl..LEDtf...PGLLGLRVLRLSHN...AIAS...LR.................
gi|45827729|ref|NP_056171.2|      VDKRHCSLQA...VPEeiy..RYSRSLEELLLDAN...QLRE...L-.................
gi|45827731|ref|NP_874365.2|      VDKRHCSLQA...VPEeiy..RYSRSLEELLLDAN...QLRE...L-.................
gi|122937315|ref|NP_001073929.1|  IDLDENKIGA...IPEei...GHLTGLQKFYMASN...NLPV...L-.................
gi|197333706|ref|NP_001127951.1|  LHLCHCPAKV...EQTafs..FLRDHLRCLHVKFT...DVAE...I-.................
gi|34222199|ref|NP_060573.2|      LHLCHCPAKV...EQTafs..FLRDHLRCLHVKFT...DVAE...I-.................
gi|4826772|ref|NP_004961.1|       LDLSHNRVAGl..LEDtf...PGLLGLRVLRLSHN...AIAS...LR.................
gi|85986601|ref|NP_067647.2|      LDCDETNLRA...VPS.....-VSSNVTAMSLQWN...LIRK...LP.................
gi|7019381|ref|NP_037363.1|       VYLYGNQLDE...FPM.....NLPKNVRVLHLQEN...NIQT...IS.................
gi|119395738|ref|NP_001073285.1|  ----------...---.....--------------...----...--.................
gi|119395736|ref|NP_000199.2|     ----------...---.....--------------...----...--.................
gi|62912472|ref|NP_067649.2|      ----------...---.....---------DLSMN...NLTE...LQ.................
gi|88702793|ref|NP_612449.2|      VFCTARQGTT...VPR.....DVPPDTVGLYVFEN...GITM...LD.................
gi|4557665|ref|NP_000866.1|       ----------...---.....--------------...----...--.................
gi|41349454|ref|NP_958505.1|      LYCDSRNLRK...VPV.....-IPPRIHYLYLQNN...FITE...LP.................
gi|4506041|ref|NP_002716.1|       LYCDSRNLRK...VPV.....-IPPRIHYLYLQNN...FITE...LP.................
gi|38202222|ref|NP_938205.1|      IYLYHNSLDE...FPT.....NLPKYVKELHLQEN...NIRT...IT.................
gi|7019383|ref|NP_037413.1|       IYLYHNSLDE...FPT.....NLPKYVKELHLQEN...NIRT...IT.................
gi|312283621|ref|NP_001186009.1|  VDCGGIDLRE...FPG.....DLPEHTNHLSLQNN...QLEK...IY.................
gi|312283625|ref|NP_001186010.1|  VDCGGIDLRE...FPG.....DLPEHTNHLSLQNN...QLEK...IY.................
gi|71040111|ref|NP_002014.2|      MYCDNRNLKY...LPF.....-VPSRMKYVYFQNN...QITS...IQ.................
gi|312283627|ref|NP_001186011.1|  VDCGGIDLRE...FPG.....DLPEHTNHLSLQNN...KLEK...IP.................
gi|19923729|ref|NP_115646.2|      LSLHQCSVKI...HSAals..FLKENLKVLSVKFD...DMRE...L-.................
gi|95113664|ref|NP_060684.4|      IDKRHCSLVY...VPEeiy..RYARSLEELLLDAN...QLRE...L-.................
gi|16418467|ref|NP_443204.1|      ----------...---.....-------HLAVEFF...NLTH...LP.................
gi|11321571|ref|NP_003053.1|      VDCSNQKLVR...IPS.....HLPEYVTDLRLNDN...EVSVl..EA.................
gi|226342933|ref|NP_001139726.1|  VDCDGLDLRV...FPD.....NITRAAQHLSLQNN...QLQE...LP.................
gi|4826876|ref|NP_005005.1|       MYCDNRKLKT...IPN.....-IPMHIQQLYLQFN...EIEA...VT.................
gi|54792100|ref|NP_001973.2|      ----------...---.....--------------...----...--.................
gi|18677729|ref|NP_570718.1|      LECVNGDLKS...VPM.....-ISNNVTLLSLKKN...KIHS...LP.................
gi|27363458|ref|NP_076941.2|      TLCAHRGLLF...VPP.....NVDRRTVELRLADN...FIQA...LG.................
gi|34577057|ref|NP_037412.2|      IYLYENDLDE...FPI.....NLPRSLRELHLQDN...NVRT...IA.................
gi|8394456|ref|NP_059138.1|       LDLSRNNLVT...VQPemf..AQLSHLQCLRLSHN...CISQa..VN.................
gi|40217803|ref|NP_079337.2|      LSLRSNAGKV...PASvt...DVAGHLQRLSLHND...GARL...VA.................
gi|291190772|ref|NP_000164.5|     VNCDKRNLTA...LPP.....DLPKDTTILHLSEN...LLYT...FS.................
gi|171846278|ref|NP_940980.3|     LELHQNALTS...FPQqlc..ETLKSLTHLDLHSN...KFTS...F-.................
gi|260593673|ref|NP_001159530.1|  LECVNGDLKS...VPM.....-ISNNVTLLSLKKN...KIHS...LP.................
gi|45505137|ref|NP_714914.2|      VHLYNNALER...VPS.....GLPRRVRTLMILHN...QITG...IG.................
gi|308818206|ref|NP_001184225.1|  ISCINAMLTQ...IPP.....LTAPQITSLELTGN...SIAS...IP.................
gi|4505047|ref|NP_002336.1|       MYCDELKLKS...VPM.....-VPPGIKYLYLRNN...QIDH...ID.................
gi|312283621|ref|NP_001186009.1|  VHLYNNALER...VPS.....GLPRRVRTLMILHN...QITG...IG.................
gi|312283625|ref|NP_001186010.1|  VHLYNNALER...VPS.....GLPRRVRTLMILHN...QITG...IG.................
gi|41327732|ref|NP_958439.1|      ----------...---.....--------------...----...--.................
gi|41327736|ref|NP_958441.1|      ----------...---.....--------------...----...--.................
gi|7706093|ref|NP_057646.1|       LDLSKNSIFF...VKSsdf..QHLSFLKCLNLSGN...LISQt..LN.................
gi|29725609|ref|NP_005219.2|      ----------...---.....--------------...----...--.................
gi|31542244|ref|NP_689660.2|      --CAKKGLLF...VPP.....NIDRRTVELRLADN...FVTN...IK.................
gi|110825958|ref|NP_001036064.1|  ----------...---.....--------------...----...--.................
gi|4885215|ref|NP_005226.1|       ----------...---.....--------------...----...--.................
gi|46094076|ref|NP_056331.2|      VDCSGLGPHI...MPV.....PIPLDTAHLDLSSN...RLEM...VN.................
gi|5901992|ref|NP_008966.1|       LYCENRGLKE...IPA.....-IPSRIWYLYLQNN...LIET...IP.................
gi|54792100|ref|NP_001973.2|      ----------...---.....--------------...----...--.................
gi|4759146|ref|NP_004778.1|       VDCSNQKLNK...IPE.....HIPQYTAELRLNNN...EFTVl..EA.................
gi|4507531|ref|NP_003256.1|       LNMEDNDIPG...IKSnmf..TGLINLKYLSLSNSft.SLRT...LT.................
gi|38490688|ref|NP_849144.2|      VHCTFRYLTS...IPD.....SIPPNVERINLGYN...SLVR...LM.................
gi|65301141|ref|NP_055835.2|      LNLSHNKLGL...FPIll...CEISTLTELNLSCN...GFHD...L-.................
gi|193083139|ref|NP_001122394.1|  VSCQVLGLLQ...VPS.....VLPPDTETLDLSGN...QLRS...IL.................
gi|5031707|ref|NP_005503.1|       VSCQVLGLLQ...VPS.....VLPPDTETLDLSGN...QLRS...IL.................
gi|4885215|ref|NP_005226.1|       ----------...---.....--------------...----...--.................
gi|110825958|ref|NP_001036064.1|  ----------...---.....--------------...----...--.................
gi|291219891|ref|NP_919431.2|     LDLRDNKLGD...LDA.....MIFNNIEVLHCERN...QLVT...LDicgyflkalyassnelv
gi|20302168|ref|NP_619542.1|      LDLSLNSIFF...IGPnqf..ENLPDIACLNLSANs..NAQV...LS.................
gi|4507531|ref|NP_003256.1|       ADCSHLKLTQ...VPD.....DLPTNITVLNLTHN...QLRR...LP.................
gi|13375646|ref|NP_078785.1|      VLCPGAGLLF...VPP.....SLDRRAAELRLADN...FIAS...VR.................
gi|167555127|ref|NP_005573.2|     LDLTATHLKG...LPSgm...KGLNLLKKLVLSVN...HFDQ...LC.................
gi|31657140|ref|NP_055030.1|      ----------...---.....--------------...----...--.................
gi|41327734|ref|NP_958440.1|      ----------...---.....--------------...----...--.................
gi|229089140|ref|NP_001019849.2|  VECGALRLRV...VPL.....GIPPGTQTLFLQDN...NIAR...LE.................
gi|119395738|ref|NP_001073285.1|  ----------...---.....--------------...----...--.................
gi|119395736|ref|NP_000199.2|     ----------...---.....--------------...----...--.................
gi|31657138|ref|NP_000136.2|      FLCQESKVTE...IPS.....DLPRNAIELRFVLT...KLRV...IQ.................
gi|41327732|ref|NP_958439.1|      ----------...---.....--------------...----...--.................
gi|41327736|ref|NP_958441.1|      ----------...---.....--------------...----...--.................
gi|29725609|ref|NP_005219.2|      ----------...---.....--------------...----...--.................
gi|188536110|ref|NP_689824.2|     LTLANRNLER...LPG.....CLPRTLRSLDASHN...LLRA...LS.................
gi|109150416|ref|NP_036425.1|     ----------...---.....------SILDLRFN...RIRE...IQ.................
gi|6912638|ref|NP_036557.1|       --------S-...---.....--------------...---Nm..LD.................
gi|55741571|ref|NP_065788.1|      TLCPSKGLLF...VPP.....DIDRRTVELRLGGN...FIIH...IS.................
gi|193083139|ref|NP_001122394.1|  ----------...---.....--LSQLLNLDLSYN...EIEL...IP.................
gi|5031707|ref|NP_005503.1|       ----------...---.....--LSQLLNLDLSYN...EIEL...IP.................
gi|41281398|ref|NP_031399.2|      ----------...---.....--------------...----...--.................
gi|54792096|ref|NP_004439.2|      ----------...---.....--------------...----...--.................
gi|4557665|ref|NP_000866.1|       ----------...---.....--------------...----...--.................
gi|54792098|ref|NP_001005862.1|   ----------...---.....--------------...----...--.................
gi|54792096|ref|NP_004439.2|      ----------...---.....--------------...----...--.................
gi|54792098|ref|NP_001005862.1|   ----------...---.....--------------...----...--.................
gi|62912472|ref|NP_067649.2|      -----NKLQE...FPVai...RTLGRLQELGFHNN...NIKA...IP.................
gi|149773484|ref|NP_065913.1|     MLCAKTGLLF...VPP.....AIDRRVVELRLTDN...FIAA...VR.................
gi|16751843|ref|NP_003259.2|      LDLSHGFVFS...LNSrvf..ETLKDLKVLNLAYN...KINK...IA.................
gi|139948432|ref|NP_056234.2|     VHCTFRSLAS...VPA.....GIAKHVERINLGFN...SIQA...LS.................
gi|90991702|ref|NP_078928.3|      LDLSANCLAT...LPSvip..WGLINLRKLNLSDN...HLGElpgVQ.................
gi|153792305|ref|NP_001093148.1|  ----------...---.....--------------...----...--.................
gi|190014581|ref|NP_078788.2|     ----------...LPKdr...GKRSSAFVFELSGE...HWTE...L-.................
gi|120953300|ref|NP_001073379.1|  VTFQDLPGCV...LSTl....AECTNLQFLSLRRC...GLTS...L-.................
gi|306140491|ref|NP_001182035.1|  -NCSNMSLRK...VPA.....DLTPATTTLDLSYN...LLFQ...LQ.................
gi|306140493|ref|NP_001182036.1|  -NCSNMSLRK...VPA.....DLTPATTTLDLSYN...LLFQ...LQ.................
gi|62865618|ref|NP_112218.2|      -NCSNMSLRK...VPA.....DLTPATTTLDLSYN...LLFQ...LQ.................
gi|62865621|ref|NP_001017388.1|   -NCSNMSLRK...VPA.....DLTPATTTLDLSYN...LLFQ...LQ.................
gi|262205665|ref|NP_001159864.1|  VKCVNRNLTE...VPT.....DLPAYVRNLFLTGN...QLAV...LP.................
gi|5729718|ref|NP_006661.1|       VKCVNRNLTE...VPT.....DLPAYVRNLFLTGN...QLAV...LP.................
gi|126517478|ref|NP_653252.3|     --CMHLMLDH...IPQ.....-VPQQTTVLDLRFN...RIRE...IP.................
gi|306140495|ref|NP_001182037.1|  -NCSNMSLRK...VPA.....DLTPATTTLDLSYN...LLFQ...LQ.................
gi|72534676|ref|NP_001026862.1|   LDCQERKLVY...VLP.....GWPQDLLHMLLARN...KIRT...LK.................
gi|41350337|ref|NP_003254.2|      ---SKNGLIH...VPK.....DLSQKTTILNISQN...YISE...LW.................
gi|52426787|ref|NP_002535.3|      VDCSGRNLST...LPS.....GLQENIIHLNLSYN...HFTD...L-.................
gi|193788651|ref|NP_001123362.1|  ----------...---.....---KNTKIITLNGK...KMTK...M-.................
gi|194306618|ref|NP_001123608.1|  ----------...---.....--------------...----...--.................
gi|194306621|ref|NP_001123609.1|  ----------...---.....--------------...----...--.................
gi|194306623|ref|NP_001123610.1|  ----------...---.....--------------...----...--.................
gi|39930401|ref|NP_065902.1|      ----------...---.....--------------...----...--.................
gi|157743290|ref|NP_001099051.1|  ----------...---.....--------------...---D...I-.................
gi|299782601|ref|NP_001010847.1|  VDCRDRGLPS...VPD.....PFPLDVRKLLVAGN...RIQR...IP.................
gi|341915001|ref|XP_003403925.1|  ----------...VPA.....LTHPGLTTLYLAEN...EIAK...IP.................
gi|255652962|ref|NP_001157397.1|  VDCSGLGLTT...VPP.....DVPAATRTLLLLNN...KLSA...LP.................
gi|255652964|ref|NP_001157398.1|  VDCSGLGLTT...VPP.....DVPAATRTLLLLNN...KLSA...LP.................
gi|84781739|ref|NP_001034118.1|   VDCSGLGLTT...VPP.....DVPAATRTLLLLNN...KLSA...LP.................
gi|30181233|ref|NP_002310.2|      LNLSNRRLKH...FPRgaarsYDLSDITQADLSRN...RFPE...V-.................
gi|194394161|ref|NP_694992.2|     ---KDRGLTE...FPAdlq..KLTSNLRTIDLSNN...KIES...LP.................
gi|14249428|ref|NP_116162.1|      LSLSGRKLRE...FPRgaan.HDLTDTTRADLSRN...RLSE...I-.................
gi|256017174|ref|NP_001157683.1|  LNLSARKLKE...FPRtaapgHDLSDTVQADLSKN...RLVE...V-.................
gi|41582239|ref|NP_958934.1|      --CAYRDLES...VPP.....GFPANVTTLSLSAN...RLPG...LP.................
gi|5031809|ref|NP_005536.1|       --CAYRDLES...VPP.....GFPANVTTLSLSAN...RLPG...LP.................
gi|63003903|ref|NP_963844.2|      ----------...---.....--------------...----...--.................
gi|223005922|ref|NP_001138549.1|  ----------...---.....--------------...----...--.................
gi|154091020|ref|NP_065922.3|     LSLSGRKLRD...FPGsg...YDLTDTTQADLSRN...RFTE...I-.................
gi|33859670|ref|NP_055931.1|      LNLSARKLKE...FPRtaapgHDLSDTVQADLSKN...RLVE...V-.................
gi|8394456|ref|NP_059138.1|       VNCNWLFLKS...VPHfsma.APRGNVTSLSLSSN...RIHH...LH.................
gi|256017180|ref|NP_001157685.1|  LNLSARKLKE...FPRtaapgHDLSDTVQADLSKN...RLVE...V-.................
gi|27436867|ref|NP_775101.1|      ---------S...MSEli...PKPLNA--------...----...--.................
gi|296080773|ref|NP_001171678.1|  ---------S...MSEli...PKPLNA--------...----...--.................
gi|296080775|ref|NP_001171679.1|  ---------S...MSEli...PKPLNA--------...----...--.................
gi|34577083|ref|NP_689937.2|      ----------...---.....--------------...----...--.................
gi|167555127|ref|NP_005573.2|     YNCENLGLSE...IPD.....TLPNTTEFLEFSFN...FLPT...IH.................
gi|33285015|ref|NP_653199.2|      LFLNYRNLHH...FPLellkdEGLQYLERLYMKRN...SLTS...LP.................
gi|291575177|ref|NP_852111.2|     FLCQESKVTE...IPS.....DLPRNAIELRFVLT...KLRV...IQ.................
gi|24308207|ref|NP_065761.1|      ----------...--Prl...FTLPLLHYLEVSGCg..SLRA...PG.................
gi|31657140|ref|NP_055030.1|      ----------...---.....--------------...----...--.................
gi|52353306|ref|NP_001005210.1|   VDCSSQRLFS...VPP.....DLPMDTRNLSLAHN...RITA...VP.................
gi|10190722|ref|NP_065729.1|      VDCSQQGLAE...IPS.....HLPPQTRTLHLQDN...QIHH...LP.................
gi|59823631|ref|NP_660333.2|      ----------...---.....--------------...----...--.................
gi|40217820|ref|NP_055741.2|      ----------...---.....--------------...----...--.................
gi|95113664|ref|NP_060684.4|      ----------...---.....--------------...----...--.................
gi|219521831|ref|NP_001137140.1|  VSCTNKNLSK...VPG.....NLFRLIKRLDLSYN...RIGL...LD.................
gi|32469517|ref|NP_862830.1|      VSCTNKNLSK...VPG.....NLFRLIKRLDLSYN...RIGL...LD.................
gi|21313638|ref|NP_060646.2|      ----------...---.....--------------...----...--.................
gi|21389483|ref|NP_653249.1|      ----------...---.....--------LTLSGC...NLID...V-.................
gi|61742784|ref|NP_665893.2|      ----------...---.....QSLSCLRSLVLKGG...QRRD...TL.................
gi|61742786|ref|NP_665894.2|      ----------...---.....QSLSCLRSLVLKGG...QRRD...TL.................
gi|7706093|ref|NP_057646.1|       VDCTDKHLTE...IPG.....GIPTNTTNLTLTIN...HIPD...IS.................
gi|61966761|ref|NP_001013675.1|   --CSALSLPA...VPP.....GLSLRLRALLLDHN...RVRA...LP.................
gi|153791466|ref|NP_065754.2|     LSCSKQQLPN...VPH.....SLPSYTALLDLSHN...NLSR...LR.................
gi|40217823|ref|NP_056382.1|      VNCQERKIES...IAElq...PKPYNPKKMYLTEN...YIAV...VR.................
gi|157694513|ref|NP_060960.2|     ----------...---.....--------------...----...--.................
gi|221136957|ref|NP_001137475.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136961|ref|NP_001137476.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136965|ref|NP_001137477.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136969|ref|NP_001137478.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136977|ref|NP_001137480.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136981|ref|NP_001137481.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136985|ref|NP_001137482.1|  INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|33504581|ref|NP_115928.1|      INCENKGFTT...VSLlq...PPQYRIYQLFLNGN...LLTR...LY.................
gi|221136957|ref|NP_001137475.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|221136961|ref|NP_001137476.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|221136965|ref|NP_001137477.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|221136969|ref|NP_001137478.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|221136977|ref|NP_001137480.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|221136981|ref|NP_001137481.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|221136985|ref|NP_001137482.1|  VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|33504581|ref|NP_115928.1|      VNCQERKFTN...ISDlq...PKPTSPKKLYLTGN...YLQT...VY.................
gi|194018474|ref|NP_001005214.2|  VICTGKQLTE...YPL.....DIPLNTRRLFLNEN...RITS...LP.................
gi|40217817|ref|NP_443142.1|      ------NVSS...LADlk...PKLSNVQELFLRDN...KIHS...IR.................
gi|40217825|ref|NP_115605.2|      IHCQERNIES...LSDlr...PPPQNPRKLILAGN...IIHS...LM.................
gi|291219891|ref|NP_919431.2|     VDLSCCSLEH...LPAnl...FYSQDLTHLNLKQN...FLRQ...NPs................
gi|4826816|ref|NP_005088.1|       ----------...---.....--------------...----...--.................
gi|38454322|ref|NP_942015.1|      LSCTGLGLQD...VPA.....ELPAATADLDLSHN...ALQR...LR.................
gi|40217817|ref|NP_443142.1|      ----------...---.....--------------...----...--.................
gi|164607156|ref|NP_113615.2|     ----------...---.....--------------...----...--.................
gi|191252816|ref|NP_001122108.1|  ----------...---.....--------------...----...--.................
gi|40217823|ref|NP_056382.1|      ----------...---.....--------------...----...--.................
gi|27436867|ref|NP_775101.1|      VNCEKVSVYR...PNQlk...PPWSNFYHLNFQNN...FLNI...LY.................
gi|296080773|ref|NP_001171678.1|  VNCEKVSVYR...PNQlk...PPWSNFYHLNFQNN...FLNI...LY.................
gi|296080775|ref|NP_001171679.1|  VNCEKVSVYR...PNQlk...PPWSNFYHLNFQNN...FLNI...LY.................
gi|40217825|ref|NP_115605.2|      ----------...---.....--------------...----...--.................
gi|21281681|ref|NP_644807.1|      ----------...---.....--------------...----...--.................
gi|300934750|ref|NP_116166.9|     ----------...---.....--------------...----...--.................
gi|21281673|ref|NP_644813.1|      ----------...---.....--------------...----...--.................
gi|66912176|ref|NP_001019782.1|   YILTNCSFTGkcdIPV.....DISQTAATVDVSFN...FFRV...LL.................
gi|301069324|ref|NP_001180264.1|  VHCSDLGLTS...VPT.....NIPFDTRMLDLQNN...KIKE...IK.................
gi|116268101|ref|NP_443138.2|     ----------...---.....--------------...----...--.................
gi|318984125|ref|NP_001188295.1|  ----------...---.....--------------...----...--.................
gi|40217820|ref|NP_055741.2|      IHCDSKGFTN...ISQit...EFWSRPFKLYLQRN...SMRK...LY.................
gi|312222719|ref|NP_001185947.1|  LSLERQKLTV...CPIi....NGEDHLRLLNFQHN...FITR...I-.................
gi|106067657|ref|NP_000224.2|     ----------...---.....-----LTRLSLAYL...PVKV...IP.................
gi|206725447|ref|NP_001128689.1|  ----------...---.....--------------...-LTD...I-.................
gi|42542396|ref|NP_964013.1|      ----------...---.....--------------...-LTD...I-.................
gi|15487670|ref|NP_006353.2|      ----------...---.....--------------...----...--.................
gi|20143971|ref|NP_006059.2|      ----------...---.....--------------...----...--.................
gi|55743114|ref|NP_060161.2|      LSLERQKLTV...CPIi....NGEDHLRLLNFQHN...FITR...I-.................
gi|312222716|ref|NP_001185946.1|  LSLERQKLTV...CPIi....NGEDHLRLLNFQHN...FITR...I-.................
gi|193083136|ref|NP_940908.2|     ----------...---.....-------K------...----...--.................
gi|254039592|ref|NP_116564.2|     ----------...---.....--------------...----...--.................
gi|87298937|ref|NP_008949.4|      ----------...---.....--------------...----...--.................
gi|13430854|ref|NP_071336.1|      ----------...---.....--------------...----...--.................
gi|14277694|ref|NP_060279.2|      ----------...---.....--------------...----...--.................
gi|153791282|ref|NP_001093156.1|  ----------...---.....--------------...----...--.................
gi|194272226|ref|NP_001123563.1|  ----------...---.....--------------...--LR...I-.................
gi|194272228|ref|NP_001123564.1|  ----------...---.....--------------...--LR...I-.................
gi|194272222|ref|NP_001123562.1|  ----------...---.....--------------...--LR...I-.................
gi|194272224|ref|NP_112584.3|     ----------...---.....--------------...--LR...I-.................
gi|62988340|ref|NP_001017924.1|   ----------...---.....--------------...----...--.................
gi|68800360|ref|NP_004941.2|      VYCDDHELDA...IPP.....-LPKNTAYFYSRFN...RIKK...IN.................
gi|167466264|ref|NP_001006940.3|  ----------...---.....--------------...----...--.................
gi|31377705|ref|NP_078824.2|      ----------...---.....-----IHTLILDKN...QIIK...L-.................
gi|21361633|ref|NP_060238.3|      ----------...---.....--------------...----...--.................
gi|122937315|ref|NP_001073929.1|  ----------...---.....--------------...----...--.................
gi|299758423|ref|NP_001177652.1|  ----------...---.....--------------...----...--.................
gi|53729359|ref|NP_612370.3|      ----------...---.....--------------...----...--.................
gi|53729361|ref|NP_001005373.1|   ----------...---.....--------------...----...--.................
gi|53729363|ref|NP_001005374.1|   ----------...---.....--------------...----...--.................
gi|14149694|ref|NP_056428.1|      ----------...---.....--------------...----...--.................
gi|45439342|ref|NP_689542.2|      ----------...-PLsk...NFPYSLEHLQTSYC...GLVR...V-.................
gi|217330610|ref|NP_001136098.1|  ----------...--Rip...SLPPSTQTLKLIET...HLRT...IP.................
gi|288541295|ref|NP_001128529.2|  VECTGARIVA...VPT.....PLPWNAMSLQILNT...HITE...LN.................
gi|117414162|ref|NP_208325.3|     ----------...---.....--------------...----...--.................
gi|19743848|ref|NP_598011.1|      VQCSD-----...---.....--------------...----...--.................
gi|64085121|ref|NP_000360.2|      ----------...--Rip...SLPPSTQTLKLIET...HLRT...IP.................
gi|31621309|ref|NP_036604.2|      ----------...---.....--------------...----...--.................
gi|64085161|ref|NP_001018046.1|   ----------...--Rip...SLPPSTQTLKLIET...HLRT...IP.................
gi|50593002|ref|NP_003081.2|      ----------...---.....--------------...----...--.................
gi|5454088|ref|NP_006392.1|       ----------...---.....--------------...----...--.................
gi|7657419|ref|NP_055174.1|       VYCDDIDLED...IPP.....-LPRRTAYLYARFN...RISR...IR.................
gi|5453880|ref|NP_006296.1|       ----------...---.....--------------...----...--.................
gi|45827729|ref|NP_056171.2|      ----------...---.....--------------...----...--.................
gi|45827731|ref|NP_874365.2|      ----------...---.....--------------...----...--.................
gi|306922420|ref|NP_001182457.1|  RCASGAELRQ...PPR.....DVPPDARNLTIVGA...NLTV...LR.................
gi|226342933|ref|NP_001139726.1|  ----------...---.....--PRTLAILHLGRN...RIRQ...VE.................
gi|239582714|ref|NP_005815.2|     ----------...-LP.....GWPQ----------...----...--.................
gi|125625324|ref|NP_001074960.1|  ----------...---.....--------------...----...--.................
gi|54792102|ref|NP_001005915.1|   ----------...---.....--------------...----...--.................
gi|39930571|ref|NP_932341.1|      ----------...---.....--------------...----...--.................
gi|16751843|ref|NP_003259.2|      ---RFCNLTQ...VPQ.....-VLNTTERLLLSFN...YIRT...VT.................
gi|12597641|ref|NP_075052.1|      ----------...---.....--------------...----...--.................
gi|4826651|ref|NP_004919.1|       ----------...---.....--------------...----...--.................
gi|15529980|ref|NP_219481.1|      ----------...---.....--------------...----...--.................
gi|40254924|ref|NP_060979.2|      ----------...---.....--------LDLSLS...DLNE...VP.................
gi|14916498|ref|NP_148935.1|      VYCEEVDIDA...VPP.....-LPKESAYLYARFN...KIKK...LT.................
gi|7661704|ref|NP_054776.1|       VYCEEVDIDA...VPP.....-LPKESAYLYARFN...KIKK...LT.................
gi|16418445|ref|NP_443185.1|      VTCSNANLKE...IPR.....DLPPETVLLYLDSN...QITS...IP.................
gi|13569879|ref|NP_112182.1|      ----------...---.....--------------...----...--.................
gi|5901898|ref|NP_008923.1|       ----------...---.....--------------...-LTD...I-.................
gi|306966160|ref|NP_001182474.1|  -RCSQAGLSA...VPS.....GIPNDTRKLYLDAN...QLAS...VP.................
gi|194239699|ref|NP_689928.3|     --LNSCGITC...AGDekeiaAFCAHVSELDLSDN...KLED...W-.................
gi|194239701|ref|NP_001123519.1|  --LNSCGITC...AGDekeiaAFCAHVSELDLSDN...KLED...W-.................
gi|13027616|ref|NP_076431.1|      ----------...---.....--------------...----...--.................
gi|218931217|ref|NP_001136400.1|  ----------...---.....--------------...----...--.................
gi|289547512|ref|NP_055649.4|     LNFQGNYISY...IDGnvw..KAYSWTEKLILREN...NLTE...LH.................
gi|28872863|ref|NP_056270.2|      ----------...---.....--------------...----...--.................
gi|116325993|ref|NP_001006608.2|  LNFQGNYISY...IDGnvw..KAYSWTEKLILREN...NLTE...LH.................
gi|61966709|ref|NP_001013648.1|   INFSDKNIDA...IEDl....SLCKNLSVLYLYDN...CISQ...I-.................
gi|305632814|ref|NP_001182209.1|  ----------...---.....--------------...----...--.................
gi|13562088|ref|NP_112153.1|      -FCSLRGLQE...VPE.....DIPANTVLLKLDAN...KISH...LP.................
gi|75677612|ref|NP_955372.2|      LNFQGNYISY...IDGnvw..KAYSWTEKLILREN...NLTE...LH.................
gi|53829385|ref|NP_443120.2|      LNFQGNYISY...LDGnvw..KAYSWTEKLILSEN...YLTE...LP.................
gi|150378449|ref|NP_892014.1|     ----------...---.....--------------...----...--.................
gi|59889558|ref|NP_001012331.1|   ----------...---.....--------------...----...--.................
gi|4585712|ref|NP_002520.2|       ----------...---.....--------------...----...--.................
gi|19743850|ref|NP_598012.1|      VQCSDLG---...---.....-LPPSLTELHLDGN...KISR...VD.................
gi|148664213|ref|NP_001091989.1|  ----------...---.....--------------...----...--.................
gi|210147571|ref|NP_001129951.1|  ----------...---.....--------------...----...--.................
gi|115583679|ref|NP_653172.2|     ----------...---.....--------------...----...--.................
gi|157785649|ref|NP_001099129.1|  ----------...---.....-------------N...GLHL...KS.................
gi|288541297|ref|NP_570843.2|     ----------...---.....-----AMSLQILNT...HITE...LN.................
gi|46397369|ref|NP_997002.1|      ----------...---.....--------------...----...--.................
gi|239735605|ref|NP_060766.5|     ----------...---.....EQPELVESLSLQGSyagKIHS...I-.................
gi|33469951|ref|NP_878256.1|      ----------...---.....--------------...----...--.................
gi|53828918|ref|NP_004572.3|      ----------...---.....--------------...----...--.................
gi|205360954|ref|NP_001009944.2|  ----------...---.....--------------...----...--.................
gi|205360962|ref|NP_000287.3|     ----------...---.....--------------...----...--.................
gi|38348406|ref|NP_940967.1|      ----------...---.....--------------...----...--.................
gi|4758460|ref|NP_004479.1|       ----------...---.....-LPTNLTHILLFGM...GRGV...LQ.................
gi|219555702|ref|NP_001137230.1|  LDLSESGLCR...LEEv....FRIPSLQQLHLQRN...ALCV...IP.................
gi|219555704|ref|NP_001137231.1|  LDLSESGLCR...LEEv....FRIPSLQQLHLQRN...ALCV...IP.................
gi|219555700|ref|NP_001137229.1|  LDLSESGLCR...LEEv....FRIPSLQQLHLQRN...ALCV...IP.................
gi|55741567|ref|NP_085129.1|      LDLSESGLCR...LEEv....FRIPSLQQLHLQRN...ALCV...IP.................
gi|62899065|ref|NP_060610.2|      ----------...---.....--------------...----...--.................
gi|56118210|ref|NP_001007793.1|   ----------...---.....--------------...----...--.................
gi|6912604|ref|NP_036535.1|       ----------...---.....--------------...----...--.................
gi|55956794|ref|NP_001007157.1|   ----------...---.....--------------...----...--.................
gi|59889560|ref|NP_002521.2|      ----------...---.....--------------...----...--.................
gi|59889562|ref|NP_001012338.1|   ----------...---.....--------------...----...--.................
gi|4503743|ref|NP_002009.1|       ----------...---.....-------GVDLSGN...DFKGg..YF.................
gi|55770895|ref|NP_001006600.1|   ----------...---.....------TTLDYSHC...SLEQ...VP.................
gi|226342931|ref|NP_079101.3|     ----------...VPP.....ALPRRLRALVLPHN...HVAA...LG.................
gi|8923909|ref|NP_061165.1|       ----------...---.....------TTLDY---...----...--.................
gi|20143971|ref|NP_006059.2|      VDKSKRGLIH...VPK.....DLPLKTKVLDMSQN...YIAE...LQ.................
gi|14042939|ref|NP_114413.1|      ----------...---.....--------------...----...--.................
gi|21071028|ref|NP_036536.2|      ----------...---.....--------------...----...--.................
gi|23097240|ref|NP_690852.1|      ----------...---.....--------------...----...--.................
gi|65301141|ref|NP_055835.2|      ----------...---.....----------MAGN...CLEV...LN.................
gi|19743852|ref|NP_598013.1|      VQCSDLGLDK...VPK.....DLPPDTTLLDLQNN...KITE...IK.................
gi|223718151|ref|NP_001138779.1|  ----------...---.....--------------...----...--.................
gi|55956790|ref|NP_001007098.1|   ----------...---.....--------------...----...--.................
gi|65506779|ref|NP_001018076.1|   ----------...---.....--------------...----...--.................
gi|312283627|ref|NP_001186011.1|  ----------...---.....--------------...----...--.................
gi|65506769|ref|NP_001018075.1|   ----------...---.....--------------...----...--.................
gi|21361306|ref|NP_006171.2|      ----------...---.....--------------...----...--.................
gi|65506745|ref|NP_001018074.1|   ----------...---.....--------------...----...--.................
gi|291575163|ref|NP_001167575.1|  ----------...---.....--------------...----...--.................
gi|291575165|ref|NP_001167576.1|  ----------...---.....--------------...----...--.................
gi|4557417|ref|NP_000582.1|       ----------...---.....--------------...----...--.................
gi|91105159|ref|NP_001035110.1|   ----------...---.....--------------...----...--.................
gi|4504077|ref|NP_000165.1|       ----------...---.....--------------...----...--.................
gi|41327734|ref|NP_958440.1|      ----------...---.....--------------...----...--.................
gi|148664188|ref|NP_689972.3|     ----------...---.....--------------...----...--.................
gi|4504073|ref|NP_000398.1|       ----------...---.....--------------...----...--.................
gi|54607118|ref|NP_056356.2|      LDCGGRGLAA...LPG.....DLPSWTRSLNLSYN...KLSE...ID.................
gi|239582714|ref|NP_005815.2|     LDCKRKELKK...VPN.....NIPPDIVKLDLSYN...KINQ...LR.................
gi|7706093|ref|NP_057646.1|       ----------...---.....--------------...----...--.................
gi|210147569|ref|NP_001129950.1|  ----------...---.....--------------...----...--.................
gi|45593138|ref|NP_660299.2|      ----------...--Nqs...LRA-----------...----...--.................
gi|34577057|ref|NP_037412.2|      IYCNDRGLTS...IPA.....DIPDDATTLYLQNN...QINNa..GI.................
gi|19718734|ref|NP_003255.2|      ----------...---.....--------------...----...--.................
gi|38202222|ref|NP_938205.1|      IYCNDRFLTS...IPT.....GIPEDATTLYLQNN...QINNa..GI.................
gi|7019383|ref|NP_037413.1|       IYCNDRFLTS...IPT.....GIPEDATTLYLQNN...QINNa..GI.................
gi|8922644|ref|NP_060675.1|       ----------...---.....--------------...----...--.................


                                                                 50                         60      
                                                                  |                          |      
d1xkua_                             ............................DGDFK...N............L..KNLHTLILINN.
gi|16904383|ref|NP_065845.1|      pisklpdgftqllnltqlylndafleflPANFG...R............L..VKLRILELREN.
gi|110825984|ref|NP_004216.2|     ............................PAVAE...L............G..HHLTELDVSHN.
gi|76880480|ref|NP_055632.2|      ............................PGTLA...P............L..RKLRILYANGN.
gi|288541297|ref|NP_570843.2|     ............................PRVFQ...H............L..GNLQVLRLYEN.
gi|256217721|ref|NP_001073982.2|  ............................RRLFQ...P............L..THLKTLNLAQN.
gi|209862903|ref|NP_001129523.1|  ............................PEHLK...E............F..QSLETLDLSSN.
gi|42544231|ref|NP_006329.2|      ............................DHSFA...G............L..ASLQELYLNHN.
gi|42544233|ref|NP_963924.1|      ............................DHSFA...G............L..ASLQELYLNHN.
gi|288541295|ref|NP_001128529.2|  ............................PRVFQ...H............L..GNLQVLRLYEN.
gi|54607118|ref|NP_056356.2|      ............................LGAFD...G............Ls.RSLLTLRLSKN.
gi|55770895|ref|NP_001006600.1|   ............................PKTMN...R............L..TQLERLDLGSN.
gi|13194201|ref|NP_075380.1|      ............................AASFR...A............C..RNLTILWLHSN.
gi|8923909|ref|NP_061165.1|       ............................PKTMN...R............L..TQLERLDLGSN.
gi|19743846|ref|NP_598010.1|      ............................DGDFK...N............L..KNLHALILVNN.
gi|4503271|ref|NP_001911.1|       ............................DGDFK...N............L..KNLHALILVNN.
gi|7662320|ref|NP_055628.1|       ............................PPKIF...K............L..PHLQFLELKRN.
gi|238908508|ref|NP_001155000.1|  ............................PIEIK...N............C..QKIIKIELSYN.
gi|11321571|ref|NP_003053.1|      ............................KMDFA...G............L..KNLRVLHLEDN.
gi|188528675|ref|NP_003052.2|     ............................KNDFA...G............L..KQLRVLQLMEN.
gi|4759146|ref|NP_004778.1|       ............................KTDFA...G............L..RHLRVLQLMEN.
gi|157694513|ref|NP_060960.2|     ............................EDAFK...N............F..PFLEELQLAGN.
gi|157426829|ref|NP_001094861.1|  ............................PGDLA...A............L..PALEELDLSEN.
gi|153791330|ref|NP_065924.3|     ............................DYCLQ...D............L..SNLQELYINHN.
gi|41281398|ref|NP_031399.2|      ............................PDSLD...N............L..KKLRMLDLRHN.
gi|52138725|ref|NP_001004432.1|   ............................QGMLS...R............L..SLLQELDLSYN.
gi|62912474|ref|NP_001017404.1|   ............................GQAFS...G............L..YSLKILMLQNN.
gi|21361633|ref|NP_060238.3|      ............................PSAIR...E............L..ENLQKLNVSHN.
gi|30425563|ref|NP_848665.1|      ............................PGTFG...S............-..-NLLTLWLFSN.
gi|50263044|ref|NP_116197.4|      ............................QDEFA...S............F..PHLEELELNEN.
gi|156139147|ref|NP_079269.4|     ............................SNQFA...G............L..NQLIWLYLDHN.
gi|4758460|ref|NP_004479.1|       ............................ASLFT...N............L..ENLKLLDLSGN.
gi|197927168|ref|NP_001128217.1|  ............................SNQFA...G............L..NQLIWLYLDHN.
gi|122937309|ref|NP_001073926.1|  ............................TDTFK...H............L..RHLEILQLSKN.
gi|22749183|ref|NP_689783.1|      ............................PEEFI...S............Y..PLLEEIDLSDN.
gi|7662102|ref|NP_056379.1|       ............................RDQFA...S............F..SQLTWLHLDHN.
gi|198041768|ref|NP_852607.3|     .....................snilyvyPKAFV...Q............L..RHLYFLFLNNN.
gi|15029530|ref|NP_071426.1|      ............................ADTFR...H............L..HHLEVLQLGRN.
gi|194440719|ref|NP_612490.1|     ............................AAAFQ...G............V..PHLTHLDLRHC.
gi|4502403|ref|NP_001702.1|       ............................KDDFK...G............L..QHLYALVLVNN.
gi|62912470|ref|NP_001017403.1|   ............................PGLFH...H............L..RFLEELRLSGN.
gi|30425553|ref|NP_848663.1|      ............................PGHFS...-............-..PAMVTLWIYSN.
gi|4504379|ref|NP_003658.1|       ............................PNPLP...S............L..RFLEELRLAGN.
gi|153251229|ref|NP_001258.2|     ............................ANSFR...A............M..PNLVSLHLQHC.
gi|51317373|ref|NP_065980.1|      ............................VNSFK...H............L..RHLEILQLSRN.
gi|4503743|ref|NP_002009.1|       ............................NQLFI...N............L..TDLLYLDLSEN.
gi|301069322|ref|NP_060150.4|     ............................ENDFK...G............L..TSLYGLILNNN.
gi|188528675|ref|NP_003052.2|     ............................TGMFK...K............L..THLKKINLSNN.
gi|153791507|ref|NP_001093130.1|  ............................EKCLS...E............L..SNLQELYINHN.
gi|153792227|ref|NP_060804.3|     ............................EKCLS...E............L..SNLQELYINHN.
gi|153792651|ref|NP_001093128.1|  ............................EKCLS...E............L..SNLQELYINHN.
gi|238908508|ref|NP_001155000.1|  ............................PSEIQ...L............L..HNLRILNVSHN.
gi|12007646|ref|NP_072089.1|      ............................PGAFK...G............L..PRLAELRLAHNg
gi|4826772|ref|NP_004961.1|       ............................PAAFQ...N............L..SSLGFLNLQGG.
gi|225579152|ref|NP_001139478.1|  ............................PAAFQ...N............L..SSLGFLNLQGG.
gi|109809759|ref|NP_821079.3|     ............................YNQFK...G............L..NQLTWLYLDHN.
gi|226342935|ref|NP_001139727.1|  ............................YNELS...R............L..SGLRTLNLHNN.
gi|40255157|ref|NP_700356.2|      ............................PPKMF...K............L..PQLQHLELNRN.
gi|4506013|ref|NP_002703.1|       ............................-ENLE...E............L..QSLRELDLYDN.
gi|86990456|ref|NP_849161.2|      ............................AGQFT...G............L..MQLTWLYLDHN.
gi|194440719|ref|NP_612490.1|     ............................RAAFP...G............L..GHLVSLHLQHC.
gi|45505137|ref|NP_714914.2|      ............................PEELS...R............L..HRLETLNLQNN.
gi|187829871|ref|NP_001120716.1|  ............................PLWIY...S............L..KTLEELHLTGNl
gi|187829877|ref|NP_001120717.1|  ............................PLWIY...S............L..KTLEELHLTGNl
gi|62241040|ref|NP_062540.2|      ............................PLWIY...S............L..KTLEELHLTGNl
gi|225579152|ref|NP_001139478.1|  ............................PRTFK...D............L..HFLEELQLGHN.
gi|45827729|ref|NP_056171.2|      ............................PKPFF...R............L..LNLRKLGLSDN.
gi|45827731|ref|NP_874365.2|      ............................PKPFF...R............L..LNLRKLGLSDN.
gi|122937315|ref|NP_001073929.1|  ............................PASLC...Q............C..SQLSVLDLSHN.
gi|197333706|ref|NP_001127951.1|  ............................PAWVY...L............L..KNLRELYLIGNl
gi|34222199|ref|NP_060573.2|      ............................PAWVY...L............L..KNLRELYLIGNl
gi|4826772|ref|NP_004961.1|       ............................PRTFK...D............L..HFLEELQLGHN.
gi|85986601|ref|NP_067647.2|      ............................PDCFK...N............Y..HDLQKLYLQNN.
gi|7019381|ref|NP_037363.1|       ............................RAALA...Q............L..LKLEELHLDDN.
gi|119395738|ref|NP_001073285.1|  ............................-----...-............-..-----------.
gi|119395736|ref|NP_000199.2|     ............................-----...-............-..-----------.
gi|62912472|ref|NP_067649.2|      ............................PGLFH...H............L..RFLEELRLSGN.
gi|88702793|ref|NP_612449.2|      ............................AGSFA...G............L..PGLQLLDLSQN.
gi|4557665|ref|NP_000866.1|       ............................-----...-............-..-----------.
gi|41349454|ref|NP_958505.1|      ............................VESFQ...N............A..TGLRWINLDNN.
gi|4506041|ref|NP_002716.1|       ............................VESFQ...N............A..TGLRWINLDNN.
gi|38202222|ref|NP_938205.1|      ............................YDSLS...K............I..PYLEELHLDDN.
gi|7019383|ref|NP_037413.1|       ............................YDSLS...K............I..PYLEELHLDDN.
gi|312283621|ref|NP_001186009.1|  ............................PEELS...R............L..HRLETLNLQNN.
gi|312283625|ref|NP_001186010.1|  ............................PEELS...R............L..HRLETLNLQNN.
gi|71040111|ref|NP_002014.2|      ............................EGVFD...N............A..TGLLWIALHGN.
gi|312283627|ref|NP_001186011.1|  ............................PGAFS...E............L..SSLRELYLQNN.
gi|19923729|ref|NP_115646.2|      ............................PPWMY...G............L..RNLEELYLVGS.
gi|95113664|ref|NP_060684.4|      ............................PEQFF...Q............L..VKLRKLGLSDN.
gi|16418467|ref|NP_443204.1|      ............................ANLLQ...G............A..SKLQELHLSSN.
gi|11321571|ref|NP_003053.1|      ............................TGIFK...K............L..PNLRKINLSNN.
gi|226342933|ref|NP_001139726.1|  ............................YNELS...R............L..SGLRTLNLHNN.
gi|4826876|ref|NP_005005.1|       ............................ANSFI...N............A..THLKEINLSHN.
gi|54792100|ref|NP_001973.2|      ............................-----...-............-..-----------.
gi|18677729|ref|NP_570718.1|      ............................DKVFI...K............Y..TKLKKIFLQHN.
gi|27363458|ref|NP_076941.2|      ............................PPDFR...N............M..TGLVDLTLSRN.
gi|34577057|ref|NP_037412.2|      ............................RDSLA...R............I..PLLEKLHLDDN.
gi|8394456|ref|NP_059138.1|       ............................GSQFL...P............L..TGLQVLDLSHN.
gi|40217803|ref|NP_079337.2|      ............................LNSLK...K............L..AALRELELVAC.
gi|291190772|ref|NP_000164.5|     ............................LATLM...P............Y..TRLTQLNLDRC.
gi|171846278|ref|NP_940980.3|     ............................PSYLL...K............M..SCIANLDVSRN.
gi|260593673|ref|NP_001159530.1|  ............................DKVFI...K............Y..TKLKKIFLQHN.
gi|45505137|ref|NP_714914.2|      ............................REDFA...T............T..YFLEELNLSYN.
gi|308818206|ref|NP_001184225.1|  ............................DEAFN...G............L..PNLERLDLSKN.
gi|4505047|ref|NP_002336.1|       ............................EKAFE...N............V..TDLQWLILDHN.
gi|312283621|ref|NP_001186009.1|  ............................REDFA...T............T..YFLEELNLSYN.
gi|312283625|ref|NP_001186010.1|  ............................REDFA...T............T..YFLEELNLSYN.
gi|41327732|ref|NP_958439.1|      ............................-----...-............-..-----------.
gi|41327736|ref|NP_958441.1|      ............................-----...-............-..-----------.
gi|7706093|ref|NP_057646.1|       ............................GSEFQ...P............L..AELRYLDFSNN.
gi|29725609|ref|NP_005219.2|      ............................-----...-............-..-----------.
gi|31542244|ref|NP_689660.2|      ............................RKDFA...N............M..TSLVDLTLSRN.
gi|110825958|ref|NP_001036064.1|  ............................-----...-............-..-----------.
gi|4885215|ref|NP_005226.1|       ............................-----...-............-..-----------.
gi|46094076|ref|NP_056331.2|      ............................ESVLAgp.G............Y..TTLAGLDLSHN.
gi|5901992|ref|NP_008966.1|       ............................EKPFE...N............A..TQLRWINLNKN.
gi|54792100|ref|NP_001973.2|      ............................-----...-............-..-----------.
gi|4759146|ref|NP_004778.1|       ............................TGIFK...K............L..PQLRKINFSNN.
gi|4507531|ref|NP_003256.1|       ............................NETFV...S............LahSPLHILNLTKN.
gi|38490688|ref|NP_849144.2|      ............................ETDFS...G............L..TKLELLMLHSN.
gi|65301141|ref|NP_055835.2|      ............................PSQIG...N............L..LNLQTLCLDGN.
gi|193083139|ref|NP_001122394.1|  ............................ASPLG...F............Y..TALRHLDLSTN.
gi|5031707|ref|NP_005503.1|       ............................ASPLG...F............Y..TALRHLDLSTN.
gi|4885215|ref|NP_005226.1|       ............................-----...-............-..-----------.
gi|110825958|ref|NP_001036064.1|  ............................-----...-............-..-----------.
gi|291219891|ref|NP_919431.2|     ...........................qLDVYP...V............P..NYLSYMDVSRN.
gi|20302168|ref|NP_619542.1|      ............................GTEFS...A............I..PHVKYLDLTNN.
gi|4507531|ref|NP_003256.1|       ............................AANFT...R............Y..SQLTSLDVGFN.
gi|13375646|ref|NP_078785.1|      ............................RRDLA...N............M..TGLLHLSLSRN.
gi|167555127|ref|NP_005573.2|     ............................QISAA...N............F..PSLTHLYIRGNv
gi|31657140|ref|NP_055030.1|      ............................-----...-............-..-----------.
gi|41327734|ref|NP_958440.1|      ............................-----...-............-..-----------.
gi|229089140|ref|NP_001019849.2|  ............................PGALA...P............L..AALRRLYLHNN.
gi|119395738|ref|NP_001073285.1|  ............................-----...-............-..-----------.
gi|119395736|ref|NP_000199.2|     ............................-----...-............-..-----------.
gi|31657138|ref|NP_000136.2|      ............................KGAFS...G............F..GDLEKIEISQNd
gi|41327732|ref|NP_958439.1|      ............................-----...-............-..-----------.
gi|41327736|ref|NP_958441.1|      ............................-----...-............-..-----------.
gi|29725609|ref|NP_005219.2|      ............................-----...-............-..-----------.
gi|188536110|ref|NP_689824.2|     ............................TSELG...H............L..EQLQVLTLRHN.
gi|109150416|ref|NP_036425.1|     ............................PGAFR...R............L..RNLNTLLLNNN.
gi|6912638|ref|NP_036557.1|       ............................VNGLF...T............L..SHITQLVLSHN.
gi|55741571|ref|NP_065788.1|      ............................RQDFA...N............M..TGLVDLTLSRN.
gi|193083139|ref|NP_001122394.1|  ............................DSFLE...H............L..TSLCFLNLSRN.
gi|5031707|ref|NP_005503.1|       ............................DSFLE...H............L..TSLCFLNLSRN.
gi|41281398|ref|NP_031399.2|      ............................-----...-............-..--IYSLNMEHN.
gi|54792096|ref|NP_004439.2|      ............................-----...-............-..-----------.
gi|4557665|ref|NP_000866.1|       ............................-----...-............-..-----------.
gi|54792098|ref|NP_001005862.1|   ............................-----...-............-..-----------.
gi|54792096|ref|NP_004439.2|      ............................-----...-............-..-----------.
gi|54792098|ref|NP_001005862.1|   ............................-----...-............-..-----------.
gi|62912472|ref|NP_067649.2|      ............................EKAFM...G............N..PLLQTIHFYDN.
gi|149773484|ref|NP_065913.1|     ............................RRDFA...N............M..TSLVHLTLSRN.
gi|16751843|ref|NP_003259.2|      ............................DEAFY...G............L..DNLQVLNLSYN.
gi|139948432|ref|NP_056234.2|     ............................ETSFA...G............L..TKLELLMIHGN.
gi|90991702|ref|NP_078928.3|      ............................SSDEI...I............C..SRLLEIDISSN.
gi|153792305|ref|NP_001093148.1|  ............................-----...-............-..-----------.
gi|190014581|ref|NP_078788.2|     ............................PDSLK...E............Q..THLREWYISNT.
gi|120953300|ref|NP_001073379.1|  ............................-HSLS...N............C..KKLKYIDAQEN.
gi|306140491|ref|NP_001182035.1|  ............................SSDFH...S............V..SKLRVLILCHN.
gi|306140493|ref|NP_001182036.1|  ............................SSDFH...S............V..SKLRVLILCHN.
gi|62865618|ref|NP_112218.2|      ............................SSDFH...S............V..SKLRVLILCHN.
gi|62865621|ref|NP_001017388.1|   ............................SSDFH...S............V..SKLRVLILCHN.
gi|262205665|ref|NP_001159864.1|  ............................AGAFArrpP............L..AELAALNLSGS.
gi|5729718|ref|NP_006661.1|       ............................AGAFArrpP............L..AELAALNLSGS.
gi|126517478|ref|NP_653252.3|     ............................GSAFK...K............L..KNLNTLLLNNN.
gi|306140495|ref|NP_001182037.1|  ............................SSDFH...S............V..SKLRVLILCHN.
gi|72534676|ref|NP_001026862.1|   ............................NNMFS...K............F..KKLKSLDLQQN.
gi|41350337|ref|NP_003254.2|      ............................TSDIL...S............L..SKLRILIISHN.
gi|52426787|ref|NP_002535.3|      ............................-----...-............-..-----------.
gi|193788651|ref|NP_001123362.1|  ............................PSALG...K............L..PGLKTLVLQNN.
gi|194306618|ref|NP_001123608.1|  ............................-----...-............-..-----------.
gi|194306621|ref|NP_001123609.1|  ............................-----...-............-..-----------.
gi|194306623|ref|NP_001123610.1|  ............................-----...-............-..-----------.
gi|39930401|ref|NP_065902.1|      ............................-----...-............-..-----------.
gi|157743290|ref|NP_001099051.1|  ............................PDFLW...G............L..SEVQKLNLSHN.
gi|299782601|ref|NP_001010847.1|  ............................EDFFI...F............Y..GDLVYLDFRNN.
gi|341915001|ref|XP_003403925.1|  ............................AHTFL...G............L..PNLEWLDLSKN.
gi|255652962|ref|NP_001157397.1|  ............................SWAFA...N............L..SSLQRLDLSNN.
gi|255652964|ref|NP_001157398.1|  ............................SWAFA...N............L..SSLQRLDLSNN.
gi|84781739|ref|NP_001034118.1|   ............................SWAFA...N............L..SSLQRLDLSNN.
gi|30181233|ref|NP_002310.2|      ............................PEAAC...Q............L..VSLEGLSLYHN.
gi|194394161|ref|NP_694992.2|     ............................PLLIG...K............F..TLLKSLSLNNN.
gi|14249428|ref|NP_116162.1|      ............................PIEAC...H............F..VSLENLNLYQN.
gi|256017174|ref|NP_001157683.1|  ............................PMELC...H............F..VSLEILNLYHN.
gi|41582239|ref|NP_958934.1|      ............................EGAFR...E............V..PLLQSLWLAHN.
gi|5031809|ref|NP_005536.1|       ............................EGAFR...E............V..PLLQSLWLAHN.
gi|63003903|ref|NP_963844.2|      ............................-----...-............-..-----------.
gi|223005922|ref|NP_001138549.1|  ............................-----...-............-..----QLELSGR.
gi|154091020|ref|NP_065922.3|     ............................PSDVW...L............F..APLETLNLYHN.
gi|33859670|ref|NP_055931.1|      ............................PMELC...H............F..VSLEILNLYHN.
gi|8394456|ref|NP_059138.1|       ............................DSDFA...H............L..PSLRHLNLKWN.
gi|256017180|ref|NP_001157685.1|  ............................PMELC...H............F..VSLEILNLYHN.
gi|27436867|ref|NP_775101.1|      ............................-----...-............-..-----------.
gi|296080773|ref|NP_001171678.1|  ............................-----...-............-..-----------.
gi|296080775|ref|NP_001171679.1|  ............................-----...-............-..-----------.
gi|34577083|ref|NP_689937.2|      ............................-----...-............-..-----------.
gi|167555127|ref|NP_005573.2|     ............................NRTFS...R............L..MNLTFLDLTRC.
gi|33285015|ref|NP_653199.2|      ............................ENLAQ...K............L..PNLVELYLHSN.
gi|291575177|ref|NP_852111.2|     ............................KGAFS...G............F..GDLEKIEISQNd
gi|24308207|ref|NP_065761.1|      ............................PGLAQ...G............L..PQLHSLVLRRN.
gi|31657140|ref|NP_055030.1|      ............................-----...-............-..-----------.
gi|52353306|ref|NP_001005210.1|   ............................PGYLT...C............Y..MELQVLDLHNN.
gi|10190722|ref|NP_065729.1|      ............................AFAFR...S............V..PWLMTLNLSNN.
gi|59823631|ref|NP_660333.2|      ............................-----...-............-..-----------.
gi|40217820|ref|NP_055741.2|      ............................-----...-............-..-----------.
gi|95113664|ref|NP_060684.4|      ............................PESIG...A............L..LHLKDLWLDGN.
gi|219521831|ref|NP_001137140.1|  ............................SEWIPv..S............F..AKLNTLILRHN.
gi|32469517|ref|NP_862830.1|      ............................SEWIPv..S............F..AKLNTLILRHN.
gi|21313638|ref|NP_060646.2|      ............................-----...-............-..-----------.
gi|21389483|ref|NP_653249.1|      ............................-SILC...G............Y..VHLQKLDLSAN.
gi|61742784|ref|NP_665893.2|      ............................GACLR...G............-..-----------.
gi|61742786|ref|NP_665894.2|      ............................GACLR...G............-..-----------.
gi|7706093|ref|NP_057646.1|       ............................PASFH...R............L..DHLVEIDFRCN.
gi|61966761|ref|NP_001013675.1|   ............................PGAFA...G............A..GALQRLDLREN.
gi|153791466|ref|NP_065754.2|     ............................AEWTPt..R............L..TQLHSLLLSHN.
gi|40217823|ref|NP_056382.1|      ............................RTDFL...E............A..TGLDLLHLGNN.
gi|157694513|ref|NP_060960.2|     ............................-----...-............-..-----------.
gi|221136957|ref|NP_001137475.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136961|ref|NP_001137476.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136965|ref|NP_001137477.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136969|ref|NP_001137478.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136977|ref|NP_001137480.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136981|ref|NP_001137481.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136985|ref|NP_001137482.1|  ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|33504581|ref|NP_115928.1|      ............................PNEFV...N............Y..SNAVTLHLGNN.
gi|221136957|ref|NP_001137475.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|221136961|ref|NP_001137476.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|221136965|ref|NP_001137477.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|221136969|ref|NP_001137478.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|221136977|ref|NP_001137480.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|221136981|ref|NP_001137481.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|221136985|ref|NP_001137482.1|  ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|33504581|ref|NP_115928.1|      ............................KNDLL...E............Y..SSLDLLHLGNN.
gi|194018474|ref|NP_001005214.2|  ............................AMHLG...L............L..SDLVYLDCQNN.
gi|40217817|ref|NP_443142.1|      ............................KSHFV...D............Y..KNLILLDLGNN.
gi|40217825|ref|NP_115605.2|      ............................KSDLV...E............Y..FTLEMLHLGNN.
gi|291219891|ref|NP_919431.2|     ............................LPAAR...-............-..-----------.
gi|4826816|ref|NP_005088.1|       ............................-----...-............-..-----------.
gi|38454322|ref|NP_942015.1|      ............................PGWLA...P............L..FQLRALHLDHN.
gi|40217817|ref|NP_443142.1|      ............................-----...-............-..-----------.
gi|164607156|ref|NP_113615.2|     ............................-ASLS...M............L..ANCEKLSLSTN.
gi|191252816|ref|NP_001122108.1|  ............................-----...-............-..-----------.
gi|40217823|ref|NP_056382.1|      ............................-----...-............-..-----------.
gi|27436867|ref|NP_775101.1|      ............................PNTFL...N............F..SHAVSLHLGNN.
gi|296080773|ref|NP_001171678.1|  ............................PNTFL...N............F..SHAVSLHLGNN.
gi|296080775|ref|NP_001171679.1|  ............................PNTFL...N............F..SHAVSLHLGNN.
gi|40217825|ref|NP_115605.2|      ............................-----...-............-..-----------.
gi|21281681|ref|NP_644807.1|      ............................-----...-............-..-----------.
gi|300934750|ref|NP_116166.9|     ............................-----...-............-..-----------.
gi|21281673|ref|NP_644813.1|      ............................-----...-............-..-----------.
gi|66912176|ref|NP_001019782.1|   ............................QSHTK...K............Ee.WKIKHLDLSNN.
gi|301069324|ref|NP_001180264.1|  ............................ENDFK...G............L..TSLYGLILNNN.
gi|116268101|ref|NP_443138.2|     ............................-----...-............-..-----------.
gi|318984125|ref|NP_001188295.1|  ............................--SLS...M............L..ANCEKLSLSTN.
gi|40217820|ref|NP_055741.2|      ............................TNSFL...H............L..NNAVSINLGNN.
gi|312222719|ref|NP_001185947.1|  ............................-QNIS...N............L..QKLISLDLYDN.
gi|106067657|ref|NP_000224.2|     ............................SQAFR...G............L..NEVIKIEISQId
gi|206725447|ref|NP_001128689.1|  ............................-YLLR...S............Y..IHLRYVDISEN.
gi|42542396|ref|NP_964013.1|      ............................-YLLR...S............Y..IHLRYVDISEN.
gi|15487670|ref|NP_006353.2|      ............................-----...-............-..-----------.
gi|20143971|ref|NP_006059.2|      ............................-----...-............-..-----------.
gi|55743114|ref|NP_060161.2|      ............................-QNIS...N............L..QKLISLDLYDN.
gi|312222716|ref|NP_001185946.1|  ............................-QNIS...N............L..QKLISLDLYDN.
gi|193083136|ref|NP_940908.2|     ............................-----...-............-..-----------.
gi|254039592|ref|NP_116564.2|     ............................-----...-............-..-----------.
gi|87298937|ref|NP_008949.4|      ............................-----...-............-..-----------.
gi|13430854|ref|NP_071336.1|      ............................-----...-............-..-----------.
gi|14277694|ref|NP_060279.2|      ............................-----...-............-..-----------.
gi|153791282|ref|NP_001093156.1|  ............................-----...-............-..-----------.
gi|194272226|ref|NP_001123563.1|  ............................-DNLW...Q............F..ENLRKLQLDNN.
gi|194272228|ref|NP_001123564.1|  ............................-DNLW...Q............F..ENLRKLQLDNN.
gi|194272222|ref|NP_001123562.1|  ............................-DNLW...Q............F..ENLRKLQLDNN.
gi|194272224|ref|NP_112584.3|     ............................-DNLW...Q............F..ENLRKLQLDNN.
gi|62988340|ref|NP_001017924.1|   ............................-----...-............-..-----------.
gi|68800360|ref|NP_004941.2|      ............................KNDFA...S............L..SDLKRIDLTSN.
gi|167466264|ref|NP_001006940.3|  ............................-----...-............-..----RLDLSKM.
gi|31377705|ref|NP_078824.2|      ............................-ENLE...K............C..KRLIQLSVANN.
gi|21361633|ref|NP_060238.3|      ............................-----...-............-..-----------.
gi|122937315|ref|NP_001073929.1|  ............................-----...-............-..-----------.
gi|299758423|ref|NP_001177652.1|  ............................-----...-............-..-----LDISKC.
gi|53729359|ref|NP_612370.3|      ............................-----...-............-..-----LDISKC.
gi|53729361|ref|NP_001005373.1|   ............................-----...-............-..-----LDISKC.
gi|53729363|ref|NP_001005374.1|   ............................-----...-............-..-----LDISKC.
gi|14149694|ref|NP_056428.1|      ............................-----...-............-..-----------.
gi|45439342|ref|NP_689542.2|      ............................DMRML...C............L..KSLRKLDLSHN.
gi|217330610|ref|NP_001136098.1|  ............................SHAFS...N............L..PNISRIYVSIDv
gi|288541295|ref|NP_001128529.2|  ............................ESPFL...N............I..SALIALRIEKN.
gi|117414162|ref|NP_208325.3|     ............................-----...-............-..-------LHCN.
gi|19743848|ref|NP_598011.1|      ............................-----...-............-..-----------.
gi|64085121|ref|NP_000360.2|      ............................SHAFS...N............L..PNISRIYVSIDv
gi|31621309|ref|NP_036604.2|      ............................-----...-............-..-----------.
gi|64085161|ref|NP_001018046.1|   ............................SHAFS...N............L..PNISRIYVSIDv
gi|50593002|ref|NP_003081.2|      ............................-----...-............-..-----------.
gi|5454088|ref|NP_006392.1|       ............................-----...-............-..-----------.
gi|7657419|ref|NP_055174.1|       ............................AEDFK...G............L..TKLKRIDLSNN.
gi|5453880|ref|NP_006296.1|       ............................-----...-............-..-----------.
gi|45827729|ref|NP_056171.2|      ............................----G...N............L..RRLVCLDVSEN.
gi|45827731|ref|NP_874365.2|      ............................----G...N............L..RRLVCLDVSEN.
gi|306922420|ref|NP_001182457.1|  ............................AAAFA...GgdgdgdqaagvrL..PLLSALRLTHN.
gi|226342933|ref|NP_001139726.1|  ............................AARLH...G............A..RGLRYLLLQHN.
gi|239582714|ref|NP_005815.2|     ............................-----...-............-..-----------.
gi|125625324|ref|NP_001074960.1|  ............................-----...-............-..-----------.
gi|54792102|ref|NP_001005915.1|   ............................-----...-............-..-----------.
gi|39930571|ref|NP_932341.1|      ............................-----...-............-..-----------.
gi|16751843|ref|NP_003259.2|      ............................ASSFP...F............L..EQLQLLELGSQy
gi|12597641|ref|NP_075052.1|      ............................-----...-............-..-----------.
gi|4826651|ref|NP_004919.1|       ............................-----...-............-..-----------.
gi|15529980|ref|NP_219481.1|      ............................---FH...T............L..DELQTVRLDRE.
gi|40254924|ref|NP_060979.2|      ............................VKELA...A............L..PKATILDLSCN.
gi|14916498|ref|NP_148935.1|      ............................AKDFA...D............I..PNLRRLDFTGN.
gi|7661704|ref|NP_054776.1|       ............................AKDFA...D............I..PNLRRLDFTGN.
gi|16418445|ref|NP_443185.1|      ............................NEIFK...D............L..HQLRVLNLSKN.
gi|13569879|ref|NP_112182.1|      ............................-----...-............-..-----------.
gi|5901898|ref|NP_008923.1|       ............................-YLLR...S............Y..IHLRYVDISEN.
gi|306966160|ref|NP_001182474.1|  ............................AGAFQ...H............L..PVLEELDLSHN.
gi|194239699|ref|NP_689928.3|     ............................-----...-............-..-----------.
gi|194239701|ref|NP_001123519.1|  ............................-----...-............-..-----------.
gi|13027616|ref|NP_076431.1|      ............................-----...-............-..-----LKLRGL.
gi|218931217|ref|NP_001136400.1|  ............................-----...-............-..-----LKLRGL.
gi|289547512|ref|NP_055649.4|     ............................KDSFE...G............L..LSLQYLDLSCN.
gi|28872863|ref|NP_056270.2|      ............................-ASLW...S............L..THLTALHLSDN.
gi|116325993|ref|NP_001006608.2|  ............................KDSFE...G............L..LSLQYLDLSCN.
gi|61966709|ref|NP_001013648.1|   ............................-TNLN...Y............A..TNLTHLYLQNN.
gi|305632814|ref|NP_001182209.1|  ............................-----...-............-..-----------.
gi|13562088|ref|NP_112153.1|      ............................DGAFQ...H............L..HRLRELDLSHN.
gi|75677612|ref|NP_955372.2|      ............................KDSFE...G............L..LSLQYLDLSCN.
gi|53829385|ref|NP_443120.2|      ............................KDSFE...G............L..LYLQYLDLSCN.
gi|150378449|ref|NP_892014.1|     ............................-----...-............-..-----------.
gi|59889558|ref|NP_001012331.1|   ............................-----...-............-..-----------.
gi|4585712|ref|NP_002520.2|       ............................-----...-............-..-----------.
gi|19743850|ref|NP_598012.1|      ............................AASLK...G............L..NNLAKLGLSFN.
gi|148664213|ref|NP_001091989.1|  ............................-----...-............-..-----------.
gi|210147571|ref|NP_001129951.1|  ............................-----...-............-..-----------.
gi|115583679|ref|NP_653172.2|     ............................STSLW...S............L..THLTALHLNDN.
gi|157785649|ref|NP_001099129.1|  ............................MENLQ...S............C..ISLRVCIFSNN.
gi|288541297|ref|NP_570843.2|     ............................ESPFL...N............I..SALIALRIEKN.
gi|46397369|ref|NP_997002.1|      ............................-----...-............-..-----------.
gi|239735605|ref|NP_060766.5|     ............................GDAFR...N............F..KNLRSLDLSRN.
gi|33469951|ref|NP_878256.1|      ............................-----...-............-..-----------.
gi|53828918|ref|NP_004572.3|      ............................-----...-............-..-----------.
gi|205360954|ref|NP_001009944.2|  ............................-----...-............-..-----------.
gi|205360962|ref|NP_000287.3|     ............................-----...-............-..-----------.
gi|38348406|ref|NP_940967.1|      ............................-----...-............-..-----------.
gi|4758460|ref|NP_004479.1|       ............................SQSFS...G............M..TVLQRLMISDS.
gi|219555702|ref|NP_001137230.1|  ............................QDFFQ...L............L..PNLTWLDLRYN.
gi|219555704|ref|NP_001137231.1|  ............................QDFFQ...L............L..PNLTWLDLRYN.
gi|219555700|ref|NP_001137229.1|  ............................QDFFQ...L............L..PNLTWLDLRYN.
gi|55741567|ref|NP_085129.1|      ............................QDFFQ...L............L..PNLTWLDLRYN.
gi|62899065|ref|NP_060610.2|      ............................-----...-............-..-----------.
gi|56118210|ref|NP_001007793.1|   ............................-----...-............-..-----------.
gi|6912604|ref|NP_036535.1|       ............................-----...-............-..-----------.
gi|55956794|ref|NP_001007157.1|   ............................-----...-............-..-----------.
gi|59889560|ref|NP_002521.2|      ............................-----...-............-..-----------.
gi|59889562|ref|NP_001012338.1|   ............................-----...-............-..-----------.
gi|4503743|ref|NP_002009.1|       ............................PENVK...A............M..TSLRWLKLNRT.
gi|55770895|ref|NP_001006600.1|   ............................KEIFT...F............E..KTLEELYLDAN.
gi|226342931|ref|NP_079101.3|     ............................ARDLV...A............T..PGLTELNLAYN.
gi|8923909|ref|NP_061165.1|       ............................-----...-............-..-----------.
gi|20143971|ref|NP_006059.2|      ............................VSDMS...F............L..SELTVLRLSHN.
gi|14042939|ref|NP_114413.1|      ............................-----...-............-..-----------.
gi|21071028|ref|NP_036536.2|      ............................-----...-............-..-----------.
gi|23097240|ref|NP_690852.1|      ............................-----...-............-..-----------.
gi|65301141|ref|NP_055835.2|      ............................LGVLN...R............M..NHIKHVDLRMN.
gi|19743852|ref|NP_598013.1|      ............................DGDFK...N............L..KNLHVVYLHNN.
gi|223718151|ref|NP_001138779.1|  ............................-----...-............-..-----------.
gi|55956790|ref|NP_001007098.1|   ............................-----...-............-..-----------.
gi|65506779|ref|NP_001018076.1|   ............................-----...-............-..-----------.
gi|312283627|ref|NP_001186011.1|  ............................-----...-............-..-----------.
gi|65506769|ref|NP_001018075.1|   ............................-----...-............-..-----------.
gi|21361306|ref|NP_006171.2|      ............................-----...-............-..-----------.
gi|65506745|ref|NP_001018074.1|   ............................-----...-............-..-----------.
gi|291575163|ref|NP_001167575.1|  ............................-----...-............-..-----------.
gi|291575165|ref|NP_001167576.1|  ............................-----...-............-..-----------.
gi|4557417|ref|NP_000582.1|       ............................-----...-............-..-----------.
gi|91105159|ref|NP_001035110.1|   ............................-----...-............-..-----------.
gi|4504077|ref|NP_000165.1|       ............................-----...-............-..-----------.
gi|41327734|ref|NP_958440.1|      ............................-----...-............-..-----------.
gi|148664188|ref|NP_689972.3|     ............................-----...-............-..-----------.
gi|4504073|ref|NP_000398.1|       ............................-----...-............-..-----------.
gi|54607118|ref|NP_056356.2|      ............................PAGFE...D............L..PNLQEVYLNNN.
gi|239582714|ref|NP_005815.2|     ............................PKEFE...D............V..HELKKLNLSSN.
gi|7706093|ref|NP_057646.1|       ............................-----...-............-..-----------.
gi|210147569|ref|NP_001129950.1|  ............................-----...-............-..-----------.
gi|45593138|ref|NP_660299.2|      ............................-----...-............-..-----------.
gi|34577057|ref|NP_037412.2|      ............................PQDLK...T............K..VNVQVIYLYEN.
gi|19718734|ref|NP_003255.2|      ............................-----...-............-..-----------.
gi|38202222|ref|NP_938205.1|      ............................PSDLK...N............L..LKVERIYLYHN.
gi|7019383|ref|NP_037413.1|       ............................PSDLK...N............L..LKVERIYLYHN.
gi|8922644|ref|NP_060675.1|       ............................-----...-............-..-----------.


                                                      70                                            
                                                       |                                            
d1xkua_                             ...KIS............KIS...........................................
gi|16904383|ref|NP_065845.1|      ...HLK............TL-...........................................
gi|110825984|ref|NP_004216.2|     ...RLT............ALG...........................................
gi|76880480|ref|NP_055632.2|      ...EIS............RLS...........................................
gi|288541297|ref|NP_570843.2|     ...RLT............DIP...........................................
gi|256217721|ref|NP_001073982.2|  ...LLA............QLP...........................................
gi|209862903|ref|NP_001129523.1|  ...NIS............ELQtafpalqlkylylnsnrvtsmepgyfdnlantllvlklnrnri
gi|42544231|ref|NP_006329.2|      ...QLY............RIA...........................................
gi|42544233|ref|NP_963924.1|      ...QLY............RIA...........................................
gi|288541295|ref|NP_001128529.2|  ...RLT............DIP...........................................
gi|54607118|ref|NP_056356.2|      ...RIT............QL-...........................................
gi|55770895|ref|NP_001006600.1|   ...EFT............EV-...........................................
gi|13194201|ref|NP_075380.1|      ...VLA............RID...........................................
gi|8923909|ref|NP_061165.1|       ...EFT............EV-...........................................
gi|19743846|ref|NP_598010.1|      ...KIS............KVS...........................................
gi|4503271|ref|NP_001911.1|       ...KIS............KVS...........................................
gi|7662320|ref|NP_055628.1|       ...RIK............IVE...........................................
gi|238908508|ref|NP_001155000.1|  ...KIM............YF-...........................................
gi|11321571|ref|NP_003053.1|      ...QVS............VIE...........................................
gi|188528675|ref|NP_003052.2|     ...QIG............AVE...........................................
gi|4759146|ref|NP_004778.1|       ...KIS............TIE...........................................
gi|157694513|ref|NP_060960.2|     ...DLS............FIH...........................................
gi|157426829|ref|NP_001094861.1|  ...AIA............HVE...........................................
gi|153791330|ref|NP_065924.3|     ...QIS............TIS...........................................
gi|41281398|ref|NP_031399.2|      ...KLR............EI-...........................................
gi|52138725|ref|NP_001004432.1|   ...QLS............TLE...........................................
gi|62912474|ref|NP_001017404.1|   ...QLG............GIP...........................................
gi|21361633|ref|NP_060238.3|      ...KLK............IL-...........................................
gi|30425563|ref|NP_848665.1|      ...NLS............TIY...........................................
gi|50263044|ref|NP_116197.4|      ...IVS............AVE...........................................
gi|156139147|ref|NP_079269.4|     ...YIS............SVD...........................................
gi|4758460|ref|NP_004479.1|       ...NLT............HLP...........................................
gi|197927168|ref|NP_001128217.1|  ...YIS............SVD...........................................
gi|122937309|ref|NP_001073926.1|  ...LVR............KIE...........................................
gi|22749183|ref|NP_689783.1|      ...IIA............NVE...........................................
gi|7662102|ref|NP_056379.1|       ...QIS............TVK...........................................
gi|198041768|ref|NP_852607.3|     ...FIK............RLD...........................................
gi|15029530|ref|NP_071426.1|      ...SIR............QIE...........................................
gi|194440719|ref|NP_612490.1|     ...EVE............LVA...........................................
gi|4502403|ref|NP_001702.1|       ...KIS............KIH...........................................
gi|62912470|ref|NP_001017403.1|   ...HLS............HIP...........................................
gi|30425553|ref|NP_848663.1|      ...NIT............YIH...........................................
gi|4504379|ref|NP_003658.1|       ...ALT............YIP...........................................
gi|153251229|ref|NP_001258.2|     ...QIR............EVA...........................................
gi|51317373|ref|NP_065980.1|      ...HIR............TIE...........................................
gi|4503743|ref|NP_002009.1|       ...RLE............SL-...........................................
gi|301069322|ref|NP_060150.4|     ...KLT............KIH...........................................
gi|188528675|ref|NP_003052.2|     ...KVS............EIE...........................................
gi|153791507|ref|NP_001093130.1|  ...LLS............TIS...........................................
gi|153792227|ref|NP_060804.3|     ...LLS............TIS...........................................
gi|153792651|ref|NP_001093128.1|  ...LLS............TIS...........................................
gi|238908508|ref|NP_001155000.1|  ...HIS............HI-...........................................
gi|12007646|ref|NP_072089.1|      ...DLR............YLH...........................................
gi|4826772|ref|NP_004961.1|       ...QLG............SLE...........................................
gi|225579152|ref|NP_001139478.1|  ...QLG............SLE...........................................
gi|109809759|ref|NP_821079.3|     ...HIS............NID...........................................
gi|226342935|ref|NP_001139727.1|  ...LISse..........GLP...........................................
gi|40255157|ref|NP_700356.2|      ...KIK............NVD...........................................
gi|4506013|ref|NP_002703.1|       ...QIK............KI-...........................................
gi|86990456|ref|NP_849161.2|      ...HIC............SVQ...........................................
gi|194440719|ref|NP_612490.1|     ...GIA............ELE...........................................
gi|45505137|ref|NP_714914.2|      ...RLTsr..........GLP...........................................
gi|187829871|ref|NP_001120716.1|  saeNNR............YIV...........................................
gi|187829877|ref|NP_001120717.1|  saeNNR............YIV...........................................
gi|62241040|ref|NP_062540.2|      saeNNR............YIV...........................................
gi|225579152|ref|NP_001139478.1|  ...RIR............QLA...........................................
gi|45827729|ref|NP_056171.2|      ...EIQ............RL-...........................................
gi|45827731|ref|NP_874365.2|      ...EIQ............RL-...........................................
gi|122937315|ref|NP_001073929.1|  ...LLH............SI-...........................................
gi|197333706|ref|NP_001127951.1|  nseNNK............MIG...........................................
gi|34222199|ref|NP_060573.2|      nseNNK............MIG...........................................
gi|4826772|ref|NP_004961.1|       ...RIR............QLA...........................................
gi|85986601|ref|NP_067647.2|      ...KIT............SIS...........................................
gi|7019381|ref|NP_037363.1|       ...SIStv..........GVE...........................................
gi|119395738|ref|NP_001073285.1|  ...---............---...........................................
gi|119395736|ref|NP_000199.2|     ...---............---...........................................
gi|62912472|ref|NP_067649.2|      ...HLS............HIP...........................................
gi|88702793|ref|NP_612449.2|      ...QIA............SLP...........................................
gi|4557665|ref|NP_000866.1|       ...---............---...........................................
gi|41349454|ref|NP_958505.1|      ...RIR............KID...........................................
gi|4506041|ref|NP_002716.1|       ...RIR............KID...........................................
gi|38202222|ref|NP_938205.1|      ...SVSav..........SIE...........................................
gi|7019383|ref|NP_037413.1|       ...SVSav..........SIE...........................................
gi|312283621|ref|NP_001186009.1|  ...RLTsr..........GLP...........................................
gi|312283625|ref|NP_001186010.1|  ...RLTsr..........GLP...........................................
gi|71040111|ref|NP_002014.2|      ...QITsd..........KVG...........................................
gi|312283627|ref|NP_001186011.1|  ...YLTde..........GLD...........................................
gi|19923729|ref|NP_115646.2|      ...LSHdisr........NVT...........................................
gi|95113664|ref|NP_060684.4|      ...EIQ............RL-...........................................
gi|16418467|ref|NP_443204.1|      ...GLE............SLS...........................................
gi|11321571|ref|NP_003053.1|      ...KIK............EVR...........................................
gi|226342933|ref|NP_001139726.1|  ...LISse..........GLP...........................................
gi|4826876|ref|NP_005005.1|       ...KIKsq..........KID...........................................
gi|54792100|ref|NP_001973.2|      ...---............---...........................................
gi|18677729|ref|NP_570718.1|      ...CIR............HIS...........................................
gi|27363458|ref|NP_076941.2|      ...AIT............RIG...........................................
gi|34577057|ref|NP_037412.2|      ...SVStv..........SIE...........................................
gi|8394456|ref|NP_059138.1|       ...KLD............LYH...........................................
gi|40217803|ref|NP_079337.2|      ...GLE............RI-...........................................
gi|291190772|ref|NP_000164.5|     ...ELT............KL-...........................................
gi|171846278|ref|NP_940980.3|     ...DIGp...........SVV...........................................
gi|260593673|ref|NP_001159530.1|  ...CIR............HIS...........................................
gi|45505137|ref|NP_714914.2|      ...RITsp..........QVH...........................................
gi|308818206|ref|NP_001184225.1|  ...NITss..........GIG...........................................
gi|4505047|ref|NP_002336.1|       ...LLEns..........KIK...........................................
gi|312283621|ref|NP_001186009.1|  ...RITsp..........QVH...........................................
gi|312283625|ref|NP_001186010.1|  ...RITsp..........QVH...........................................
gi|41327732|ref|NP_958439.1|      ...---............---...........................................
gi|41327736|ref|NP_958441.1|      ...---............---...........................................
gi|7706093|ref|NP_057646.1|       ...RLD............LLH...........................................
gi|29725609|ref|NP_005219.2|      ...---............---...........................................
gi|31542244|ref|NP_689660.2|      ...TIS............FIT...........................................
gi|110825958|ref|NP_001036064.1|  ...---............---...........................................
gi|4885215|ref|NP_005226.1|       ...---............---...........................................
gi|46094076|ref|NP_056331.2|      ...LLT............SIS...........................................
gi|5901992|ref|NP_008966.1|       ...KITny..........GIE...........................................
gi|54792100|ref|NP_001973.2|      ...---............---...........................................
gi|4759146|ref|NP_004778.1|       ...KIT............DIE...........................................
gi|4507531|ref|NP_003256.1|       ...KIS............KIE...........................................
gi|38490688|ref|NP_849144.2|      ...GIH............TIP...........................................
gi|65301141|ref|NP_055835.2|      ...FLT............TL-...........................................
gi|193083139|ref|NP_001122394.1|  ...EIS............FLQ...........................................
gi|5031707|ref|NP_005503.1|       ...EIS............FLQ...........................................
gi|4885215|ref|NP_005226.1|       ...---............---...........................................
gi|110825958|ref|NP_001036064.1|  ...---............---...........................................
gi|291219891|ref|NP_919431.2|     ...RLE............NV-...........................................
gi|20302168|ref|NP_619542.1|      ...RLD............FDN...........................................
gi|4507531|ref|NP_003256.1|       ...TIS............KLE...........................................
gi|13375646|ref|NP_078785.1|      ...TIR............HVA...........................................
gi|167555127|ref|NP_005573.2|     ...KKL............HLG...........................................
gi|31657140|ref|NP_055030.1|      ...---............---...........................................
gi|41327734|ref|NP_958440.1|      ...---............---...........................................
gi|229089140|ref|NP_001019849.2|  ...SLR............ALE...........................................
gi|119395738|ref|NP_001073285.1|  ...---............---...........................................
gi|119395736|ref|NP_000199.2|     ...---............---...........................................
gi|31657138|ref|NP_000136.2|      ...VLE............VIE...........................................
gi|41327732|ref|NP_958439.1|      ...---............---...........................................
gi|41327736|ref|NP_958441.1|      ...---............---...........................................
gi|29725609|ref|NP_005219.2|      ...---............---...........................................
gi|188536110|ref|NP_689824.2|     ...RIA............AL-...........................................
gi|109150416|ref|NP_036425.1|     ...QIK............RIP...........................................
gi|6912638|ref|NP_036557.1|       ...KLT............MV-...........................................
gi|55741571|ref|NP_065788.1|      ...TIS............HIQ...........................................
gi|193083139|ref|NP_001122394.1|  ...CLR............TFE...........................................
gi|5031707|ref|NP_005503.1|       ...CLR............TFE...........................................
gi|41281398|ref|NP_031399.2|      ...RIN............KIP...........................................
gi|54792096|ref|NP_004439.2|      ...---............---...........................................
gi|4557665|ref|NP_000866.1|       ...---............---...........................................
gi|54792098|ref|NP_001005862.1|   ...---............---...........................................
gi|54792096|ref|NP_004439.2|      ...---............---...........................................
gi|54792098|ref|NP_001005862.1|   ...---............---...........................................
gi|62912472|ref|NP_067649.2|      ...PIQ............FVG...........................................
gi|149773484|ref|NP_065913.1|     ...TIG............QVA...........................................
gi|16751843|ref|NP_003259.2|      ...LLG............ELY...........................................
gi|139948432|ref|NP_056234.2|     ...EIP............SIP...........................................
gi|90991702|ref|NP_078928.3|      ...KLS............HL-...........................................
gi|153792305|ref|NP_001093148.1|  ...---............---...........................................
gi|190014581|ref|NP_078788.2|     ...LIQ............II-...........................................
gi|120953300|ref|NP_001073379.1|  ...HIE............AI-...........................................
gi|306140491|ref|NP_001182035.1|  ...RIQ............QLD...........................................
gi|306140493|ref|NP_001182036.1|  ...RIQ............QLD...........................................
gi|62865618|ref|NP_112218.2|      ...RIQ............QLD...........................................
gi|62865621|ref|NP_001017388.1|   ...RIQ............QLD...........................................
gi|262205665|ref|NP_001159864.1|  ...RLD............EVR...........................................
gi|5729718|ref|NP_006661.1|       ...RLD............EVR...........................................
gi|126517478|ref|NP_653252.3|     ...HIR............KIS...........................................
gi|306140495|ref|NP_001182037.1|  ...RIQ............QLD...........................................
gi|72534676|ref|NP_001026862.1|   ...EIS............KIE...........................................
gi|41350337|ref|NP_003254.2|      ...RIQ............YLD...........................................
gi|52426787|ref|NP_002535.3|      ...---............---...........................................
gi|193788651|ref|NP_001123362.1|  ...LIP............KV-...........................................
gi|194306618|ref|NP_001123608.1|  ...---............---...........................................
gi|194306621|ref|NP_001123609.1|  ...---............---...........................................
gi|194306623|ref|NP_001123610.1|  ...---............---...........................................
gi|39930401|ref|NP_065902.1|      ...---............---...........................................
gi|157743290|ref|NP_001099051.1|  ...QLR............VL-...........................................
gi|299782601|ref|NP_001010847.1|  ...SLR............SLE...........................................
gi|341915001|ref|XP_003403925.1|  ...KLDpr..........GLH...........................................
gi|255652962|ref|NP_001157397.1|  ...FLD............RLP...........................................
gi|255652964|ref|NP_001157398.1|  ...FLD............RLP...........................................
gi|84781739|ref|NP_001034118.1|   ...FLD............RLP...........................................
gi|30181233|ref|NP_002310.2|      ...CLR............CL-...........................................
gi|194394161|ref|NP_694992.2|     ...KLT............VL-...........................................
gi|14249428|ref|NP_116162.1|      ...CIR............YI-...........................................
gi|256017174|ref|NP_001157683.1|  ...CIR............VI-...........................................
gi|41582239|ref|NP_958934.1|      ...EIR............TVA...........................................
gi|5031809|ref|NP_005536.1|       ...EIR............TVA...........................................
gi|63003903|ref|NP_963844.2|      ...---............---...........................................
gi|223005922|ref|NP_001138549.1|  ...RLR............RL-...........................................
gi|154091020|ref|NP_065922.3|     ...CIK............TI-...........................................
gi|33859670|ref|NP_055931.1|      ...CIR............VI-...........................................
gi|8394456|ref|NP_059138.1|       ...CPPvglspmhfpchmTIE...........................................
gi|256017180|ref|NP_001157685.1|  ...CIR............VI-...........................................
gi|27436867|ref|NP_775101.1|      ...---............---...........................................
gi|296080773|ref|NP_001171678.1|  ...---............---...........................................
gi|296080775|ref|NP_001171679.1|  ...---............---...........................................
gi|34577083|ref|NP_689937.2|      ...---............---...........................................
gi|167555127|ref|NP_005573.2|     ...QIN............WIH...........................................
gi|33285015|ref|NP_653199.2|      ...NIV............VV-...........................................
gi|291575177|ref|NP_852111.2|     ...VLE............VIE...........................................
gi|24308207|ref|NP_065761.1|      ...ALG............PGL...........................................
gi|31657140|ref|NP_055030.1|      ...---............---...........................................
gi|52353306|ref|NP_001005210.1|   ...SLM............ELP...........................................
gi|10190722|ref|NP_065729.1|      ...SLS............NLA...........................................
gi|59823631|ref|NP_660333.2|      ...---............---...........................................
gi|40217820|ref|NP_055741.2|      ...---............---...........................................
gi|95113664|ref|NP_060684.4|      ...QLS............EL-...........................................
gi|219521831|ref|NP_001137140.1|  ...NIT............SIS...........................................
gi|32469517|ref|NP_862830.1|      ...NIT............SIS...........................................
gi|21313638|ref|NP_060646.2|      ...---............---...........................................
gi|21389483|ref|NP_653249.1|      ...KIE............DL-...........................................
gi|61742784|ref|NP_665893.2|      ...ALT............NL-...........................................
gi|61742786|ref|NP_665894.2|      ...ALT............NL-...........................................
gi|7706093|ref|NP_057646.1|       ...CVP............IPLgsknnmcikrlqik.............................
gi|61966761|ref|NP_001013675.1|   ...---............---...........................................
gi|153791466|ref|NP_065754.2|     ...HLN............FIS...........................................
gi|40217823|ref|NP_056382.1|      ...RIS............MIQ...........................................
gi|157694513|ref|NP_060960.2|     ...---............---...........................................
gi|221136957|ref|NP_001137475.1|  ...GLQ............EIR...........................................
gi|221136961|ref|NP_001137476.1|  ...GLQ............EIR...........................................
gi|221136965|ref|NP_001137477.1|  ...GLQ............EIR...........................................
gi|221136969|ref|NP_001137478.1|  ...GLQ............EIR...........................................
gi|221136977|ref|NP_001137480.1|  ...GLQ............EIR...........................................
gi|221136981|ref|NP_001137481.1|  ...GLQ............EIR...........................................
gi|221136985|ref|NP_001137482.1|  ...GLQ............EIR...........................................
gi|33504581|ref|NP_115928.1|      ...GLQ............EIR...........................................
gi|221136957|ref|NP_001137475.1|  ...RIA............VIQ...........................................
gi|221136961|ref|NP_001137476.1|  ...RIA............VIQ...........................................
gi|221136965|ref|NP_001137477.1|  ...RIA............VIQ...........................................
gi|221136969|ref|NP_001137478.1|  ...RIA............VIQ...........................................
gi|221136977|ref|NP_001137480.1|  ...RIA............VIQ...........................................
gi|221136981|ref|NP_001137481.1|  ...RIA............VIQ...........................................
gi|221136985|ref|NP_001137482.1|  ...RIA............VIQ...........................................
gi|33504581|ref|NP_115928.1|      ...RIA............VIQ...........................................
gi|194018474|ref|NP_001005214.2|  ...RIR............EVM...........................................
gi|40217817|ref|NP_443142.1|      ...NIA............TVE...........................................
gi|40217825|ref|NP_115605.2|      ...RIE............VLE...........................................
gi|291219891|ref|NP_919431.2|     ...---............G--...........................................
gi|4826816|ref|NP_005088.1|       ...---............---...........................................
gi|38454322|ref|NP_942015.1|      ...ELD............ALG...........................................
gi|40217817|ref|NP_443142.1|      ...---............---...........................................
gi|164607156|ref|NP_113615.2|     ...CIE............KI-...........................................
gi|191252816|ref|NP_001122108.1|  ...---............---...........................................
gi|40217823|ref|NP_056382.1|      ...---............---...........................................
gi|27436867|ref|NP_775101.1|      ...KLQ............NIE...........................................
gi|296080773|ref|NP_001171678.1|  ...KLQ............NIE...........................................
gi|296080775|ref|NP_001171679.1|  ...KLQ............NIE...........................................
gi|40217825|ref|NP_115605.2|      ...---............---...........................................
gi|21281681|ref|NP_644807.1|      ...---............---...........................................
gi|300934750|ref|NP_116166.9|     ...---............---...........................................
gi|21281673|ref|NP_644813.1|      ...---............---...........................................
gi|66912176|ref|NP_001019782.1|   ...LIS............KIT...........................................
gi|301069324|ref|NP_001180264.1|  ...KLT............KIH...........................................
gi|116268101|ref|NP_443138.2|     ...---............---...........................................
gi|318984125|ref|NP_001188295.1|  ...CIE............KI-...........................................
gi|40217820|ref|NP_055741.2|      ...ALQ............DIQ...........................................
gi|312222719|ref|NP_001185947.1|  ...QIE............EI-...........................................
gi|106067657|ref|NP_000224.2|     ...SLE............RIE...........................................
gi|206725447|ref|NP_001128689.1|  ...HLT............DL-...........................................
gi|42542396|ref|NP_964013.1|      ...HLT............DL-...........................................
gi|15487670|ref|NP_006353.2|      ...---............---...........................................
gi|20143971|ref|NP_006059.2|      ...---............---...........................................
gi|55743114|ref|NP_060161.2|      ...QIE............EI-...........................................
gi|312222716|ref|NP_001185946.1|  ...QIE............EI-...........................................
gi|193083136|ref|NP_940908.2|     ...---............---...........................................
gi|254039592|ref|NP_116564.2|     ...---............---...........................................
gi|87298937|ref|NP_008949.4|      ...---............---...........................................
gi|13430854|ref|NP_071336.1|      ...---............---...........................................
gi|14277694|ref|NP_060279.2|      ...---............---...........................................
gi|153791282|ref|NP_001093156.1|  ...---............---...........................................
gi|194272226|ref|NP_001123563.1|  ...IIE............KI-...........................................
gi|194272228|ref|NP_001123564.1|  ...IIE............KI-...........................................
gi|194272222|ref|NP_001123562.1|  ...IIE............KI-...........................................
gi|194272224|ref|NP_112584.3|     ...IIE............KI-...........................................
gi|62988340|ref|NP_001017924.1|   ...---............---...........................................
gi|68800360|ref|NP_004941.2|      ...LIS............EID...........................................
gi|167466264|ref|NP_001006940.3|  ...GIT............TF-...........................................
gi|31377705|ref|NP_078824.2|      ...RLV............RM-...........................................
gi|21361633|ref|NP_060238.3|      ...---............---...........................................
gi|122937315|ref|NP_001073929.1|  ...---............---...........................................
gi|299758423|ref|NP_001177652.1|  ...ELS............EIP...........................................
gi|53729359|ref|NP_612370.3|      ...ELS............EIP...........................................
gi|53729361|ref|NP_001005373.1|   ...ELS............EIP...........................................
gi|53729363|ref|NP_001005374.1|   ...ELS............EIP...........................................
gi|14149694|ref|NP_056428.1|      ...---............---...........................................
gi|45439342|ref|NP_689542.2|      ...HIK............KL-...........................................
gi|217330610|ref|NP_001136098.1|  ...TLQ............QLE...........................................
gi|288541295|ref|NP_001128529.2|  ...ELS............RIT...........................................
gi|117414162|ref|NP_208325.3|     ...NIS............KI-...........................................
gi|19743848|ref|NP_598011.1|      ...---............---...........................................
gi|64085121|ref|NP_000360.2|      ...TLQ............QLE...........................................
gi|31621309|ref|NP_036604.2|      ...---............---...........................................
gi|64085161|ref|NP_001018046.1|   ...TLQ............QLE...........................................
gi|50593002|ref|NP_003081.2|      ...---............---...........................................
gi|5454088|ref|NP_006392.1|       ...---............---...........................................
gi|7657419|ref|NP_055174.1|       ...LIS............SID...........................................
gi|5453880|ref|NP_006296.1|       ...---............---...........................................
gi|45827729|ref|NP_056171.2|      ...RLE............EL-...........................................
gi|45827731|ref|NP_874365.2|      ...RLE............EL-...........................................
gi|306922420|ref|NP_001182457.1|  ...HIE............VVE...........................................
gi|226342933|ref|NP_001139726.1|  ...QLGss..........GLP...........................................
gi|239582714|ref|NP_005815.2|     ...---............---...........................................
gi|125625324|ref|NP_001074960.1|  ...---............---...........................................
gi|54792102|ref|NP_001005915.1|   ...---............---...........................................
gi|39930571|ref|NP_932341.1|      ...---............---...........................................
gi|16751843|ref|NP_003259.2|      ...TPL............TID...........................................
gi|12597641|ref|NP_075052.1|      ...---............---...........................................
gi|4826651|ref|NP_004919.1|       ...---............---...........................................
gi|15529980|ref|NP_219481.1|      ...GIT............TI-...........................................
gi|40254924|ref|NP_060979.2|      ...KLT............TL-...........................................
gi|14916498|ref|NP_148935.1|      ...LIE............DIE...........................................
gi|7661704|ref|NP_054776.1|       ...LIE............DIE...........................................
gi|16418445|ref|NP_443185.1|      ...GIE............FID...........................................
gi|13569879|ref|NP_112182.1|      ...---............---...........................................
gi|5901898|ref|NP_008923.1|       ...HLT............DL-...........................................
gi|306966160|ref|NP_001182474.1|  ...ALA............HLS...........................................
gi|194239699|ref|NP_689928.3|     ...---............HEV...........................................
gi|194239701|ref|NP_001123519.1|  ...---............HEV...........................................
gi|13027616|ref|NP_076431.1|      ...GLA............DL-...........................................
gi|218931217|ref|NP_001136400.1|  ...GLA............DL-...........................................
gi|289547512|ref|NP_055649.4|     ...KIQ............SIE...........................................
gi|28872863|ref|NP_056270.2|      ...SLS............RI-...........................................
gi|116325993|ref|NP_001006608.2|  ...KIQ............SIE...........................................
gi|61966709|ref|NP_001013648.1|   ...CIS............CI-...........................................
gi|305632814|ref|NP_001182209.1|  ...---............---...........................................
gi|13562088|ref|NP_112153.1|      ...AIE............AIG...........................................
gi|75677612|ref|NP_955372.2|      ...KIQ............SIE...........................................
gi|53829385|ref|NP_443120.2|      ...KIR............YIE...........................................
gi|150378449|ref|NP_892014.1|     ...---............--P...........................................
gi|59889558|ref|NP_001012331.1|   ...---............---...........................................
gi|4585712|ref|NP_002520.2|       ...---............---...........................................
gi|19743850|ref|NP_598012.1|      ...SIS............AVD...........................................
gi|148664213|ref|NP_001091989.1|  ...---............---...........................................
gi|210147571|ref|NP_001129951.1|  ...---............---...........................................
gi|115583679|ref|NP_653172.2|     ...YLS............RI-...........................................
gi|157785649|ref|NP_001099129.1|  ...FIT............DI-...........................................
gi|288541297|ref|NP_570843.2|     ...ELS............RIT...........................................
gi|46397369|ref|NP_997002.1|      ...---............---...........................................
gi|239735605|ref|NP_060766.5|     ...LIT............SL-...........................................
gi|33469951|ref|NP_878256.1|      ...---............---...........................................
gi|53828918|ref|NP_004572.3|      ...---............---...........................................
gi|205360954|ref|NP_001009944.2|  ...---............---...........................................
gi|205360962|ref|NP_000287.3|     ...---............---...........................................
gi|38348406|ref|NP_940967.1|      ...---............---...........................................
gi|4758460|ref|NP_004479.1|       ...HIS............AVA...........................................
gi|219555702|ref|NP_001137230.1|  ...RIK............AL-...........................................
gi|219555704|ref|NP_001137231.1|  ...RIK............AL-...........................................
gi|219555700|ref|NP_001137229.1|  ...RIK............AL-...........................................
gi|55741567|ref|NP_085129.1|      ...RIK............AL-...........................................
gi|62899065|ref|NP_060610.2|      ...---............---...........................................
gi|56118210|ref|NP_001007793.1|   ...---............---...........................................
gi|6912604|ref|NP_036535.1|       ...---............---...........................................
gi|55956794|ref|NP_001007157.1|   ...---............---...........................................
gi|59889560|ref|NP_002521.2|      ...---............---...........................................
gi|59889562|ref|NP_001012338.1|   ...---............---...........................................
gi|4503743|ref|NP_002009.1|       ...GLC............YL-...........................................
gi|55770895|ref|NP_001006600.1|   ...QIE............EL-...........................................
gi|226342931|ref|NP_079101.3|     ...RLAsa..........RVH...........................................
gi|8923909|ref|NP_061165.1|       ...---............---...........................................
gi|20143971|ref|NP_006059.2|      ...RIQ............LLD...........................................
gi|14042939|ref|NP_114413.1|      ...---............---...........................................
gi|21071028|ref|NP_036536.2|      ...---............---...........................................
gi|23097240|ref|NP_690852.1|      ...---............---...........................................
gi|65301141|ref|NP_055835.2|      ...HLK............TMV...........................................
gi|19743852|ref|NP_598013.1|      ...NIS............VVG...........................................
gi|223718151|ref|NP_001138779.1|  ...---............---...........................................
gi|55956790|ref|NP_001007098.1|   ...---............---...........................................
gi|65506779|ref|NP_001018076.1|   ...---............---...........................................
gi|312283627|ref|NP_001186011.1|  ...---............---...........................................
gi|65506769|ref|NP_001018075.1|   ...---............---...........................................
gi|21361306|ref|NP_006171.2|      ...---............---...........................................
gi|65506745|ref|NP_001018074.1|   ...---............---...........................................
gi|291575163|ref|NP_001167575.1|  ...---............---...........................................
gi|291575165|ref|NP_001167576.1|  ...---............---...........................................
gi|4557417|ref|NP_000582.1|       ...---............---...........................................
gi|91105159|ref|NP_001035110.1|   ...---............---...........................................
gi|4504077|ref|NP_000165.1|       ...---............---...........................................
gi|41327734|ref|NP_958440.1|      ...---............---...........................................
gi|148664188|ref|NP_689972.3|     ...---............---...........................................
gi|4504073|ref|NP_000398.1|       ...---............---...........................................
gi|54607118|ref|NP_056356.2|      ...ELT............AV-...........................................
gi|239582714|ref|NP_005815.2|     ...GIE............FID...........................................
gi|7706093|ref|NP_057646.1|       ...---............---...........................................
gi|210147569|ref|NP_001129950.1|  ...---............---...........................................
gi|45593138|ref|NP_660299.2|      ...---............---...........................................
gi|34577057|ref|NP_037412.2|      ...DL-............---...........................................
gi|19718734|ref|NP_003255.2|      ...---............---...........................................
gi|38202222|ref|NP_938205.1|      ...---............---...........................................
gi|7019383|ref|NP_037413.1|       ...---............---...........................................
gi|8922644|ref|NP_060675.1|       ...---............---...........................................


                                               80                                                   
                                                |                                                   
d1xkua_                             ...PGAFAPL.VKLE..RLYLSK.........................................
gi|16904383|ref|NP_065845.1|      ...PKSMHKL.AQLE..RLDLGN.........................................
gi|110825984|ref|NP_004216.2|     ...AEVVSAL.RELR..KLNLSH.........................................
gi|76880480|ref|NP_055632.2|      ...RGSFEGL.ESLV..KLRLDG.........................................
gi|288541297|ref|NP_570843.2|     ...MGTFDGL.VNLQ..ELALQQ.........................................
gi|256217721|ref|NP_001073982.2|  ...EELFHPL.TSLQ..TLKLSN.........................................
gi|209862903|ref|NP_001129523.1|  saiPPKMFKL.PQLQ..HLELNR.........................................
gi|42544231|ref|NP_006329.2|      ...PRAFSGL.SNLL..RLHLNS.........................................
gi|42544233|ref|NP_963924.1|      ...PRAFSGL.SNLL..RLHLNS.........................................
gi|288541295|ref|NP_001128529.2|  ...MGTFDGL.VNLQ..ELALQQ.........................................
gi|54607118|ref|NP_056356.2|      ...PVRAFKL.PRLT..QLDLNR.........................................
gi|55770895|ref|NP_001006600.1|   ...PEVLEQL.SGLK..EFWMDA.........................................
gi|13194201|ref|NP_075380.1|      ...AAAFTGL.ALLE..QLDLSD.........................................
gi|8923909|ref|NP_061165.1|       ...PEVLEQL.SGLK..EFWMDA.........................................
gi|19743846|ref|NP_598010.1|      ...PGAFTPL.VKLE..RLYLSK.........................................
gi|4503271|ref|NP_001911.1|       ...PGAFTPL.VKLE..RLYLSK.........................................
gi|7662320|ref|NP_055628.1|       ...GLTFQGL.DSLR..SLKMQR.........................................
gi|238908508|ref|NP_001155000.1|  ...PLGLCAL.DSLY..YLSVNG.........................................
gi|11321571|ref|NP_003053.1|      ...RGAFQDL.KQLE..RLRLNK.........................................
gi|188528675|ref|NP_003052.2|     ...RGAFDDM.KELE..RLRLNR.........................................
gi|4759146|ref|NP_004778.1|       ...RGAFQDL.KELE..RLRLNR.........................................
gi|157694513|ref|NP_060960.2|     ...PKALSGL.KELK..VLTLQN.........................................
gi|157426829|ref|NP_001094861.1|  ...PGAFANL.PRLR..VLRLRG.........................................
gi|153791330|ref|NP_065924.3|     ...AHAFAGL.KNLL..RLHLNS.........................................
gi|41281398|ref|NP_031399.2|      ...PSVVYRL.DSLT..TLYLRF.........................................
gi|52138725|ref|NP_001004432.1|   ...PGAFHGL.QSLL..TLRLQG.........................................
gi|62912474|ref|NP_001017404.1|   ...AEALWEL.PSLQ..SLDLNY.........................................
gi|21361633|ref|NP_060238.3|      ...PEEITNL.RNLK..CLYLQH.........................................
gi|30425563|ref|NP_848665.1|      ...PGTFRHL.QALE..ELDLGD.........................................
gi|50263044|ref|NP_116197.4|      ...PGAFNNL.FNLR..TLGLRS.........................................
gi|156139147|ref|NP_079269.4|     ...EDAFQGI.RRLK..ELILSS.........................................
gi|4758460|ref|NP_004479.1|       ...KGLLGAQ.AKLE..RLLLHS.........................................
gi|197927168|ref|NP_001128217.1|  ...EDAFQGI.RRLK..ELILSS.........................................
gi|122937309|ref|NP_001073926.1|  ...VGAFNGL.PSLN..TLELFD.........................................
gi|22749183|ref|NP_689783.1|      ...PGAFNNL.FNLR..SLRLKG.........................................
gi|7662102|ref|NP_056379.1|       ...EDAFQGL.YKLK..ELILSS.........................................
gi|198041768|ref|NP_852607.3|     ...PGIFKGL.LNLR..NLYLQY.........................................
gi|15029530|ref|NP_071426.1|      ...VGAFNGL.ASLN..TLELFD.........................................
gi|194440719|ref|NP_612490.1|     ...EGAFRGL.GRLL..LLNLAS.........................................
gi|4502403|ref|NP_001702.1|       ...EKAFSPL.RKLQ..KLYISK.........................................
gi|62912470|ref|NP_001017403.1|   ...GQAFSGL.YSLK..ILMLQN.........................................
gi|30425553|ref|NP_848663.1|      ...PSTFEGF.VHLE..ELDLGD.........................................
gi|4504379|ref|NP_003658.1|       ...KGAFTGL.YSLK..VLMLQN.........................................
gi|153251229|ref|NP_001258.2|     ...AGAFRGL.KQLI..YLYLSH.........................................
gi|51317373|ref|NP_065980.1|      ...IGAFNGL.ANLN..TLELFD.........................................
gi|4503743|ref|NP_002009.1|       ...PPQMRRL.VHLQ..TLVLNG.........................................
gi|301069322|ref|NP_060150.4|     ...PKAFLTT.KKLR..RLYLSH.........................................
gi|188528675|ref|NP_003052.2|     ...DGAFEGA.ASVS..ELHLTA.........................................
gi|153791507|ref|NP_001093130.1|  ...PGAFIGL.HNLL..RLHLNS.........................................
gi|153792227|ref|NP_060804.3|     ...PGAFIGL.HNLL..RLHLNS.........................................
gi|153792651|ref|NP_001093128.1|  ...PGAFIGL.HNLL..RLHLNS.........................................
gi|238908508|ref|NP_001155000.1|  ...PKEISQL.GNIR..QLFFYN.........................................
gi|12007646|ref|NP_072089.1|      ...ARTFAAL.SRLR..RLDLAA.........................................
gi|4826772|ref|NP_004961.1|       ...PQALLGL.ENLC..HLHLER.........................................
gi|225579152|ref|NP_001139478.1|  ...PQALLGL.ENLC..HLHLER.........................................
gi|109809759|ref|NP_821079.3|     ...ENAFNGI.RRLK..ELILSS.........................................
gi|226342935|ref|NP_001139727.1|  ...DEAFESL.TQLQ..HLCVAH.........................................
gi|40255157|ref|NP_700356.2|      ...GLTFQGL.GALK..SLKMQR.........................................
gi|4506013|ref|NP_002703.1|       ...-ENLEAL.TELE..ILDISF.........................................
gi|86990456|ref|NP_849161.2|      ...GDAFQKL.RRVK..ELTLSS.........................................
gi|194440719|ref|NP_612490.1|     ...AGALAGL.GRLI..YLYLSD.........................................
gi|45505137|ref|NP_714914.2|      ...EKAFEHL.TNLN..YLYLAN.........................................
gi|187829871|ref|NP_001120716.1|  ...IDGLREL.KRLK..VLRLKS.........................................
gi|187829877|ref|NP_001120717.1|  ...IDGLREL.KRLK..VLRLKS.........................................
gi|62241040|ref|NP_062540.2|      ...IDGLREL.KRLK..VLRLKS.........................................
gi|225579152|ref|NP_001139478.1|  ...ERSFEGL.GQLE..VLTLDH.........................................
gi|45827729|ref|NP_056171.2|      ...PPEVANF.MQLV..ELDVSR.........................................
gi|45827731|ref|NP_874365.2|      ...PPEVANF.MQLV..ELDVSR.........................................
gi|122937315|ref|NP_001073929.1|  ...PKSFAEL.RKMT..EIGLSG.........................................
gi|197333706|ref|NP_001127951.1|  ...LESLREL.RHLK..ILHVKS.........................................
gi|34222199|ref|NP_060573.2|      ...LESLREL.RHLK..ILHVKS.........................................
gi|4826772|ref|NP_004961.1|       ...ERSFEGL.GQLE..VLTLDH.........................................
gi|85986601|ref|NP_067647.2|      ...IYAFRGL.NSLT..KLYLSH.........................................
gi|7019381|ref|NP_037363.1|       ...DGAFREA.ISLK..LLFLSK.........................................
gi|119395738|ref|NP_001073285.1|  ...-------.----..------.........................................
gi|119395736|ref|NP_000199.2|     ...-------.----..------.........................................
gi|62912472|ref|NP_067649.2|      ...GQAFSGL.YSLK..ILMLQN.........................................
gi|88702793|ref|NP_612449.2|      ...SGVFQPL.ANLS..NLDLTA.........................................
gi|4557665|ref|NP_000866.1|       ...-------.----..------.........................................
gi|41349454|ref|NP_958505.1|      ...QRVLEKL.PGLV..FLYMEK.........................................
gi|4506041|ref|NP_002716.1|       ...QRVLEKL.PGLV..FLYMEK.........................................
gi|38202222|ref|NP_938205.1|      ...EGAFRDS.NYLR..LLFLSR.........................................
gi|7019383|ref|NP_037413.1|       ...EGAFRDS.NYLR..LLFLSR.........................................
gi|312283621|ref|NP_001186009.1|  ...EKAFEHL.TNLN..YLYLAN.........................................
gi|312283625|ref|NP_001186010.1|  ...EKAFEHL.TNLN..YLYLAN.........................................
gi|71040111|ref|NP_002014.2|      ...RKVFSKL.RHLE..RLYLDH.........................................
gi|312283627|ref|NP_001186011.1|  ...NETFWKL.SSLE..YLDLSS.........................................
gi|19923729|ref|NP_115646.2|      ...LESLRDL.KSLK..ILSIKSnvskipqavvdvsshlqkmcihndg................
gi|95113664|ref|NP_060684.4|      ...PPEIANF.MQLV..ELDVSR.........................................
gi|16418467|ref|NP_443204.1|      ...PEFLRPV.PQLR..VLDLTR.........................................
gi|11321571|ref|NP_003053.1|      ...EGAFDGA.ASVQ..ELMLTG.........................................
gi|226342933|ref|NP_001139726.1|  ...DEAFESL.TQLQ..HLCVAH.........................................
gi|4826876|ref|NP_005005.1|       ...YGVFAKL.PNLL..QLHLEH.........................................
gi|54792100|ref|NP_001973.2|      ...-------.----..------.........................................
gi|18677729|ref|NP_570718.1|      ...RKAFFGL.CNLQ..ILYLNH.........................................
gi|27363458|ref|NP_076941.2|      ...ARAFGDL.ESLR..SLHLDG.........................................
gi|34577057|ref|NP_037412.2|      ...EDAFADS.KQLK..LLFLSR.........................................
gi|8394456|ref|NP_059138.1|       ...EHSFTEL.PRLE..ALDLSY.........................................
gi|40217803|ref|NP_079337.2|      ...PHAVFSL.GALQ..ELDLKD.........................................
gi|291190772|ref|NP_000164.5|     ...-------.----..------.........................................
gi|171846278|ref|NP_940980.3|     ...LDPTVKC.PTLK..QFNLSY.........................................
gi|260593673|ref|NP_001159530.1|  ...RKAFFGL.CNLQ..ILYLNH.........................................
gi|45505137|ref|NP_714914.2|      ...RDAFRKL.RLLR..SLDLSG.........................................
gi|308818206|ref|NP_001184225.1|  ...PKAFKLL.KKLM..RLNMDG.........................................
gi|4505047|ref|NP_002336.1|       ...GRVFSKL.KQLK..KLHINH.........................................
gi|312283621|ref|NP_001186009.1|  ...RDAFRKL.RLLR..SLDLSG.........................................
gi|312283625|ref|NP_001186010.1|  ...RDAFRKL.RLLR..SLDLSG.........................................
gi|41327732|ref|NP_958439.1|      ...-------.----..------.........................................
gi|41327736|ref|NP_958441.1|      ...-------.----..------.........................................
gi|7706093|ref|NP_057646.1|       ...STAFEEL.HKLE..VLDISS.........................................
gi|29725609|ref|NP_005219.2|      ...-------.----..------.........................................
gi|31542244|ref|NP_689660.2|      ...PHAFADL.RNLR..ALHLNS.........................................
gi|110825958|ref|NP_001036064.1|  ...-------.----..------.........................................
gi|4885215|ref|NP_005226.1|       ...-------.----..------.........................................
gi|46094076|ref|NP_056331.2|      ...PTAFSRL.RYLE..SLDLSH.........................................
gi|5901992|ref|NP_008966.1|       ...KGALSQL.KKLL..FLFLED.........................................
gi|54792100|ref|NP_001973.2|      ...-------.----..------.........................................
gi|4759146|ref|NP_004778.1|       ...EGAFEGA.SGVN..EILLTS.........................................
gi|4507531|ref|NP_003256.1|       ...SDAFSWL.GHLE..VLDLGL.........................................
gi|38490688|ref|NP_849144.2|      ...DKTFSDL.QALQ..VLKMSY.........................................
gi|65301141|ref|NP_055835.2|      ...PEELGNL.QQLS..SLGISFnnfsqipevyekltmldrvvmagnclevlnlgvlnrmnhik
gi|193083139|ref|NP_001122394.1|  ...PGAFQAL.THLE..HLSLAH.........................................
gi|5031707|ref|NP_005503.1|       ...PGAFQAL.THLE..HLSLAH.........................................
gi|4885215|ref|NP_005226.1|       ...-------.----..------.........................................
gi|110825958|ref|NP_001036064.1|  ...-------.----..------.........................................
gi|291219891|ref|NP_919431.2|     ...PEWVCES.RKLE..VLDIGH.........................................
gi|20302168|ref|NP_619542.1|      ...ASALTEL.SDLE..VLDLSY.........................................
gi|4507531|ref|NP_003256.1|       ...PELCQKL.PMLK..VLNLQH.........................................
gi|13375646|ref|NP_078785.1|      ...AGAFADL.RALR..ALHLDG.........................................
gi|167555127|ref|NP_005573.2|     ...VGCLEKL.GNLQ..TLDLSH.........................................
gi|31657140|ref|NP_055030.1|      ...-------.----..------.........................................
gi|41327734|ref|NP_958440.1|      ...-------.----..------.........................................
gi|229089140|ref|NP_001019849.2|  ...AGAFRAQ.PRLL..ELALTS.........................................
gi|119395738|ref|NP_001073285.1|  ...-------.GHLQ..ILLMFK.........................................
gi|119395736|ref|NP_000199.2|     ...-------.GHLQ..ILLMFK.........................................
gi|31657138|ref|NP_000136.2|      ...ADVFSNL.PKLH..EIRIEK.........................................
gi|41327732|ref|NP_958439.1|      ...-------.----..------.........................................
gi|41327736|ref|NP_958441.1|      ...-------.----..------.........................................
gi|29725609|ref|NP_005219.2|      ...-------.----..------.........................................
gi|188536110|ref|NP_689824.2|     ...RWGPGGP.AGLH..TLDLSY.........................................
gi|109150416|ref|NP_036425.1|     ...SGAFEDL.ENLK..YLYLYK.........................................
gi|6912638|ref|NP_036557.1|       ...PPNIAEL.KNLE..VLNFFN.........................................
gi|55741571|ref|NP_065788.1|      ...PFSFLDL.ESLR..SLHLDS.........................................
gi|193083139|ref|NP_001122394.1|  ...ARRLGSL.PCLM..LLDLSH.........................................
gi|5031707|ref|NP_005503.1|       ...ARRLGSL.PCLM..LLDLSH.........................................
gi|41281398|ref|NP_031399.2|      ...FGIFSRA.KVLS..KLNMKD.........................................
gi|54792096|ref|NP_004439.2|      ...-------.----..------.........................................
gi|4557665|ref|NP_000866.1|       ...-------.----..------.........................................
gi|54792098|ref|NP_001005862.1|   ...-------.----..------.........................................
gi|54792096|ref|NP_004439.2|      ...-------.----..------.........................................
gi|54792098|ref|NP_001005862.1|   ...-------.----..------.........................................
gi|62912472|ref|NP_067649.2|      ...RSAFQYL.PKLH..TLSLNG.........................................
gi|149773484|ref|NP_065913.1|     ...AGAFADL.RALR..ALHLDS.........................................
gi|16751843|ref|NP_003259.2|      ...SSNFYGL.PKVA..YIDLQK.........................................
gi|139948432|ref|NP_056234.2|     ...DGALRDL.SSLQ..VFKFSY.........................................
gi|90991702|ref|NP_078928.3|      ...PPGFLHL.SKLQ..KLTASK.........................................
gi|153792305|ref|NP_001093148.1|  ...-------.--LL..RLLLPH.........................................
gi|190014581|ref|NP_078788.2|     ...PTYIQLF.QAMR..ILDLPK.........................................
gi|120953300|ref|NP_001073379.1|  ...--ECENL.ENLC..VVLLNK.........................................
gi|306140491|ref|NP_001182035.1|  ...LKTFEFN.KELR..YLDLSN.........................................
gi|306140493|ref|NP_001182036.1|  ...LKTFEFN.KELR..YLDLSN.........................................
gi|62865618|ref|NP_112218.2|      ...LKTFEFN.KELR..YLDLSN.........................................
gi|62865621|ref|NP_001017388.1|   ...LKTFEFN.KELR..YLDLSN.........................................
gi|262205665|ref|NP_001159864.1|  ...AGAFEHL.PSLR..QLDLSH.........................................
gi|5729718|ref|NP_006661.1|       ...AGAFEHL.PSLR..QLDLSH.........................................
gi|126517478|ref|NP_653252.3|     ...RNAFEGL.ENLL..YLYLYK.........................................
gi|306140495|ref|NP_001182037.1|  ...LKTFEFN.KELR..YLDLSN.........................................
gi|72534676|ref|NP_001026862.1|   ...SEAFFGL.NKLT..TLLLQH.........................................
gi|41350337|ref|NP_003254.2|      ...ISVFKFN.QELE..YLDLSH.........................................
gi|52426787|ref|NP_002535.3|      ...HNQLTQY.TNLR..TLDISN.........................................
gi|193788651|ref|NP_001123362.1|  ...CPELCNL.TQLT..TLNLGN.........................................
gi|194306618|ref|NP_001123608.1|  ...-------.----..------.........................................
gi|194306621|ref|NP_001123609.1|  ...-------.----..------.........................................
gi|194306623|ref|NP_001123610.1|  ...-------.----..------.........................................
gi|39930401|ref|NP_065902.1|      ...-------.----..------.........................................
gi|157743290|ref|NP_001099051.1|  ...PPEVGKL.TRIV..VLNLCG.........................................
gi|299782601|ref|NP_001010847.1|  ...EGTFSGS.AKLV..FLDLSY.........................................
gi|341915001|ref|XP_003403925.1|  ...PHAFKNL.MRLK..RLNLVG.........................................
gi|255652962|ref|NP_001157397.1|  ...RSIFGDL.TNLT..ELQLRN.........................................
gi|255652964|ref|NP_001157398.1|  ...RSIFGDL.TNLT..ELQLRN.........................................
gi|84781739|ref|NP_001034118.1|   ...RSIFGDL.TNLT..ELQLRN.........................................
gi|30181233|ref|NP_002310.2|      ...NPALGNL.TALT..YLNLSR.........................................
gi|194394161|ref|NP_694992.2|     ...PDEICNL.KKLE..TLSLNN.........................................
gi|14249428|ref|NP_116162.1|      ...PEAILNL.QALT..FLNISR.........................................
gi|256017174|ref|NP_001157683.1|  ...PEAIVNL.QMLT..YLNLSR.........................................
gi|41582239|ref|NP_958934.1|      ...AGALASL.SHLK..SLDLSH.........................................
gi|5031809|ref|NP_005536.1|       ...AGALASL.SHLK..SLDLSH.........................................
gi|63003903|ref|NP_963844.2|      ...-------.----..-VDLSG.........................................
gi|223005922|ref|NP_001138549.1|  ...PSAVCAL.SRLQ..KLYVSG.........................................
gi|154091020|ref|NP_065922.3|     ...PEAIKNL.QMLT..YLNISR.........................................
gi|33859670|ref|NP_055931.1|      ...PEAIVNL.QMLT..YLNLSR.........................................
gi|8394456|ref|NP_059138.1|       ...PSTFLAV.PTLE..ELNLSY.........................................
gi|256017180|ref|NP_001157685.1|  ...PEAIVNL.QMLT..YLNLSR.........................................
gi|27436867|ref|NP_775101.1|      ...-------.----..------.........................................
gi|296080773|ref|NP_001171678.1|  ...-------.----..------.........................................
gi|296080775|ref|NP_001171679.1|  ...-------.----..------.........................................
gi|34577083|ref|NP_689937.2|      ...-PNIAEL.KNLE..VLNFFN.........................................
gi|167555127|ref|NP_005573.2|     ...EDTFQSH.HQLS..TLVLTG.........................................
gi|33285015|ref|NP_653199.2|      ...PEAIGSL.VKLQ..CLDLSD.........................................
gi|291575177|ref|NP_852111.2|     ...ADVFSNL.PKLH..EIRIEK.........................................
gi|24308207|ref|NP_065761.1|      ...SPELGPL.PALR..VLDLSG.........................................
gi|31657140|ref|NP_055030.1|      ...-------.----..------.........................................
gi|52353306|ref|NP_001005210.1|   ...RGLFLHA.KRLA..HLDLSY.........................................
gi|10190722|ref|NP_065729.1|      ...PGAFHGL.QHLQ..VLNLTQ.........................................
gi|59823631|ref|NP_660333.2|      ...-------.----..------.........................................
gi|40217820|ref|NP_055741.2|      ...-------.----..------.........................................
gi|95113664|ref|NP_060684.4|      ...PQEIGNL.KNLL..CLDVSE.........................................
gi|219521831|ref|NP_001137140.1|  ...TGSFSTT.PNLK..CLDLSS.........................................
gi|32469517|ref|NP_862830.1|      ...TGSFSTT.PNLK..CLDLSS.........................................
gi|21313638|ref|NP_060646.2|      ...-------.----..------.........................................
gi|21389483|ref|NP_653249.1|      ...-SCVSCM.PYLL..ELNASQ.........................................
gi|61742784|ref|NP_665893.2|      ...PAGLSGL.AHLA..HLDLSF.........................................
gi|61742786|ref|NP_665894.2|      ...PAGLSGL.AHLA..HLDLSF.........................................
gi|7706093|ref|NP_057646.1|       ...PRSFSGL.TYLK..SLYLDG.........................................
gi|61966761|ref|NP_001013675.1|   ...-------.----..------.........................................
gi|153791466|ref|NP_065754.2|     ...SEAFSPV.PNLR..YLDLSS.........................................
gi|40217823|ref|NP_056382.1|      ...DRAFGDL.TNLR..RLYLNG.........................................
gi|157694513|ref|NP_060960.2|     ...PQAIKAL.PSLK..ELGFHS.........................................
gi|221136957|ref|NP_001137475.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136961|ref|NP_001137476.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136965|ref|NP_001137477.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136969|ref|NP_001137478.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136977|ref|NP_001137480.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136981|ref|NP_001137481.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136985|ref|NP_001137482.1|  ...TGAFSGL.KTLK..RLHLNN.........................................
gi|33504581|ref|NP_115928.1|      ...TGAFSGL.KTLK..RLHLNN.........................................
gi|221136957|ref|NP_001137475.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|221136961|ref|NP_001137476.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|221136965|ref|NP_001137477.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|221136969|ref|NP_001137478.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|221136977|ref|NP_001137480.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|221136981|ref|NP_001137481.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|221136985|ref|NP_001137482.1|  ...EGAFTNL.TSLR..RLYLNG.........................................
gi|33504581|ref|NP_115928.1|      ...EGAFTNL.TSLR..RLYLNG.........................................
gi|194018474|ref|NP_001005214.2|  ...DYTFIGV.FKLI..YLDLSS.........................................
gi|40217817|ref|NP_443142.1|      ...NNTFKNL.LDLR..WLYMDS.........................................
gi|40217825|ref|NP_115605.2|      ...EGSFMNL.TRLQ..KLYLNG.........................................
gi|291219891|ref|NP_919431.2|     ...LNELQRF.TKLK..SLNLSN.........................................
gi|4826816|ref|NP_005088.1|       ...-------.----..------.........................................
gi|38454322|ref|NP_942015.1|      ...RGVFVNA.SGLR..LLDLSS.........................................
gi|40217817|ref|NP_443142.1|      ...-------.----..------.........................................
gi|164607156|ref|NP_113615.2|     ...-ANLNGL.KNLR..ILSLGR.........................................
gi|191252816|ref|NP_001122108.1|  ...-------.----..------.........................................
gi|40217823|ref|NP_056382.1|      ...-------.----..------.........................................
gi|27436867|ref|NP_775101.1|      ...GGAFLGL.SALK..QLHLNN.........................................
gi|296080773|ref|NP_001171678.1|  ...GGAFLGL.SALK..QLHLNN.........................................
gi|296080775|ref|NP_001171679.1|  ...GGAFLGL.SALK..QLHLNN.........................................
gi|40217825|ref|NP_115605.2|      ...-------.----..------.........................................
gi|21281681|ref|NP_644807.1|      ...-------.----..------.........................................
gi|300934750|ref|NP_116166.9|     ...-------.----..------.........................................
gi|21281673|ref|NP_644813.1|      ...-------.----..------.........................................
gi|66912176|ref|NP_001019782.1|   ...LSPFAYL.HALE..VLNLSN.........................................
gi|301069324|ref|NP_001180264.1|  ...PKAFLTT.KKLR..RLYLSH.........................................
gi|116268101|ref|NP_443138.2|     ...-------.----..------.........................................
gi|318984125|ref|NP_001188295.1|  ...-ANLNGL.KNLR..ILSLGR.........................................
gi|40217820|ref|NP_055741.2|      ...TGAFNGL.KILK..RLYLHE.........................................
gi|312222719|ref|NP_001185947.1|  ...-SGLSTL.RCLR..VLLLGK.........................................
gi|106067657|ref|NP_000224.2|     ...ANAFDNL.LNLS..EILIQN.........................................
gi|206725447|ref|NP_001128689.1|  ...-SPLNYL.THLL..WLKADG.........................................
gi|42542396|ref|NP_964013.1|      ...-SPLNYL.THLL..WLKADG.........................................
gi|15487670|ref|NP_006353.2|      ...-------.----..------.........................................
gi|20143971|ref|NP_006059.2|      ...-------.-NIM..MLTISD.........................................
gi|55743114|ref|NP_060161.2|      ...-SGLSTL.RCLR..VLLLGK.........................................
gi|312222716|ref|NP_001185946.1|  ...-SGLSTL.RCLR..VLLLGK.........................................
gi|193083136|ref|NP_940908.2|     ...-------.----..------.........................................
gi|254039592|ref|NP_116564.2|     ...-------.----..------.........................................
gi|87298937|ref|NP_008949.4|      ...-------.----..------.........................................
gi|13430854|ref|NP_071336.1|      ...-------.----..------.........................................
gi|14277694|ref|NP_060279.2|      ...-------.----..------.........................................
gi|153791282|ref|NP_001093156.1|  ...-------.----..------.........................................
gi|194272226|ref|NP_001123563.1|  ...-EGLENL.AHLV..WLDLSF.........................................
gi|194272228|ref|NP_001123564.1|  ...-EGLENL.AHLV..WLDLSF.........................................
gi|194272222|ref|NP_001123562.1|  ...-EGLENL.AHLV..WLDLSF.........................................
gi|194272224|ref|NP_112584.3|     ...-EGLENL.AHLV..WLDLSF.........................................
gi|62988340|ref|NP_001017924.1|   ...-------.----..------.........................................
gi|68800360|ref|NP_004941.2|      ...EDAFRKL.PQLR..ELVLRD.........................................
gi|167466264|ref|NP_001006940.3|  ...PKCILRL.SDMD..ELDLSR.........................................
gi|31377705|ref|NP_078824.2|      ...-MGVAKL.TLLR..VLNLPH.........................................
gi|21361633|ref|NP_060238.3|      ...-------.--LK..ILDYSD.........................................
gi|122937315|ref|NP_001073929.1|  ...-------.----..-IDASN.........................................
gi|299758423|ref|NP_001177652.1|  ...FGAFATC.KVLQkkVLIVHT.........................................
gi|53729359|ref|NP_612370.3|      ...FGAFATC.KVLQkkVLIVHT.........................................
gi|53729361|ref|NP_001005373.1|   ...FGAFATC.KVLQkkVLIVHT.........................................
gi|53729363|ref|NP_001005374.1|   ...FGAFATC.KVLQkkVLIVHT.........................................
gi|14149694|ref|NP_056428.1|      ...-------.----..------.........................................
gi|45439342|ref|NP_689542.2|      ...PATIGDL.IHLQ..ELNLND.........................................
gi|217330610|ref|NP_001136098.1|  ...SHSFYNL.SKVT..HIEIRN.........................................
gi|288541295|ref|NP_001128529.2|  ...PGAFRNL.GSLR..YLSLAN.........................................
gi|117414162|ref|NP_208325.3|     ...-EAIDHI.WNLQ..HLDLSS.........................................
gi|19743848|ref|NP_598011.1|      ...-------.----..------.........................................
gi|64085121|ref|NP_000360.2|      ...SHSFYNL.SKVT..HIEIRN.........................................
gi|31621309|ref|NP_036604.2|      ...-------.----..------.........................................
gi|64085161|ref|NP_001018046.1|   ...SHSFYNL.SKVT..HIEIRN.........................................
gi|50593002|ref|NP_003081.2|      ...-------.----..------.........................................
gi|5454088|ref|NP_006392.1|       ...-------.----..------.........................................
gi|7657419|ref|NP_055174.1|       ...NDAFRLL.HALQ..DLILPE.........................................
gi|5453880|ref|NP_006296.1|       ...-------.----..------.........................................
gi|45827729|ref|NP_056171.2|      ...PAELGGL.VLLT..DLLLSQ.........................................
gi|45827731|ref|NP_874365.2|      ...PAELGGL.VLLT..DLLLSQ.........................................
gi|306922420|ref|NP_001182457.1|  ...DGAFDGL.PSLA..ALDLSH.........................................
gi|226342933|ref|NP_001139726.1|  ...AGALRPL.RGLH..TLHLYG.........................................
gi|239582714|ref|NP_005815.2|     ...-------.----..------.........................................
gi|125625324|ref|NP_001074960.1|  ...-------.----..------.........................................
gi|54792102|ref|NP_001005915.1|   ...-------.----..------.........................................
gi|39930571|ref|NP_932341.1|      ...-------.----..------.........................................
gi|16751843|ref|NP_003259.2|      ...KEAFRNL.PNLR..ILDLGS.........................................
gi|12597641|ref|NP_075052.1|      ...-------.----..------.........................................
gi|4826651|ref|NP_004919.1|       ...-------.----..------.........................................
gi|15529980|ref|NP_219481.1|      ...-RNLEGL.QNLH..SLYLQG.........................................
gi|40254924|ref|NP_060979.2|      ...PSDFCGL.THLV..KLDLSK.........................................
gi|14916498|ref|NP_148935.1|      ...DGTFSKL.SLLE..ELSLAE.........................................
gi|7661704|ref|NP_054776.1|       ...DGTFSKL.SLLE..ELSLAE.........................................
gi|16418445|ref|NP_443185.1|      ...EHAFKGVaETLQ..TLDLSD.........................................
gi|13569879|ref|NP_112182.1|      ...-------.----..------.........................................
gi|5901898|ref|NP_008923.1|       ...-SPLNYL.THLL..WLKADG.........................................
gi|306966160|ref|NP_001182474.1|  ...GAAFQGLeGTLR..HLDLSA.........................................
gi|194239699|ref|NP_689928.3|     ...SKIVSNV.PQLE..FLNLSS.........................................
gi|194239701|ref|NP_001123519.1|  ...SKIVSNV.PQLE..FLNLSS.........................................
gi|13027616|ref|NP_076431.1|      ...-GCLGEC.LGLE..WLDLSG.........................................
gi|218931217|ref|NP_001136400.1|  ...-GCLGEC.LGLE..WLDLSG.........................................
gi|289547512|ref|NP_055649.4|     ...RHTFEPL.PFLK..FINLSC.........................................
gi|28872863|ref|NP_056270.2|      ...PSDIAKL.HNLV..YLDLSS.........................................
gi|116325993|ref|NP_001006608.2|  ...RHTFEPL.PFLK..FINLSC.........................................
gi|61966709|ref|NP_001013648.1|   ...-ENLRSL.KKLE..KLYLGG.........................................
gi|305632814|ref|NP_001182209.1|  ...-------.----..------.........................................
gi|13562088|ref|NP_112153.1|      ...SATFAGLaGGLR..LLDLSY.........................................
gi|75677612|ref|NP_955372.2|      ...RHTFEPL.PFLK..FINLSC.........................................
gi|53829385|ref|NP_443120.2|      ...RQTFESL.PFLQ..YINLGC.........................................
gi|150378449|ref|NP_892014.1|     ...LEAFHTF.PALK..ELDLAF.........................................
gi|59889558|ref|NP_001012331.1|   ...-------.----..------.........................................
gi|4585712|ref|NP_002520.2|       ...-------.----..------.........................................
gi|19743850|ref|NP_598012.1|      ...NGSLANT.PHLR..ELHLDN.........................................
gi|148664213|ref|NP_001091989.1|  ...-------.----..------.........................................
gi|210147571|ref|NP_001129951.1|  ...-------.----..------.........................................
gi|115583679|ref|NP_653172.2|     ...PPDIAKL.HNLV..YLDLSS.........................................
gi|157785649|ref|NP_001099129.1|  ...-HPLQSC.IKLI..KLDLHG.........................................
gi|288541297|ref|NP_570843.2|     ...PGAFRNL.GSLR..YLSLAN.........................................
gi|46397369|ref|NP_997002.1|      ...-------.----..------.........................................
gi|239735605|ref|NP_060766.5|     ...-KGIQYL.CSLQ..DLNLYY.........................................
gi|33469951|ref|NP_878256.1|      ...-------.----..------.........................................
gi|53828918|ref|NP_004572.3|      ...-------.----..------.........................................
gi|205360954|ref|NP_001009944.2|  ...-------.----..------.........................................
gi|205360962|ref|NP_000287.3|     ...-------.----..------.........................................
gi|38348406|ref|NP_940967.1|      ...---FRNM.ASLR..SLSLEG.........................................
gi|4758460|ref|NP_004479.1|       ...PGTFSDL.IKLK..TLRLSR.........................................
gi|219555702|ref|NP_001137230.1|  ...PSGIGAH.QHLK..TLLLER.........................................
gi|219555704|ref|NP_001137231.1|  ...PSGIGAH.QHLK..TLLLER.........................................
gi|219555700|ref|NP_001137229.1|  ...PSGIGAH.QHLK..TLLLER.........................................
gi|55741567|ref|NP_085129.1|      ...PSGIGAH.QHLK..TLLLER.........................................
gi|62899065|ref|NP_060610.2|      ...-------.----..------.........................................
gi|56118210|ref|NP_001007793.1|   ...-------.----..------.........................................
gi|6912604|ref|NP_036535.1|       ...-------.----..------.........................................
gi|55956794|ref|NP_001007157.1|   ...-------.----..------.........................................
gi|59889560|ref|NP_002521.2|      ...-------.----..------.........................................
gi|59889562|ref|NP_001012338.1|   ...-------.----..------.........................................
gi|4503743|ref|NP_002009.1|       ...PEELAAL.QKLE..HLSVSH.........................................
gi|55770895|ref|NP_001006600.1|   ...PKQLFNC.QSLH..KLSLPD.........................................
gi|226342931|ref|NP_079101.3|     ...HRAFRRL.RALR..SLDLAG.........................................
gi|8923909|ref|NP_061165.1|       ...-------.----..----SH.........................................
gi|20143971|ref|NP_006059.2|      ...LSVFKFN.QDLE..YLDLSH.........................................
gi|14042939|ref|NP_114413.1|      ...-------.----..------.........................................
gi|21071028|ref|NP_036536.2|      ...-------.----..------.........................................
gi|23097240|ref|NP_690852.1|      ...-------.----..------.........................................
gi|65301141|ref|NP_055835.2|      ...IENLEGN.KHIT..HVDLRD.........................................
gi|19743852|ref|NP_598013.1|      ...SSDF---.----..------.........................................
gi|223718151|ref|NP_001138779.1|  ...-------.----..------.........................................
gi|55956790|ref|NP_001007098.1|   ...-------.----..------.........................................
gi|65506779|ref|NP_001018076.1|   ...-------.----..------.........................................
gi|312283627|ref|NP_001186011.1|  ...-------.AHLQ..LLDIAG.........................................
gi|65506769|ref|NP_001018075.1|   ...-------.----..------.........................................
gi|21361306|ref|NP_006171.2|      ...-------.----..------.........................................
gi|65506745|ref|NP_001018074.1|   ...-------.----..------.........................................
gi|291575163|ref|NP_001167575.1|  ...-------.-RLK..ELTLED.........................................
gi|291575165|ref|NP_001167576.1|  ...-------.-RLK..ELTLED.........................................
gi|4557417|ref|NP_000582.1|       ...-------.-RLK..ELTLED.........................................
gi|91105159|ref|NP_001035110.1|   ...-------.-RLK..ELTLED.........................................
gi|4504077|ref|NP_000165.1|       ...-------.----..------.........................................
gi|41327734|ref|NP_958440.1|      ...-------.----..------.........................................
gi|148664188|ref|NP_689972.3|     ...-------.----..------.........................................
gi|4504073|ref|NP_000398.1|       ...-------.----..------.........................................
gi|54607118|ref|NP_056356.2|      ...PSLGAAS.SHVV..SLFLQH.........................................
gi|239582714|ref|NP_005815.2|     ...PGS----.----..------.........................................
gi|7706093|ref|NP_057646.1|       ...-------.----..------.........................................
gi|210147569|ref|NP_001129950.1|  ...-------.----..------.........................................
gi|45593138|ref|NP_660299.2|      ...-------.----..------.........................................
gi|34577057|ref|NP_037412.2|      ...-------.----..------.........................................
gi|19718734|ref|NP_003255.2|      ...-------.----..------.........................................
gi|38202222|ref|NP_938205.1|      ...-------.----..------.........................................
gi|7019383|ref|NP_037413.1|       ...-------.----..------.........................................
gi|8922644|ref|NP_060675.1|       ...-------.----..------.........................................


                                                                                                    
                                                                                                    
d1xkua_                             ................................................................
gi|16904383|ref|NP_065845.1|      ................................................................
gi|110825984|ref|NP_004216.2|     ................................................................
gi|76880480|ref|NP_055632.2|      ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|256217721|ref|NP_001073982.2|  ................................................................
gi|209862903|ref|NP_001129523.1|  ................................................................
gi|42544231|ref|NP_006329.2|      ................................................................
gi|42544233|ref|NP_963924.1|      ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|13194201|ref|NP_075380.1|      ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|19743846|ref|NP_598010.1|      ................................................................
gi|4503271|ref|NP_001911.1|       ................................................................
gi|7662320|ref|NP_055628.1|       ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|157426829|ref|NP_001094861.1|  ................................................................
gi|153791330|ref|NP_065924.3|     ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|52138725|ref|NP_001004432.1|   ................................................................
gi|62912474|ref|NP_001017404.1|   ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|30425563|ref|NP_848665.1|      ................................................................
gi|50263044|ref|NP_116197.4|      ................................................................
gi|156139147|ref|NP_079269.4|     ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|197927168|ref|NP_001128217.1|  ................................................................
gi|122937309|ref|NP_001073926.1|  ................................................................
gi|22749183|ref|NP_689783.1|      ................................................................
gi|7662102|ref|NP_056379.1|       ................................................................
gi|198041768|ref|NP_852607.3|     ................................................................
gi|15029530|ref|NP_071426.1|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|4502403|ref|NP_001702.1|       ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|30425553|ref|NP_848663.1|      ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|153251229|ref|NP_001258.2|     ................................................................
gi|51317373|ref|NP_065980.1|      ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|301069322|ref|NP_060150.4|     ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|153791507|ref|NP_001093130.1|  ................................................................
gi|153792227|ref|NP_060804.3|     ................................................................
gi|153792651|ref|NP_001093128.1|  ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|12007646|ref|NP_072089.1|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|109809759|ref|NP_821079.3|     ................................................................
gi|226342935|ref|NP_001139727.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|4506013|ref|NP_002703.1|       ................................................................
gi|86990456|ref|NP_849161.2|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|187829871|ref|NP_001120716.1|  ................................................................
gi|187829877|ref|NP_001120717.1|  ................................................................
gi|62241040|ref|NP_062540.2|      ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|197333706|ref|NP_001127951.1|  ................................................................
gi|34222199|ref|NP_060573.2|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|85986601|ref|NP_067647.2|      ................................................................
gi|7019381|ref|NP_037363.1|       ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|88702793|ref|NP_612449.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|41349454|ref|NP_958505.1|      ................................................................
gi|4506041|ref|NP_002716.1|       ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|71040111|ref|NP_002014.2|      ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|19923729|ref|NP_115646.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|16418467|ref|NP_443204.1|      ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|4826876|ref|NP_005005.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|18677729|ref|NP_570718.1|      ................................................................
gi|27363458|ref|NP_076941.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|40217803|ref|NP_079337.2|      ................................................................
gi|291190772|ref|NP_000164.5|     ................................................................
gi|171846278|ref|NP_940980.3|     ................................................................
gi|260593673|ref|NP_001159530.1|  ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|308818206|ref|NP_001184225.1|  ................................................................
gi|4505047|ref|NP_002336.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|31542244|ref|NP_689660.2|      ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|46094076|ref|NP_056331.2|      ................................................................
gi|5901992|ref|NP_008966.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|38490688|ref|NP_849144.2|      ................................................................
gi|65301141|ref|NP_055835.2|      hvdlrmnhlktmvienlegnkhithvdlrdnrltdldlsslcsleqlhcgrnqlreltlsgfsl
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|13375646|ref|NP_078785.1|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|229089140|ref|NP_001019849.2|  ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|31657138|ref|NP_000136.2|      ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|188536110|ref|NP_689824.2|     ................................................................
gi|109150416|ref|NP_036425.1|     ................................................................
gi|6912638|ref|NP_036557.1|       ................................................................
gi|55741571|ref|NP_065788.1|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|149773484|ref|NP_065913.1|     ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|139948432|ref|NP_056234.2|     ................................................................
gi|90991702|ref|NP_078928.3|      ................................................................
gi|153792305|ref|NP_001093148.1|  ................................................................
gi|190014581|ref|NP_078788.2|     ................................................................
gi|120953300|ref|NP_001073379.1|  ................................................................
gi|306140491|ref|NP_001182035.1|  ................................................................
gi|306140493|ref|NP_001182036.1|  ................................................................
gi|62865618|ref|NP_112218.2|      ................................................................
gi|62865621|ref|NP_001017388.1|   ................................................................
gi|262205665|ref|NP_001159864.1|  ................................................................
gi|5729718|ref|NP_006661.1|       ................................................................
gi|126517478|ref|NP_653252.3|     ................................................................
gi|306140495|ref|NP_001182037.1|  ................................................................
gi|72534676|ref|NP_001026862.1|   ................................................................
gi|41350337|ref|NP_003254.2|      ................................................................
gi|52426787|ref|NP_002535.3|      ................................................................
gi|193788651|ref|NP_001123362.1|  ................................................................
gi|194306618|ref|NP_001123608.1|  ................................................................
gi|194306621|ref|NP_001123609.1|  ................................................................
gi|194306623|ref|NP_001123610.1|  ................................................................
gi|39930401|ref|NP_065902.1|      ................................................................
gi|157743290|ref|NP_001099051.1|  ................................................................
gi|299782601|ref|NP_001010847.1|  ................................................................
gi|341915001|ref|XP_003403925.1|  ................................................................
gi|255652962|ref|NP_001157397.1|  ................................................................
gi|255652964|ref|NP_001157398.1|  ................................................................
gi|84781739|ref|NP_001034118.1|   ................................................................
gi|30181233|ref|NP_002310.2|      ................................................................
gi|194394161|ref|NP_694992.2|     ................................................................
gi|14249428|ref|NP_116162.1|      ................................................................
gi|256017174|ref|NP_001157683.1|  ................................................................
gi|41582239|ref|NP_958934.1|      ................................................................
gi|5031809|ref|NP_005536.1|       ................................................................
gi|63003903|ref|NP_963844.2|      ................................................................
gi|223005922|ref|NP_001138549.1|  ................................................................
gi|154091020|ref|NP_065922.3|     ................................................................
gi|33859670|ref|NP_055931.1|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|256017180|ref|NP_001157685.1|  ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|34577083|ref|NP_689937.2|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|33285015|ref|NP_653199.2|      ................................................................
gi|291575177|ref|NP_852111.2|     ................................................................
gi|24308207|ref|NP_065761.1|      ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|52353306|ref|NP_001005210.1|   ................................................................
gi|10190722|ref|NP_065729.1|      ................................................................
gi|59823631|ref|NP_660333.2|      ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|219521831|ref|NP_001137140.1|  ................................................................
gi|32469517|ref|NP_862830.1|      ................................................................
gi|21313638|ref|NP_060646.2|      ................................................................
gi|21389483|ref|NP_653249.1|      ................................................................
gi|61742784|ref|NP_665893.2|      ................................................................
gi|61742786|ref|NP_665894.2|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|61966761|ref|NP_001013675.1|   ................................................................
gi|153791466|ref|NP_065754.2|     ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|194018474|ref|NP_001005214.2|  ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|4826816|ref|NP_005088.1|       ................................................................
gi|38454322|ref|NP_942015.1|      ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|164607156|ref|NP_113615.2|     ................................................................
gi|191252816|ref|NP_001122108.1|  ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|21281681|ref|NP_644807.1|      ................................................................
gi|300934750|ref|NP_116166.9|     ................................................................
gi|21281673|ref|NP_644813.1|      ................................................................
gi|66912176|ref|NP_001019782.1|   ................................................................
gi|301069324|ref|NP_001180264.1|  ................................................................
gi|116268101|ref|NP_443138.2|     ................................................................
gi|318984125|ref|NP_001188295.1|  ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|312222719|ref|NP_001185947.1|  ................................................................
gi|106067657|ref|NP_000224.2|     ................................................................
gi|206725447|ref|NP_001128689.1|  ................................................................
gi|42542396|ref|NP_964013.1|      ................................................................
gi|15487670|ref|NP_006353.2|      ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|55743114|ref|NP_060161.2|      ................................................................
gi|312222716|ref|NP_001185946.1|  ................................................................
gi|193083136|ref|NP_940908.2|     ................................................................
gi|254039592|ref|NP_116564.2|     ................................................................
gi|87298937|ref|NP_008949.4|      ................................................................
gi|13430854|ref|NP_071336.1|      ................................................................
gi|14277694|ref|NP_060279.2|      ................................................................
gi|153791282|ref|NP_001093156.1|  ................................................................
gi|194272226|ref|NP_001123563.1|  ................................................................
gi|194272228|ref|NP_001123564.1|  ................................................................
gi|194272222|ref|NP_001123562.1|  ................................................................
gi|194272224|ref|NP_112584.3|     ................................................................
gi|62988340|ref|NP_001017924.1|   ................................................................
gi|68800360|ref|NP_004941.2|      ................................................................
gi|167466264|ref|NP_001006940.3|  ................................................................
gi|31377705|ref|NP_078824.2|      ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|299758423|ref|NP_001177652.1|  ................................................................
gi|53729359|ref|NP_612370.3|      ................................................................
gi|53729361|ref|NP_001005373.1|   ................................................................
gi|53729363|ref|NP_001005374.1|   ................................................................
gi|14149694|ref|NP_056428.1|      ................................................................
gi|45439342|ref|NP_689542.2|      ................................................................
gi|217330610|ref|NP_001136098.1|  ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|117414162|ref|NP_208325.3|     ................................................................
gi|19743848|ref|NP_598011.1|      ................................................................
gi|64085121|ref|NP_000360.2|      ................................................................
gi|31621309|ref|NP_036604.2|      ................................................................
gi|64085161|ref|NP_001018046.1|   ................................................................
gi|50593002|ref|NP_003081.2|      ................................................................
gi|5454088|ref|NP_006392.1|       ................................................................
gi|7657419|ref|NP_055174.1|       ................................................................
gi|5453880|ref|NP_006296.1|       ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|306922420|ref|NP_001182457.1|  ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|125625324|ref|NP_001074960.1|  ................................................................
gi|54792102|ref|NP_001005915.1|   ................................................................
gi|39930571|ref|NP_932341.1|      ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|12597641|ref|NP_075052.1|      ................................................................
gi|4826651|ref|NP_004919.1|       ................................................................
gi|15529980|ref|NP_219481.1|      ................................................................
gi|40254924|ref|NP_060979.2|      ................................................................
gi|14916498|ref|NP_148935.1|      ................................................................
gi|7661704|ref|NP_054776.1|       ................................................................
gi|16418445|ref|NP_443185.1|      ................................................................
gi|13569879|ref|NP_112182.1|      ................................................................
gi|5901898|ref|NP_008923.1|       ................................................................
gi|306966160|ref|NP_001182474.1|  ................................................................
gi|194239699|ref|NP_689928.3|     ................................................................
gi|194239701|ref|NP_001123519.1|  ................................................................
gi|13027616|ref|NP_076431.1|      ................................................................
gi|218931217|ref|NP_001136400.1|  ................................................................
gi|289547512|ref|NP_055649.4|     ................................................................
gi|28872863|ref|NP_056270.2|      ................................................................
gi|116325993|ref|NP_001006608.2|  ................................................................
gi|61966709|ref|NP_001013648.1|   ................................................................
gi|305632814|ref|NP_001182209.1|  ................................................................
gi|13562088|ref|NP_112153.1|      ................................................................
gi|75677612|ref|NP_955372.2|      ................................................................
gi|53829385|ref|NP_443120.2|      ................................................................
gi|150378449|ref|NP_892014.1|     ................................................................
gi|59889558|ref|NP_001012331.1|   ................................................................
gi|4585712|ref|NP_002520.2|       ................................................................
gi|19743850|ref|NP_598012.1|      ................................................................
gi|148664213|ref|NP_001091989.1|  ................................................................
gi|210147571|ref|NP_001129951.1|  ................................................................
gi|115583679|ref|NP_653172.2|     ................................................................
gi|157785649|ref|NP_001099129.1|  ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|46397369|ref|NP_997002.1|      ................................................................
gi|239735605|ref|NP_060766.5|     ................................................................
gi|33469951|ref|NP_878256.1|      ................................................................
gi|53828918|ref|NP_004572.3|      ................................................................
gi|205360954|ref|NP_001009944.2|  ................................................................
gi|205360962|ref|NP_000287.3|     ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|219555702|ref|NP_001137230.1|  ................................................................
gi|219555704|ref|NP_001137231.1|  ................................................................
gi|219555700|ref|NP_001137229.1|  ................................................................
gi|55741567|ref|NP_085129.1|      ................................................................
gi|62899065|ref|NP_060610.2|      ................................................................
gi|56118210|ref|NP_001007793.1|   ................................................................
gi|6912604|ref|NP_036535.1|       ................................................................
gi|55956794|ref|NP_001007157.1|   ................................................................
gi|59889560|ref|NP_002521.2|      ................................................................
gi|59889562|ref|NP_001012338.1|   ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|14042939|ref|NP_114413.1|      ................................................................
gi|21071028|ref|NP_036536.2|      ................................................................
gi|23097240|ref|NP_690852.1|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|19743852|ref|NP_598013.1|      ................................................................
gi|223718151|ref|NP_001138779.1|  ................................................................
gi|55956790|ref|NP_001007098.1|   ................................................................
gi|65506779|ref|NP_001018076.1|   ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|65506769|ref|NP_001018075.1|   ................................................................
gi|21361306|ref|NP_006171.2|      ................................................................
gi|65506745|ref|NP_001018074.1|   ................................................................
gi|291575163|ref|NP_001167575.1|  ................................................................
gi|291575165|ref|NP_001167576.1|  ................................................................
gi|4557417|ref|NP_000582.1|       ................................................................
gi|91105159|ref|NP_001035110.1|   ................................................................
gi|4504077|ref|NP_000165.1|       ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|148664188|ref|NP_689972.3|     ................................................................
gi|4504073|ref|NP_000398.1|       ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|210147569|ref|NP_001129950.1|  ................................................................
gi|45593138|ref|NP_660299.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|8922644|ref|NP_060675.1|       ................................................................


                                                                                          90        
                                                                                           |        
d1xkua_                             ....................................................N..QL...KELP
gi|16904383|ref|NP_065845.1|      ....................................................N..EF...GELP
gi|110825984|ref|NP_004216.2|     ....................................................N..QL...PALP
gi|76880480|ref|NP_055632.2|      ....................................................N..AL...GALP
gi|288541297|ref|NP_570843.2|     ....................................................N..QI...GLLS
gi|256217721|ref|NP_001073982.2|  ....................................................N..AL...SGLP
gi|209862903|ref|NP_001129523.1|  ....................................................N..KI...KNVD
gi|42544231|ref|NP_006329.2|      ....................................................N..LL...RAID
gi|42544233|ref|NP_963924.1|      ....................................................N..LL...RAID
gi|288541295|ref|NP_001128529.2|  ....................................................N..QI...GLLS
gi|54607118|ref|NP_056356.2|      ....................................................N..RI...RLIE
gi|55770895|ref|NP_001006600.1|   ....................................................N..RL...TFIP
gi|13194201|ref|NP_075380.1|      ....................................................N..A-...----
gi|8923909|ref|NP_061165.1|       ....................................................N..RL...TFIP
gi|19743846|ref|NP_598010.1|      ....................................................N..QL...KELP
gi|4503271|ref|NP_001911.1|       ....................................................N..QL...KELP
gi|7662320|ref|NP_055628.1|       ....................................................N..GI...SKLK
gi|238908508|ref|NP_001155000.1|  ....................................................N..YI...SEIP
gi|11321571|ref|NP_003053.1|      ....................................................N..KL...QVLP
gi|188528675|ref|NP_003052.2|     ....................................................N..QL...HMLP
gi|4759146|ref|NP_004778.1|       ....................................................N..HL...QLFP
gi|157694513|ref|NP_060960.2|     ....................................................N..QL...KTVP
gi|157426829|ref|NP_001094861.1|  ....................................................N..QL...KLIP
gi|153791330|ref|NP_065924.3|     ....................................................N..KL...KVID
gi|41281398|ref|NP_031399.2|      ....................................................N..RI...TTVE
gi|52138725|ref|NP_001004432.1|   ....................................................N..RL...RIMG
gi|62912474|ref|NP_001017404.1|   ....................................................N..KL...QEFP
gi|21361633|ref|NP_060238.3|      ....................................................N..EL...TCIS
gi|30425563|ref|NP_848665.1|      ....................................................N..R-...----
gi|50263044|ref|NP_116197.4|      ....................................................N..RL...KLIP
gi|156139147|ref|NP_079269.4|     ....................................................N..KI...TYLH
gi|4758460|ref|NP_004479.1|       ....................................................N..RL...VSLD
gi|197927168|ref|NP_001128217.1|  ....................................................N..KI...TYLH
gi|122937309|ref|NP_001073926.1|  ....................................................N..RL...TTVP
gi|22749183|ref|NP_689783.1|      ....................................................N..RL...KLVP
gi|7662102|ref|NP_056379.1|       ....................................................N..KI...FYLP
gi|198041768|ref|NP_852607.3|     ....................................................N..QV...SFVP
gi|15029530|ref|NP_071426.1|      ....................................................N..WL...TVIP
gi|194440719|ref|NP_612490.1|     ....................................................N..HL...RELP
gi|4502403|ref|NP_001702.1|       ....................................................N..HL...VEIP
gi|62912470|ref|NP_001017403.1|   ....................................................N..QL...GGIP
gi|30425553|ref|NP_848663.1|      ....................................................N..R-...----
gi|4504379|ref|NP_003658.1|       ....................................................N..QL...RHVP
gi|153251229|ref|NP_001258.2|     ....................................................N..DI...RVLR
gi|51317373|ref|NP_065980.1|      ....................................................N..RL...TTIP
gi|4503743|ref|NP_002009.1|       ....................................................N..PLlh.AQLR
gi|301069322|ref|NP_060150.4|     ....................................................N..QL...SEIP
gi|188528675|ref|NP_003052.2|     ....................................................N..QL...ESIR
gi|153791507|ref|NP_001093130.1|  ....................................................N..RL...QMIN
gi|153792227|ref|NP_060804.3|     ....................................................N..RL...QMIN
gi|153792651|ref|NP_001093128.1|  ....................................................N..RL...QMIN
gi|238908508|ref|NP_001155000.1|  ....................................................N..YI...ENFP
gi|12007646|ref|NP_072089.1|      ....................................................C..RL...FSVP
gi|4826772|ref|NP_004961.1|       ....................................................N..QL...RSLA
gi|225579152|ref|NP_001139478.1|  ....................................................N..QL...RSLA
gi|109809759|ref|NP_821079.3|     ....................................................N..RI...SYFL
gi|226342935|ref|NP_001139727.1|  ....................................................NknNLi..SKVP
gi|40255157|ref|NP_700356.2|      ....................................................N..GV...TKLM
gi|4506013|ref|NP_002703.1|       ....................................................N..LL...RNIE
gi|86990456|ref|NP_849161.2|      ....................................................N..QI...TQLP
gi|194440719|ref|NP_612490.1|     ....................................................N..QL...AGLS
gi|45505137|ref|NP_714914.2|      ....................................................N..KL...TLAP
gi|187829871|ref|NP_001120716.1|  ....................................................N..-L...SKLP
gi|187829877|ref|NP_001120717.1|  ....................................................N..-L...SKLP
gi|62241040|ref|NP_062540.2|      ....................................................N..-L...SKLP
gi|225579152|ref|NP_001139478.1|  ....................................................N..QL...QEVK
gi|45827729|ref|NP_056171.2|      ....................................................N..DI...PEIP
gi|45827731|ref|NP_874365.2|      ....................................................N..DI...PEIP
gi|122937315|ref|NP_001073929.1|  ....................................................N..RL...EKVP
gi|197333706|ref|NP_001127951.1|  ....................................................N..-L...TKVP
gi|34222199|ref|NP_060573.2|      ....................................................N..-L...TKVP
gi|4826772|ref|NP_004961.1|       ....................................................N..QL...QEVK
gi|85986601|ref|NP_067647.2|      ....................................................N..RI...TFLK
gi|7019381|ref|NP_037363.1|       ....................................................N..HL...SSVP
gi|119395738|ref|NP_001073285.1|  ....................................................-..--...----
gi|119395736|ref|NP_000199.2|     ....................................................-..--...----
gi|62912472|ref|NP_067649.2|      ....................................................N..QL...GGIP
gi|88702793|ref|NP_612449.2|      ....................................................N..RL...HEIT
gi|4557665|ref|NP_000866.1|       ....................................................-..--...----
gi|41349454|ref|NP_958505.1|      ....................................................N..QL...EEVP
gi|4506041|ref|NP_002716.1|       ....................................................N..QL...EEVP
gi|38202222|ref|NP_938205.1|      ....................................................N..HL...STIP
gi|7019383|ref|NP_037413.1|       ....................................................N..HL...STIP
gi|312283621|ref|NP_001186009.1|  ....................................................N..KL...TLAP
gi|312283625|ref|NP_001186010.1|  ....................................................N..KL...TLAP
gi|71040111|ref|NP_002014.2|      ....................................................N..NL...TRMP
gi|312283627|ref|NP_001186011.1|  ....................................................N..NL...SRVP
gi|19923729|ref|NP_115646.2|      ....................................................T..KL...VMLN
gi|95113664|ref|NP_060684.4|      ....................................................N..EI...PEIP
gi|16418467|ref|NP_443204.1|      ....................................................N..AL...TGLP
gi|11321571|ref|NP_003053.1|      ....................................................N..QL...ETVH
gi|226342933|ref|NP_001139726.1|  ....................................................N..KL...SVAP
gi|4826876|ref|NP_005005.1|       ....................................................N..NL...EEFP
gi|54792100|ref|NP_001973.2|      ....................................................-..--...----
gi|18677729|ref|NP_570718.1|      ....................................................N..CI...TTLR
gi|27363458|ref|NP_076941.2|      ....................................................N..RL...VELG
gi|34577057|ref|NP_037412.2|      ....................................................N..HL...SSIP
gi|8394456|ref|NP_059138.1|       ....................................................NsqPF...GMQG
gi|40217803|ref|NP_079337.2|      ....................................................N..HL...RSIE
gi|291190772|ref|NP_000164.5|     ....................................................-..--...----
gi|171846278|ref|NP_940980.3|     ....................................................N..QL...SFVP
gi|260593673|ref|NP_001159530.1|  ....................................................N..CI...TTLR
gi|45505137|ref|NP_714914.2|      ....................................................N..RL...HTLP
gi|308818206|ref|NP_001184225.1|  ....................................................N..NL...IQIP
gi|4505047|ref|NP_002336.1|       ....................................................N..NL...TESV
gi|312283621|ref|NP_001186009.1|  ....................................................N..RL...HTLP
gi|312283625|ref|NP_001186010.1|  ....................................................N..RL...HTLP
gi|41327732|ref|NP_958439.1|      ....................................................-..--...----
gi|41327736|ref|NP_958441.1|      ....................................................-..--...----
gi|7706093|ref|NP_057646.1|       ....................................................N..SH...YFQS
gi|29725609|ref|NP_005219.2|      ....................................................-..--...----
gi|31542244|ref|NP_689660.2|      ....................................................N..--...----
gi|110825958|ref|NP_001036064.1|  ....................................................-..--...----
gi|4885215|ref|NP_005226.1|       ....................................................-..--...----
gi|46094076|ref|NP_056331.2|      ....................................................N..GL...TALP
gi|5901992|ref|NP_008966.1|       ....................................................N..EL...EEVP
gi|54792100|ref|NP_001973.2|      ....................................................-..--...----
gi|4759146|ref|NP_004778.1|       ....................................................N..RL...ENVQ
gi|4507531|ref|NP_003256.1|       ....................................................N..EIg..QELT
gi|38490688|ref|NP_849144.2|      ....................................................N..--...----
gi|65301141|ref|NP_055835.2|      rtlyassnrltavnvypvpslltfldlsrnllecvpdwaceakkievldvsyN..LL...TEVP
gi|193083139|ref|NP_001122394.1|  ....................................................N..RLamaTALS
gi|5031707|ref|NP_005503.1|       ....................................................N..RLamaTALS
gi|4885215|ref|NP_005226.1|       ....................................................-..NL...VTIG
gi|110825958|ref|NP_001036064.1|  ....................................................-..NL...VTIG
gi|291219891|ref|NP_919431.2|     ....................................................N..QI...CELP
gi|20302168|ref|NP_619542.1|      ....................................................N..SHy..FRIA
gi|4507531|ref|NP_003256.1|       ....................................................N..EL...SQLS
gi|13375646|ref|NP_078785.1|      ....................................................N..--...----
gi|167555127|ref|NP_005573.2|     ....................................................N..DI...EASD
gi|31657140|ref|NP_055030.1|      ....................................................-..--...----
gi|41327734|ref|NP_958440.1|      ....................................................-..--...----
gi|229089140|ref|NP_001019849.2|  ....................................................N..--...----
gi|119395738|ref|NP_001073285.1|  ....................................................T..RP...EDFR
gi|119395736|ref|NP_000199.2|     ....................................................T..RP...EDFR
gi|31657138|ref|NP_000136.2|      ....................................................A..--...----
gi|41327732|ref|NP_958439.1|      ....................................................-..--...----
gi|41327736|ref|NP_958441.1|      ....................................................-..--...----
gi|29725609|ref|NP_005219.2|      ....................................................-..--...----
gi|188536110|ref|NP_689824.2|     ....................................................N..QL...AALP
gi|109150416|ref|NP_036425.1|     ....................................................N..EI...QSID
gi|6912638|ref|NP_036557.1|       ....................................................N..QI...EELP
gi|55741571|ref|NP_065788.1|      ....................................................N..--...----
gi|193083139|ref|NP_001122394.1|  ....................................................N..AL...ETLE
gi|5031707|ref|NP_005503.1|       ....................................................N..AL...ETLE
gi|41281398|ref|NP_031399.2|      ....................................................N..QL...TSLP
gi|54792096|ref|NP_004439.2|      ....................................................-..--...----
gi|4557665|ref|NP_000866.1|       ....................................................-..--...----
gi|54792098|ref|NP_001005862.1|   ....................................................-..--...----
gi|54792096|ref|NP_004439.2|      ....................................................-..--...----
gi|54792098|ref|NP_001005862.1|   ....................................................-..--...----
gi|62912472|ref|NP_067649.2|      ....................................................Am.DI...QEFP
gi|149773484|ref|NP_065913.1|     ....................................................N..--...----
gi|16751843|ref|NP_003259.2|      ....................................................N..HI...AIIQ
gi|139948432|ref|NP_056234.2|     ....................................................N..KL...RVIT
gi|90991702|ref|NP_078928.3|      ....................................................N..CL...EKLF
gi|153792305|ref|NP_001093148.1|  ....................................................N..RL...VSLP
gi|190014581|ref|NP_078788.2|     ....................................................N..QI...SHLP
gi|120953300|ref|NP_001073379.1|  ....................................................N..QL...TSLH
gi|306140491|ref|NP_001182035.1|  ....................................................N..RL...KSVT
gi|306140493|ref|NP_001182036.1|  ....................................................N..RL...KSVT
gi|62865618|ref|NP_112218.2|      ....................................................N..RL...KSVT
gi|62865621|ref|NP_001017388.1|   ....................................................N..RL...KSVT
gi|262205665|ref|NP_001159864.1|  ....................................................N..PL...ADLS
gi|5729718|ref|NP_006661.1|       ....................................................N..PL...ADLS
gi|126517478|ref|NP_653252.3|     ....................................................N..EI...HALD
gi|306140495|ref|NP_001182037.1|  ....................................................N..RL...KSVT
gi|72534676|ref|NP_001026862.1|   ....................................................N..QI...KVLT
gi|41350337|ref|NP_003254.2|      ....................................................N..KL...VKIS
gi|52426787|ref|NP_002535.3|      ....................................................N..RL...ESLP
gi|193788651|ref|NP_001123362.1|  ....................................................N..LL...EEVP
gi|194306618|ref|NP_001123608.1|  ....................................................-..--...----
gi|194306621|ref|NP_001123609.1|  ....................................................-..--...----
gi|194306623|ref|NP_001123610.1|  ....................................................-..--...----
gi|39930401|ref|NP_065902.1|      ....................................................-..--...----
gi|157743290|ref|NP_001099051.1|  ....................................................N..RL...KSLP
gi|299782601|ref|NP_001010847.1|  ....................................................N..NL...TQLG
gi|341915001|ref|XP_003403925.1|  ....................................................N..SL...TTVP
gi|255652962|ref|NP_001157397.1|  ....................................................N..SI...RTLD
gi|255652964|ref|NP_001157398.1|  ....................................................N..SI...RTLD
gi|84781739|ref|NP_001034118.1|   ....................................................N..SI...RTLD
gi|30181233|ref|NP_002310.2|      ....................................................N..QL...SLLP
gi|194394161|ref|NP_694992.2|     ....................................................N..--...----
gi|14249428|ref|NP_116162.1|      ....................................................N..QL...STLP
gi|256017174|ref|NP_001157683.1|  ....................................................N..QL...SALP
gi|41582239|ref|NP_958934.1|      ....................................................-..--...----
gi|5031809|ref|NP_005536.1|       ....................................................-..--...----
gi|63003903|ref|NP_963844.2|      ....................................................S..QL...RRFP
gi|223005922|ref|NP_001138549.1|  ....................................................T..GL...RELP
gi|154091020|ref|NP_065922.3|     ....................................................N..LL...STLP
gi|33859670|ref|NP_055931.1|      ....................................................N..QL...SALP
gi|8394456|ref|NP_059138.1|       ....................................................N..NI...MTVP
gi|256017180|ref|NP_001157685.1|  ....................................................N..QL...SALP
gi|27436867|ref|NP_775101.1|      ....................................................-..--...----
gi|296080773|ref|NP_001171678.1|  ....................................................-..--...----
gi|296080775|ref|NP_001171679.1|  ....................................................-..--...----
gi|34577083|ref|NP_689937.2|      ....................................................N..QI...EELP
gi|167555127|ref|NP_005573.2|     ....................................................N..PL...IFMA
gi|33285015|ref|NP_653199.2|      ....................................................N..AL...----
gi|291575177|ref|NP_852111.2|     ....................................................A..--...----
gi|24308207|ref|NP_065761.1|      ....................................................N..AL...EALP
gi|31657140|ref|NP_055030.1|      ....................................................-..--...----
gi|52353306|ref|NP_001005210.1|   ....................................................N..NF...SHVP
gi|10190722|ref|NP_065729.1|      ....................................................N..SL...LSLE
gi|59823631|ref|NP_660333.2|      ....................................................-..--...----
gi|40217820|ref|NP_055741.2|      ....................................................-..--...----
gi|95113664|ref|NP_060684.4|      ....................................................N..RL...ERLP
gi|219521831|ref|NP_001137140.1|  ....................................................N..--...----
gi|32469517|ref|NP_862830.1|      ....................................................N..--...----
gi|21313638|ref|NP_060646.2|      ....................................................-..--...----
gi|21389483|ref|NP_653249.1|      ....................................................N..NL...TTFF
gi|61742784|ref|NP_665893.2|      ....................................................N..SL...ETLP
gi|61742786|ref|NP_665894.2|      ....................................................N..SL...ETLP
gi|7706093|ref|NP_057646.1|       ....................................................N..QL...LEIP
gi|61966761|ref|NP_001013675.1|   ....................................................-..--...----
gi|153791466|ref|NP_065754.2|     ....................................................N..--...----
gi|40217823|ref|NP_056382.1|      ....................................................N..--...----
gi|157694513|ref|NP_060960.2|     ....................................................N..SI...SVIP
gi|221136957|ref|NP_001137475.1|  ....................................................N..KL...EILR
gi|221136961|ref|NP_001137476.1|  ....................................................N..KL...EILR
gi|221136965|ref|NP_001137477.1|  ....................................................N..KL...EILR
gi|221136969|ref|NP_001137478.1|  ....................................................N..KL...EILR
gi|221136977|ref|NP_001137480.1|  ....................................................N..KL...EILR
gi|221136981|ref|NP_001137481.1|  ....................................................N..KL...EILR
gi|221136985|ref|NP_001137482.1|  ....................................................N..KL...EILR
gi|33504581|ref|NP_115928.1|      ....................................................N..KL...EILR
gi|221136957|ref|NP_001137475.1|  ....................................................N..--...----
gi|221136961|ref|NP_001137476.1|  ....................................................N..--...----
gi|221136965|ref|NP_001137477.1|  ....................................................N..--...----
gi|221136969|ref|NP_001137478.1|  ....................................................N..--...----
gi|221136977|ref|NP_001137480.1|  ....................................................N..--...----
gi|221136981|ref|NP_001137481.1|  ....................................................N..--...----
gi|221136985|ref|NP_001137482.1|  ....................................................N..--...----
gi|33504581|ref|NP_115928.1|      ....................................................N..--...----
gi|194018474|ref|NP_001005214.2|  ....................................................N..NL...TSIS
gi|40217817|ref|NP_443142.1|      ....................................................N..--...----
gi|40217825|ref|NP_115605.2|      ....................................................N..HL...TKLS
gi|291219891|ref|NP_919431.2|     ....................................................N..HL...GDFP
gi|4826816|ref|NP_005088.1|       ....................................................-..--...----
gi|38454322|ref|NP_942015.1|      ....................................................N..--...----
gi|40217817|ref|NP_443142.1|      ....................................................-..--...TSLQ
gi|164607156|ref|NP_113615.2|     ....................................................N..NI...KNLN
gi|191252816|ref|NP_001122108.1|  ....................................................-..--...----
gi|40217823|ref|NP_056382.1|      ....................................................-..--...----
gi|27436867|ref|NP_775101.1|      ....................................................N..EL...KILR
gi|296080773|ref|NP_001171678.1|  ....................................................N..EL...KILR
gi|296080775|ref|NP_001171679.1|  ....................................................N..EL...KILR
gi|40217825|ref|NP_115605.2|      ....................................................-..--...----
gi|21281681|ref|NP_644807.1|      ....................................................-..--...----
gi|300934750|ref|NP_116166.9|     ....................................................-..--...----
gi|21281673|ref|NP_644813.1|      ....................................................-..--...----
gi|66912176|ref|NP_001019782.1|   ....................................................N..AI...HSLS
gi|301069324|ref|NP_001180264.1|  ....................................................N..QL...SEIP
gi|116268101|ref|NP_443138.2|     ....................................................-..--...----
gi|318984125|ref|NP_001188295.1|  ....................................................N..NI...KNLN
gi|40217820|ref|NP_055741.2|      ....................................................N..KL...DVFR
gi|312222719|ref|NP_001185947.1|  ....................................................N..RI...KKIS
gi|106067657|ref|NP_000224.2|     ....................................................T..K-...----
gi|206725447|ref|NP_001128689.1|  ....................................................N..RL...RSAQ
gi|42542396|ref|NP_964013.1|      ....................................................N..RL...RSAQ
gi|15487670|ref|NP_006353.2|      ....................................................-..--...----
gi|20143971|ref|NP_006059.2|      ....................................................T..PFi..HMLC
gi|55743114|ref|NP_060161.2|      ....................................................N..RI...KKIS
gi|312222716|ref|NP_001185946.1|  ....................................................N..RI...KKIS
gi|193083136|ref|NP_940908.2|     ....................................................-..--...----
gi|254039592|ref|NP_116564.2|     ....................................................-..--...----
gi|87298937|ref|NP_008949.4|      ....................................................-..--...----
gi|13430854|ref|NP_071336.1|      ....................................................-..--...----
gi|14277694|ref|NP_060279.2|      ....................................................-..--...----
gi|153791282|ref|NP_001093156.1|  ....................................................-..--...----
gi|194272226|ref|NP_001123563.1|  ....................................................N..NI...ETIE
gi|194272228|ref|NP_001123564.1|  ....................................................N..NI...ETIE
gi|194272222|ref|NP_001123562.1|  ....................................................N..NI...ETIE
gi|194272224|ref|NP_112584.3|     ....................................................N..NI...ETIE
gi|62988340|ref|NP_001017924.1|   ....................................................-..SL...GKIP
gi|68800360|ref|NP_004941.2|      ....................................................N..KI...RQLP
gi|167466264|ref|NP_001006940.3|  ....................................................N..LI...RKIP
gi|31377705|ref|NP_078824.2|      ....................................................N..SI...GCVE
gi|21361633|ref|NP_060238.3|      ....................................................K..QA...TLIP
gi|122937315|ref|NP_001073929.1|  ....................................................Q..SL...TAIP
gi|299758423|ref|NP_001177652.1|  ....................................................N..HLt..SLLP
gi|53729359|ref|NP_612370.3|      ....................................................N..HLt..SLLP
gi|53729361|ref|NP_001005373.1|   ....................................................N..HLt..SLLP
gi|53729363|ref|NP_001005374.1|   ....................................................N..HLt..SLLP
gi|14149694|ref|NP_056428.1|      ....................................................-..--...----
gi|45439342|ref|NP_689542.2|      ....................................................N..HL...ESFS
gi|217330610|ref|NP_001136098.1|  ....................................................T..R-...----
gi|288541295|ref|NP_001128529.2|  ....................................................N..KL...QVLP
gi|117414162|ref|NP_208325.3|     ....................................................N..QI...SRIE
gi|19743848|ref|NP_598011.1|      ....................................................-..--...----
gi|64085121|ref|NP_000360.2|      ....................................................T..R-...----
gi|31621309|ref|NP_036604.2|      ....................................................-..--...----
gi|64085161|ref|NP_001018046.1|   ....................................................T..R-...----
gi|50593002|ref|NP_003081.2|      ....................................................-..--...----
gi|5454088|ref|NP_006392.1|       ....................................................-..--...----
gi|7657419|ref|NP_055174.1|       ....................................................N..QL...EALP
gi|5453880|ref|NP_006296.1|       ....................................................-..--...----
gi|45827729|ref|NP_056171.2|      ....................................................N..LL...RRLP
gi|45827731|ref|NP_874365.2|      ....................................................N..LL...RRLP
gi|306922420|ref|NP_001182457.1|  ....................................................N..--...----
gi|226342933|ref|NP_001139726.1|  ....................................................N..GL...DRVP
gi|239582714|ref|NP_005815.2|     ....................................................-..--...----
gi|125625324|ref|NP_001074960.1|  ....................................................-..--...----
gi|54792102|ref|NP_001005915.1|   ....................................................-..--...----
gi|39930571|ref|NP_932341.1|      ....................................................-..--...----
gi|16751843|ref|NP_003259.2|      ....................................................S..--...----
gi|12597641|ref|NP_075052.1|      ....................................................-..--...----
gi|4826651|ref|NP_004919.1|       ....................................................-..--...----
gi|15529980|ref|NP_219481.1|      ....................................................N..KI...QQIE
gi|40254924|ref|NP_060979.2|      ....................................................N..KL...QQLP
gi|14916498|ref|NP_148935.1|      ....................................................N..QL...LKLP
gi|7661704|ref|NP_054776.1|       ....................................................N..QL...LKLP
gi|16418445|ref|NP_443185.1|      ....................................................N..RI...QSVH
gi|13569879|ref|NP_112182.1|      ....................................................-..--...----
gi|5901898|ref|NP_008923.1|       ....................................................N..RL...RSAQ
gi|306966160|ref|NP_001182474.1|  ....................................................N..QL...ASVP
gi|194239699|ref|NP_689928.3|     ....................................................-..--...----
gi|194239701|ref|NP_001123519.1|  ....................................................-..--...----
gi|13027616|ref|NP_076431.1|      ....................................................N..AL...THLG
gi|218931217|ref|NP_001136400.1|  ....................................................N..AL...THLG
gi|289547512|ref|NP_055649.4|     ....................................................N..VI...TELS
gi|28872863|ref|NP_056270.2|      ....................................................N..KI...RSLP
gi|116325993|ref|NP_001006608.2|  ....................................................N..VI...TELS
gi|61966709|ref|NP_001013648.1|   ....................................................N..--...----
gi|305632814|ref|NP_001182209.1|  ....................................................-..--...----
gi|13562088|ref|NP_112153.1|      ....................................................N..RI...QRIP
gi|75677612|ref|NP_955372.2|      ....................................................N..VI...TELS
gi|53829385|ref|NP_443120.2|      ....................................................N..LI...TKLS
gi|150378449|ref|NP_892014.1|     ....................................................N..GI...KTIY
gi|59889558|ref|NP_001012331.1|   ....................................................-..--...----
gi|4585712|ref|NP_002520.2|       ....................................................-..--...----
gi|19743850|ref|NP_598012.1|      ....................................................N..KL...TRVP
gi|148664213|ref|NP_001091989.1|  ....................................................-..--...----
gi|210147571|ref|NP_001129951.1|  ....................................................-..--...----
gi|115583679|ref|NP_653172.2|     ....................................................N..KL...RSLP
gi|157785649|ref|NP_001099129.1|  ....................................................N..QI...KSLP
gi|288541297|ref|NP_570843.2|     ....................................................N..KL...QVLP
gi|46397369|ref|NP_997002.1|      ....................................................-..--...----
gi|239735605|ref|NP_060766.5|     ....................................................N..--...----
gi|33469951|ref|NP_878256.1|      ....................................................-..--...----
gi|53828918|ref|NP_004572.3|      ....................................................-..--...----
gi|205360954|ref|NP_001009944.2|  ....................................................-..--...----
gi|205360962|ref|NP_000287.3|     ....................................................-..--...----
gi|38348406|ref|NP_940967.1|      ....................................................C..GL...GALP
gi|4758460|ref|NP_004479.1|       ....................................................N..KI...THLP
gi|219555702|ref|NP_001137230.1|  ....................................................N..PI...KMLP
gi|219555704|ref|NP_001137231.1|  ....................................................N..PI...KMLP
gi|219555700|ref|NP_001137229.1|  ....................................................N..PI...KMLP
gi|55741567|ref|NP_085129.1|      ....................................................N..PI...KMLP
gi|62899065|ref|NP_060610.2|      ....................................................-..--...----
gi|56118210|ref|NP_001007793.1|   ....................................................-..--...----
gi|6912604|ref|NP_036535.1|       ....................................................-..--...----
gi|55956794|ref|NP_001007157.1|   ....................................................-..--...----
gi|59889560|ref|NP_002521.2|      ....................................................-..--...----
gi|59889562|ref|NP_001012338.1|   ....................................................-..--...----
gi|4503743|ref|NP_002009.1|       ....................................................N..--...----
gi|55770895|ref|NP_001006600.1|   ....................................................N..--...----
gi|226342931|ref|NP_079101.3|     ....................................................N..QL...TRLP
gi|8923909|ref|NP_061165.1|       ....................................................C..SL...EQVP
gi|20143971|ref|NP_006059.2|      ....................................................N..QL...QKIS
gi|14042939|ref|NP_114413.1|      ....................................................-..--...----
gi|21071028|ref|NP_036536.2|      ....................................................-..--...----
gi|23097240|ref|NP_690852.1|      ....................................................-..--...----
gi|65301141|ref|NP_055835.2|      ....................................................N..RL...TDLD
gi|19743852|ref|NP_598013.1|      ....................................................-..--...----
gi|223718151|ref|NP_001138779.1|  ....................................................-..--...----
gi|55956790|ref|NP_001007098.1|   ....................................................-..--...----
gi|65506779|ref|NP_001018076.1|   ....................................................-..--...----
gi|312283627|ref|NP_001186011.1|  ....................................................N..QL...TEIP
gi|65506769|ref|NP_001018075.1|   ....................................................-..--...----
gi|21361306|ref|NP_006171.2|      ....................................................-..--...----
gi|65506745|ref|NP_001018074.1|   ....................................................-..--...----
gi|291575163|ref|NP_001167575.1|  ....................................................L..KIt..GTMP
gi|291575165|ref|NP_001167576.1|  ....................................................L..KIt..GTMP
gi|4557417|ref|NP_000582.1|       ....................................................L..KIt..GTMP
gi|91105159|ref|NP_001035110.1|   ....................................................L..KIt..GTMP
gi|4504077|ref|NP_000165.1|       ....................................................-..--...----
gi|41327734|ref|NP_958440.1|      ....................................................-..--...----
gi|148664188|ref|NP_689972.3|     ....................................................-..--...----
gi|4504073|ref|NP_000398.1|       ....................................................-..--...----
gi|54607118|ref|NP_056356.2|      ....................................................N..KI...RS--
gi|239582714|ref|NP_005815.2|     ....................................................-..--...----
gi|7706093|ref|NP_057646.1|       ....................................................-..--...----
gi|210147569|ref|NP_001129950.1|  ....................................................-..--...----
gi|45593138|ref|NP_660299.2|      ....................................................-..--...----
gi|34577057|ref|NP_037412.2|      ....................................................-..--...----
gi|19718734|ref|NP_003255.2|      ....................................................-..--...----
gi|38202222|ref|NP_938205.1|      ....................................................-..--...----
gi|7019383|ref|NP_037413.1|       ....................................................-..--...----
gi|8922644|ref|NP_060675.1|       ....................................................-..--...----


                                                100                               110               
                                                  |                                 |               
d1xkua_                             EKMP..........KTLQELRVHE........................N..EITKVR.K.....
gi|16904383|ref|NP_065845.1|      EVLDqi........QNLRELWMDN........................N..ALQVL-.P.....
gi|110825984|ref|NP_004216.2|     AQLGal........AHLEELDVSF........................N..RLAHL-.P.....
gi|76880480|ref|NP_055632.2|      DAVFapl.......GNLLYLHLES........................N..RIRFLG.K.....
gi|288541297|ref|NP_570843.2|     PGLFhnn.......HNLQRLYLSN........................N..HISQLP.P.....
gi|256217721|ref|NP_001073982.2|  QGVFgkl.......GSLQELFLDS........................N..NISELP.P.....
gi|209862903|ref|NP_001129523.1|  GLTFqgl.......GALKSLKMQR........................N..GVTKLM.D.....
gi|42544231|ref|NP_006329.2|      SRWFeml.......PNLEILMIGG........................N..KVDAIL.D.....
gi|42544233|ref|NP_963924.1|      SRWFeml.......PNLEILMIGG........................N..KVDAIL.D.....
gi|288541295|ref|NP_001128529.2|  PGLFhnn.......HNLQRLYLSN........................N..HISQLP.P.....
gi|54607118|ref|NP_056356.2|      GLTFqgl.......NSLEVLKLQR........................N..NISKLT.D.....
gi|55770895|ref|NP_001006600.1|   GFIGsl........KQLTYLDVSK........................N..NIEMV-.E.....
gi|13194201|ref|NP_075380.1|      ----..........----------........................-..QLRSVD.P.....
gi|8923909|ref|NP_061165.1|       GFIGsl........KQLTYLDVSK........................N..NIEMV-.E.....
gi|19743846|ref|NP_598010.1|      EKMP..........KTLQELRAHE........................N..EITKVR.K.....
gi|4503271|ref|NP_001911.1|       EKMP..........KTLQELRAHE........................N..EITKVR.K.....
gi|7662320|ref|NP_055628.1|       DGAFfgl.......NNMEELELEH........................N..NLTRVN.K.....
gi|238908508|ref|NP_001155000.1|  VDISfs........KQLLHLELSE........................N..KLLIF-.S.....
gi|11321571|ref|NP_003053.1|      ELLFqst.......PKLTRLDLSE........................N..QIQGIP.R.....
gi|188528675|ref|NP_003052.2|     ELLFqnn.......QALSRLDLSE........................N..AIQAIP.R.....
gi|4759146|ref|NP_004778.1|       ELLFlgt.......AKLYRLDLSE........................N..QIQAIP.R.....
gi|157694513|ref|NP_060960.2|     SEAIrgl.......SALQSLRLDA........................N..HITSVP.E.....
gi|157426829|ref|NP_001094861.1|  PGVFtrl.......DNLTLLDLSE........................N..KLVILL.D.....
gi|153791330|ref|NP_065924.3|     SRWFdst.......PNLEILMIGE........................N..PVIGIL.D.....
gi|41281398|ref|NP_031399.2|      KDIKnl........SKLSMLSIRE........................N..KIKQL-.P.....
gi|52138725|ref|NP_001004432.1|   PGVFsgl.......SALTLLDLRL........................N..QIVLFL.D.....
gi|62912474|ref|NP_001017404.1|   VAIRtl........GRLQELGFHN........................N..NIKAIP.E.....
gi|21361633|ref|NP_060238.3|      EGFEql........SNLEDLDLSN........................N..HLTTV-.P.....
gi|30425563|ref|NP_848665.1|      ----..........----------........................-..HLRSLE.P.....
gi|50263044|ref|NP_116197.4|      LGVFtgl.......SNLTKLDISE........................N..KIVILL.D.....
gi|156139147|ref|NP_079269.4|     NKTFhpv.......PNLRNLDLSY........................N..KLQTLQ.S.....
gi|4758460|ref|NP_004479.1|       SGLLnsl.......GALTELQFHR........................N..HIRSIA.P.....
gi|197927168|ref|NP_001128217.1|  NKTFhpv.......PNLRNLDLSY........................N..KLQTLQ.S.....
gi|122937309|ref|NP_001073926.1|  TQAFeyl.......SKLRELWLRN........................N..PIESIP.S.....
gi|22749183|ref|NP_689783.1|      LGVFtgl.......SNLTKLDISE........................N..KIVILL.D.....
gi|7662102|ref|NP_056379.1|       NTTFtql.......INLQNLDLSF........................N..QLSSLH.P.....
gi|198041768|ref|NP_852607.3|     RGVFndl.......VSVQYLNLQR........................N..RLTVLG.S.....
gi|15029530|ref|NP_071426.1|      SGAFeyl.......SKLRELWLRN........................N..PIESIP.S.....
gi|194440719|ref|NP_612490.1|     QEALdgl.......GSLRRLELEG........................N..ALEELR.P.....
gi|4502403|ref|NP_001702.1|       PNLP..........SSLVELRIHD........................N..RIRKVP.K.....
gi|62912470|ref|NP_001017403.1|   AEALwel.......PSLQSLRLDA........................N..LISLVP.E.....
gi|30425553|ref|NP_848663.1|      ----..........----------........................-..QLRT--.-.....
gi|4504379|ref|NP_003658.1|       TEALqnl.......RSLQSLRLDA........................N..HISYVP.P.....
gi|153251229|ref|NP_001258.2|     AGAFddl.......TELTYLYLDH........................N..KVTELP.R.....
gi|51317373|ref|NP_065980.1|      NGAFvyl.......SKLKELWLRN........................N..PIESIP.S.....
gi|4503743|ref|NP_002009.1|       Q--Lpam.......TALQTLHLRS........................Tq.RTQSNL.P.....
gi|301069322|ref|NP_060150.4|     LNLP..........KSLAELRIHE........................N..KVKKIQ.K.....
gi|188528675|ref|NP_003052.2|     SGMFrgl.......DGLRTLMLRN........................N..RISCIH.N.....
gi|153791507|ref|NP_001093130.1|  SKWFdal.......PNLEILMIGE........................N..PIIRIK.D.....
gi|153792227|ref|NP_060804.3|     SKWFdal.......PNLEILMIGE........................N..PIIRIK.D.....
gi|153792651|ref|NP_001093128.1|  SKWFdal.......PNLEILMIGE........................N..PIIRIK.D.....
gi|238908508|ref|NP_001155000.1|  SDLEcl........GNLEILSLGK........................N..KLRHI-.P.....
gi|12007646|ref|NP_072089.1|      ERLLael.......PALRELAAFD........................N..LFRRV-.P.....
gi|4826772|ref|NP_004961.1|       LGTFaht.......PALASLGLSN........................N..RLSRLE.D.....
gi|225579152|ref|NP_001139478.1|  LGTFaht.......PALASLGLSN........................N..RLSRLE.D.....
gi|109809759|ref|NP_821079.3|     NNTFrpv.......TNLRNLDLSY........................N..QLHSLG.S.....
gi|226342935|ref|NP_001139727.1|  RGALsrq.......TQLRELYLQH........................N..QLTDSG.L.....
gi|40255157|ref|NP_700356.2|      DGAFwgl.......SNMEILQLDH........................N..NLTEIT.K.....
gi|4506013|ref|NP_002703.1|       GVDKl.........TRLKKLFLVN........................N..KISKI-.-.....
gi|86990456|ref|NP_849161.2|      NTTFrpm.......PNLRSVDLSY........................N..KLQALA.P.....
gi|194440719|ref|NP_612490.1|     AAALega.......PRLGYLYLER........................N..RFLQVP.G.....
gi|45505137|ref|NP_714914.2|      RFLP..........NALISVDFAA........................N..YLTKIY.G.....
gi|187829871|ref|NP_001120716.1|  QVVTdvg.......VHLQKLSINNegtklivlnslkkmanltelelirC..DLERI-.P.....
gi|187829877|ref|NP_001120717.1|  QVVTdvg.......VHLQKLSINNegtklivlnslkkmanltelelirC..DLERI-.P.....
gi|62241040|ref|NP_062540.2|      QVVTdvg.......VHLQKLSINNegtklivlnslkkmanltelelirC..DLERI-.P.....
gi|225579152|ref|NP_001139478.1|  AGAFlgl.......TNVAVMNLSG........................N..CLRNLP.E.....
gi|45827729|ref|NP_056171.2|      ESIKfc........KALEIADFSG........................N..PLSRL-.P.....
gi|45827731|ref|NP_874365.2|      ESIKfc........KALEIADFSG........................N..PLSRL-.P.....
gi|122937315|ref|NP_001073929.1|  RLICrw........TSLHLLYLGN........................T..GLHRL-.R.....
gi|197333706|ref|NP_001127951.1|  SNITdva.......PHLTKLVIHNdgtkllvlnslkkmmnvaelelqnC..ELERI-.P.....
gi|34222199|ref|NP_060573.2|      SNITdva.......PHLTKLVIHNdgtkllvlnslkkmmnvaelelqnC..ELERI-.P.....
gi|4826772|ref|NP_004961.1|       AGAFlgl.......TNVAVMNLSG........................N..CLRNLP.E.....
gi|85986601|ref|NP_067647.2|      PGVFedl.......HRLEWLIIED........................N..HLSRIS.P.....
gi|7019381|ref|NP_037363.1|       VGLP..........VDLQELRVDE........................N..RIAVIS.D.....
gi|119395738|ref|NP_001073285.1|  ----..........----------........................-..------.-.....
gi|119395736|ref|NP_000199.2|     ----..........----------........................-..------.-.....
gi|62912472|ref|NP_067649.2|      AEALwel.......PSLQSLRLDA........................N..LISLVP.E.....
gi|88702793|ref|NP_612449.2|      NETFrgl.......RRLERLYLGK........................N..RIRHIQ.P.....
gi|4557665|ref|NP_000866.1|       ----..........----------........................-..------.-.....
gi|41349454|ref|NP_958505.1|      SALP..........RNLEQLRLSQ........................N..HISRIP.P.....
gi|4506041|ref|NP_002716.1|       SALP..........RNLEQLRLSQ........................N..HISRIP.P.....
gi|38202222|ref|NP_938205.1|      WGLP..........RTIEELRLDD........................N..RISTIS.S.....
gi|7019383|ref|NP_037413.1|       WGLP..........RTIEELRLDD........................N..RISTIS.S.....
gi|312283621|ref|NP_001186009.1|  RFLP..........NALISVDFAA........................N..YLTKIY.G.....
gi|312283625|ref|NP_001186010.1|  RFLP..........NALISVDFAA........................N..YLTKIY.G.....
gi|71040111|ref|NP_002014.2|      GPLP..........RSLRELHLDH........................N..QISRVP.N.....
gi|312283627|ref|NP_001186011.1|  AGLP..........RSLVLLHLEK........................N..AIRSVD.A.....
gi|19923729|ref|NP_115646.2|      NLKKm.........TNLTELELVH........................C..DLERI-.P.....
gi|95113664|ref|NP_060684.4|      ESISfc........KALQVADFSG........................N..PLTRL-.P.....
gi|16418467|ref|NP_443204.1|      PGLFqas.......ATLDTLVLKE........................N..QLEVLE.V.....
gi|11321571|ref|NP_003053.1|      GRVFrgl.......SGLKTLMLRS........................N..LIGCVS.N.....
gi|226342933|ref|NP_001139726.1|  QFLP..........RSLRVADLAA........................N..QVMEIF.P.....
gi|4826876|ref|NP_005005.1|       FPLP..........KSLERLLLGY........................N..EISKLQ.T.....
gi|54792100|ref|NP_001973.2|      ----..........----------........................-..------.-.....
gi|18677729|ref|NP_570718.1|      PGIFkdl.......HQLTWLILDD........................N..PITRIS.Q.....
gi|27363458|ref|NP_076941.2|      TG--..........----------........................-..------.-.....
gi|34577057|ref|NP_037412.2|      SGLP..........HTLEELRLDD........................N..RISTIP.L.....
gi|8394456|ref|NP_059138.1|       VGHNfsfvahl...RTLRHLSLAH........................N..NIHSQV.S.....
gi|40217803|ref|NP_079337.2|      EILSfqhc......RKLVTLRLWH........................N..QIAYV-.P.....
gi|291190772|ref|NP_000164.5|     ----..........----------........................-..QVDGT-.-.....
gi|171846278|ref|NP_940980.3|     ENLTdvv.......EKLEQLILEG........................N..KISGI-.-.....
gi|260593673|ref|NP_001159530.1|  PGIFkdl.......HQLTWLILDD........................N..PITRIS.Q.....
gi|45505137|ref|NP_714914.2|      PGLP..........RNVHVLKVKR........................N..ELAALA.R.....
gi|308818206|ref|NP_001184225.1|  SQLP..........STLEELKVNE........................N..NLQAID.E.....
gi|4505047|ref|NP_002336.1|       GPLP..........KSLEDLQLTH........................N..KITKL-.-.....
gi|312283621|ref|NP_001186009.1|  PGLP..........RNVHVLKVKR........................N..ELAALA.R.....
gi|312283625|ref|NP_001186010.1|  PGLP..........RNVHVLKVKR........................N..ELAALA.R.....
gi|41327732|ref|NP_958439.1|      ----..........----------........................-..------.-.....
gi|41327736|ref|NP_958441.1|      ----..........----------........................-..------.-.....
gi|7706093|ref|NP_057646.1|       EGIThmlnftknl.KVLQKLMMND........................N..DISSS-.T.....
gi|29725609|ref|NP_005219.2|      ----..........----------........................-..------.-.....
gi|31542244|ref|NP_689660.2|      ----..........----------........................-..RLTKIT.N.....
gi|110825958|ref|NP_001036064.1|  ----..........----------........................-..------.-.....
gi|4885215|ref|NP_005226.1|       ----..........----------........................-..------.-.....
gi|46094076|ref|NP_056331.2|      AESFts........SPLSDVNLSH........................N..QLREVS.V.....
gi|5901992|ref|NP_008966.1|       SPLP..........RSLEQLQLAR........................N..KVSRIP.Q.....
gi|54792100|ref|NP_001973.2|      ----..........----------........................-..------.-.....
gi|4759146|ref|NP_004778.1|       HKMFkgl.......ESLKTLMLRS........................N..RITCVG.N.....
gi|4507531|ref|NP_003256.1|       GQEWrgl.......ENIFEIYLSY........................N..KYLQLT.R.....
gi|38490688|ref|NP_849144.2|      ----..........----------........................-..------.-.....
gi|65301141|ref|NP_055835.2|      VRILss........LSLRKLMLGH........................N..HVQNL-.-.....
gi|193083139|ref|NP_001122394.1|  AGGLgpl.......PRVTSLDLSG........................Ns.LYSG--.-.....
gi|5031707|ref|NP_005503.1|       AGGLgpl.......PRVTSLDLSG........................Ns.LYSG--.-.....
gi|4885215|ref|NP_005226.1|       GRVLy.........SGLSLLILKQ........................Q..GITSL-.-.....
gi|110825958|ref|NP_001036064.1|  GRVLy.........SGLSLLILKQ........................Q..GITSL-.-.....
gi|291219891|ref|NP_919431.2|     ARLFcn........SSLRKLLAGH........................N..QLARL-.P.....
gi|20302168|ref|NP_619542.1|      GVTHhlefiqnf..TNLKVLNLSH........................N..NIYTLT.D.....
gi|4507531|ref|NP_003256.1|       DKTFafc.......TNLTELHLMS........................N..SIQKIK.N.....
gi|13375646|ref|NP_078785.1|      ----..........----------........................-..RLTSLG.E.....
gi|167555127|ref|NP_005573.2|     CCSLqlknl.....SHLQTLNLSH........................N..EPLGLQ.S.....
gi|31657140|ref|NP_055030.1|      ----..........----------........................-..------.-.....
gi|41327734|ref|NP_958440.1|      ----..........----------........................-..------.-.....
gi|229089140|ref|NP_001019849.2|  ----..........----------........................-..------.-.....
gi|119395738|ref|NP_001073285.1|  DLSF..........PKLIMITDYL........................L..LFRVYG.L.....
gi|119395736|ref|NP_000199.2|     DLSF..........PKLIMITDYL........................L..LFRVYG.L.....
gi|31657138|ref|NP_000136.2|      ----..........----------........................N..NLLYIN.P.....
gi|41327732|ref|NP_958439.1|      ----..........----------........................-..------.-.....
gi|41327736|ref|NP_958441.1|      ----..........----------........................-..------.-.....
gi|29725609|ref|NP_005219.2|      ----..........----------........................-..------.-.....
gi|188536110|ref|NP_689824.2|     PCTGpal.......SSLRALALAG........................N..PLRALQ.P.....
gi|109150416|ref|NP_036425.1|     RQAFkgl.......ASLEQLYLHF........................N..QIETLD.P.....
gi|6912638|ref|NP_036557.1|       TQISsl........QKLKHLNLGM........................N..RLNTL-.P.....
gi|55741571|ref|NP_065788.1|      ----..........----------........................-..RLPSLG.E.....
gi|193083139|ref|NP_001122394.1|  LGARal........GSLRTLLLQG........................N..ALRDLP.P.....
gi|5031707|ref|NP_005503.1|       LGARal........GSLRTLLLQG........................N..ALRDLP.P.....
gi|41281398|ref|NP_031399.2|      LDFGtw........TSMVELNLAT........................N..QLTKI-.P.....
gi|54792096|ref|NP_004439.2|      ----..........----------........................-..------.-.....
gi|4557665|ref|NP_000866.1|       ----..........----------........................-..------.-.....
gi|54792098|ref|NP_001005862.1|   ----..........----------........................-..------.-.....
gi|54792096|ref|NP_004439.2|      ----..........----------........................-..------.-.....
gi|54792098|ref|NP_001005862.1|   ----..........----------........................-..------.-.....
gi|62912472|ref|NP_067649.2|      DLKGt.........TSLEILTLTR........................A..GIRLLP.S.....
gi|149773484|ref|NP_065913.1|     ----..........----------........................-..RLAEVR.G.....
gi|16751843|ref|NP_003259.2|      DQTFkfl.......EKLQTLDLRD........................N..------.-.....
gi|139948432|ref|NP_056234.2|     GQTLqgl.......SNLMRLHIDH........................N..KIEFIH.P.....
gi|90991702|ref|NP_078928.3|      EEENatnwigl...RKLQELDISD........................N..KLTELP.A.....
gi|153792305|ref|NP_001093148.1|  RALGsgf.......PHLQLLDVSG........................N..ALTAL-.G.....
gi|190014581|ref|NP_078788.2|     AEIGcl........KNLKELNVGF........................N..YLKSI-.P.....
gi|120953300|ref|NP_001073379.1|  GLDGc.........TNIQCLELSY........................N..KITRIG.Ysffle
gi|306140491|ref|NP_001182035.1|  WYLL..........AGLRYLDLSF........................N..DFDTMP.Iceeag
gi|306140493|ref|NP_001182036.1|  WYLL..........AGLRYLDLSF........................N..DFDTMP.Iceeag
gi|62865618|ref|NP_112218.2|      WYLL..........AGLRYLDLSF........................N..DFDTMP.Iceeag
gi|62865621|ref|NP_001017388.1|   WYLL..........AGLRYLDLSF........................N..DFDTMP.Iceeag
gi|262205665|ref|NP_001159864.1|  PFAFsgsnasvsapSPLVELILNHivppederq...............Nr.SFEGM-.-.....
gi|5729718|ref|NP_006661.1|       PFAFsgsnasvsapSPLVELILNHivppederq...............Nr.SFEGM-.-.....
gi|126517478|ref|NP_653252.3|     KQTFkgl.......ISLEHLYIHF........................N..QLEMLQ.P.....
gi|306140495|ref|NP_001182037.1|  WYLL..........AGLRYLDLSF........................N..DFDTMP.Iceeag
gi|72534676|ref|NP_001026862.1|   EEVFiyt.......PLLSYLRLYD........................N..PWHCT-.-.....
gi|41350337|ref|NP_003254.2|      CHPT..........VNLKHLDLSF........................N..AFDALP.Ickefg
gi|52426787|ref|NP_002535.3|      AHLP..........RSLWNMSAAN........................N..NIKLLD.K.....
gi|193788651|ref|NP_001123362.1|  EEMKyl........TSLKNLHLSG........................N..RICRFA.P.....
gi|194306618|ref|NP_001123608.1|  ----..........----------........................-..------.-.....
gi|194306621|ref|NP_001123609.1|  ----..........----------........................-..------.-.....
gi|194306623|ref|NP_001123610.1|  ----..........----------........................-..------.-.....
gi|39930401|ref|NP_065902.1|      ----..........----------........................-..------.-.....
gi|157743290|ref|NP_001099051.1|  REVSll........QCLKVLFVNM........................N..CLTEV-.P.....
gi|299782601|ref|NP_001010847.1|  AGAFrsa.......GRLVKLSLAN........................N..NLVGVH.E.....
gi|341915001|ref|XP_003403925.1|  ALP-..........ASLQELKLND........................N..LLQGLQ.Gssfrg
gi|255652962|ref|NP_001157397.1|  RDLLrhs.......PLLRHLDLSI........................N..GLAQLP.P.....
gi|255652964|ref|NP_001157398.1|  RDLLrhs.......PLLRHLDLSI........................N..GLAQLP.P.....
gi|84781739|ref|NP_001034118.1|   RDLLrhs.......PLLRHLDLSI........................N..GLAQLP.P.....
gi|30181233|ref|NP_002310.2|      PYICq.........LPLRVLIVSN........................N..KLGAL-.P.....
gi|194394161|ref|NP_694992.2|     ----..........----------........................-..HLREL-.P.....
gi|14249428|ref|NP_116162.1|      VHLCn.........LPLKVLIASN........................N..KLVSL-.P.....
gi|256017174|ref|NP_001157683.1|  ACLCg.........LPLKVLIASN........................N..KLGSL-.P.....
gi|41582239|ref|NP_958934.1|      ----..........----------........................-..------.-.....
gi|5031809|ref|NP_005536.1|       ----..........----------........................-..------.-.....
gi|63003903|ref|NP_963844.2|      LHVCsf........RELVKLYLSD........................N..HLNSL-.P.....
gi|223005922|ref|NP_001138549.1|  EEIEel........RELRILALDF........................N..KLERL-.P.....
gi|154091020|ref|NP_065922.3|     KYLFd.........LPLKVLVVSN........................N..KLVSI-.P.....
gi|33859670|ref|NP_055931.1|      ACLCg.........LPLKVLIASN........................N..KLGSL-.P.....
gi|8394456|ref|NP_059138.1|       ALP-..........KSLISLSLSH........................T..NILMLD.S.....
gi|256017180|ref|NP_001157685.1|  ACLCg.........LPLKVLIASN........................N..KLGSL-.P.....
gi|27436867|ref|NP_775101.1|      ----..........----------........................-..------.-.....
gi|296080773|ref|NP_001171678.1|  ----..........----------........................-..------.-.....
gi|296080775|ref|NP_001171679.1|  ----..........----------........................-..------.-.....
gi|34577083|ref|NP_689937.2|      TQISsl........QKLKHLNLGM........................N..RLNTL-.P.....
gi|167555127|ref|NP_005573.2|     ETSLngp.......KSLKHLFLIQ........................T..GISNLE.F.....
gi|33285015|ref|NP_653199.2|      ----..........----------........................-..--EIV-.C.....
gi|291575177|ref|NP_852111.2|     ----..........----------........................-..------.-.....
gi|24308207|ref|NP_065761.1|      ----..........----------........................-..PGQGLG.P.....
gi|31657140|ref|NP_055030.1|      ----..........----------........................-..------.-.....
gi|52353306|ref|NP_001005210.1|   ADMFqea.......HGLVHIDLSH........................Np.WLRRVH.P.....
gi|10190722|ref|NP_065729.1|      ----..........----------........................-..------.-.....
gi|59823631|ref|NP_660333.2|      ----..........----------........................-..------.-.....
gi|40217820|ref|NP_055741.2|      ----..........LNA-------........................-..------.-.....
gi|95113664|ref|NP_060684.4|      EEISgl........TSLTDLVISQ........................N..LLETI-.P.....
gi|219521831|ref|NP_001137140.1|  ----..........----------........................-..KLKTVK.N.....
gi|32469517|ref|NP_862830.1|      ----..........----------........................-..KLKTVK.N.....
gi|21313638|ref|NP_060646.2|      ----..........----------........................-..------.-.....
gi|21389483|ref|NP_653249.1|      NFKPp.........KNLKKADFSH........................N..QISEI-.-.....
gi|61742784|ref|NP_665893.2|      ACVLqm........RGLGALLLSH........................N..CLSEL-.P.....
gi|61742786|ref|NP_665894.2|      ACVLqm........RGLGALLLSH........................N..CLSEL-.P.....
gi|7706093|ref|NP_057646.1|       QGLP..........PSLQLLSLEA........................N..NIFSIR.K.....
gi|61966761|ref|NP_001013675.1|   ----..........----------........................-..------.-.....
gi|153791466|ref|NP_065754.2|     ----..........----------........................-..QLRTLD.E.....
gi|40217823|ref|NP_056382.1|      ----..........----------........................-..RIERLS.P.....
gi|157694513|ref|NP_060960.2|     DGAFdgn.......PLLRTIHLYD........................N..PLSFVG.N.....
gi|221136957|ref|NP_001137475.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136961|ref|NP_001137476.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136965|ref|NP_001137477.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136969|ref|NP_001137478.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136977|ref|NP_001137480.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136981|ref|NP_001137481.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136985|ref|NP_001137482.1|  EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|33504581|ref|NP_115928.1|      EDTFlgl.......ESLEYLQADY........................N..YISAIE.A.....
gi|221136957|ref|NP_001137475.1|  ----..........----------........................-..YLEVLY.P.....
gi|221136961|ref|NP_001137476.1|  ----..........----------........................-..YLEVLY.P.....
gi|221136965|ref|NP_001137477.1|  ----..........----------........................-..YLEVLY.P.....
gi|221136969|ref|NP_001137478.1|  ----..........----------........................-..YLEVLY.P.....
gi|221136977|ref|NP_001137480.1|  ----..........----------........................-..YLEVLY.P.....
gi|221136981|ref|NP_001137481.1|  ----..........----------........................-..YLEVLY.P.....
gi|221136985|ref|NP_001137482.1|  ----..........----------........................-..YLEVLY.P.....
gi|33504581|ref|NP_115928.1|      ----..........----------........................-..YLEVLY.P.....
gi|194018474|ref|NP_001005214.2|  PFTFsvl.......SNLVQLNIAN........................Np.HLLSLH.K.....
gi|40217817|ref|NP_443142.1|      ----..........----------........................-..------.-.....
gi|40217825|ref|NP_115605.2|      KGMFlgl.......HNLEYLYLEY........................N..AIKEIL.P.....
gi|291219891|ref|NP_919431.2|     LAVCsi........PTLAELNVSC........................N..ALRSV-.P.....
gi|4826816|ref|NP_005088.1|       ----..........----------........................-..------.-.....
gi|38454322|ref|NP_942015.1|      ----..........----------........................-..TLRALG.R.....
gi|40217817|ref|NP_443142.1|      RFTApt........SQFYHLFLHG........................N..SLTRLF.P.....
gi|164607156|ref|NP_113615.2|     GLEAvg........DTLEELWISY........................N..FIEKL-.-.....
gi|191252816|ref|NP_001122108.1|  ----..........----------........................-..------.-.....
gi|40217823|ref|NP_056382.1|      ----..........--IYHLLLSG........................N..LLNRLY.P.....
gi|27436867|ref|NP_775101.1|      ADTFlgi.......ENLEYLQADY........................N..LIKYIE.R.....
gi|296080773|ref|NP_001171678.1|  ADTFlgi.......ENLEYLQADY........................N..LIKYIE.R.....
gi|296080775|ref|NP_001171679.1|  ADTFlgi.......ENLEYLQADY........................N..LIKYIE.R.....
gi|40217825|ref|NP_115605.2|      ----..........-----LSLLN........................N..GLTMLH.T.....
gi|21281681|ref|NP_644807.1|      ----..........----------........................-..------.-.....
gi|300934750|ref|NP_116166.9|     ----..........----------........................-..------.-.....
gi|21281673|ref|NP_644813.1|      ----..........----------........................-..------.-.....
gi|66912176|ref|NP_001019782.1|   LDLLsp........KS--------........................-..SWVKRH.R.....
gi|301069324|ref|NP_001180264.1|  LNLP..........KSLAELRIHE........................N..KVKKIQ.K.....
gi|116268101|ref|NP_443138.2|     ----..........----------........................-..------.-.....
gi|318984125|ref|NP_001188295.1|  GLEAvg........DTLEELWISY........................N..FIEKL-.-.....
gi|40217820|ref|NP_055741.2|      ----..........----------........................-..------.N.....
gi|312222719|ref|NP_001185947.1|  NLENl.........KSLDVLDLHG........................N..QITKI-.-.....
gi|106067657|ref|NP_000224.2|     ----..........----------........................-..NLRYIE.P.....
gi|206725447|ref|NP_001128689.1|  MNEL..........PYLQIASFAY........................N..QITDT-.-.....
gi|42542396|ref|NP_964013.1|      MNEL..........PYLQIASFAY........................N..QITDT-.-.....
gi|15487670|ref|NP_006353.2|      ----..........----------........................-..------.-.....
gi|20143971|ref|NP_006059.2|      PHAP..........STFKFLNFTQ........................N..VFTDSI.F.....
gi|55743114|ref|NP_060161.2|      NLENl.........KSLDVLDLHG........................N..QITKI-.-.....
gi|312222716|ref|NP_001185946.1|  NLENl.........KSLDVLDLHG........................N..QITKI-.-.....
gi|193083136|ref|NP_940908.2|     ----..........-----LRIEK........................T..VIRRIS.A.....
gi|254039592|ref|NP_116564.2|     ----..........----------........................-..------.-.....
gi|87298937|ref|NP_008949.4|      ----..........----------........................-..------.-.....
gi|13430854|ref|NP_071336.1|      ----..........----------........................-..------.-.....
gi|14277694|ref|NP_060279.2|      ----..........----------........................-..------.-.....
gi|153791282|ref|NP_001093156.1|  ----..........----------........................-..------.-.....
gi|194272226|ref|NP_001123563.1|  GLDTl.........VNLEDLSLFN........................N..RISKI-.-.....
gi|194272228|ref|NP_001123564.1|  GLDTl.........VNLEDLSLFN........................N..RISKI-.-.....
gi|194272222|ref|NP_001123562.1|  GLDTl.........VNLEDLSLFN........................N..RISKI-.-.....
gi|194272224|ref|NP_112584.3|     GLDTl.........VNLEDLSLFN........................N..RISKI-.-.....
gi|62988340|ref|NP_001017924.1|   GNLS..........EEFKQVRIEN........................S..PLFEMP.Q.....
gi|68800360|ref|NP_004941.2|      ELP-..........----------........................-..------.-.....
gi|167466264|ref|NP_001006940.3|  DSISkf........QNLRWLDLHS........................N..YIDKL-.P.....
gi|31377705|ref|NP_078824.2|      G---..........----------........................-..------.-.....
gi|21361633|ref|NP_060238.3|      DEVFdavks.....NIVTSINFSK........................N..QLCEIP.K.....
gi|122937315|ref|NP_001073929.1|  LEIFtf........TELEEVHLEN........................N..QIEEI-.P.....
gi|299758423|ref|NP_001177652.1|  KSCSllsl......ATIKVLDLHD........................N..QLTAL-.P.....
gi|53729359|ref|NP_612370.3|      KSCSllsl......ATIKVLDLHD........................N..QLTAL-.P.....
gi|53729361|ref|NP_001005373.1|   KSCSllsl......ATIKVLDLHD........................N..QLTAL-.P.....
gi|53729363|ref|NP_001005374.1|   KSCSllsl......ATIKVLDLHD........................N..QLTAL-.P.....
gi|14149694|ref|NP_056428.1|      ----..........----------........................-..------.-.....
gi|45439342|ref|NP_689542.2|      VALChstlq.....KSLRSLDLSK........................N..KIKAL-.P.....
gi|217330610|ref|NP_001136098.1|  ----..........----------........................-..NLTYID.P.....
gi|288541295|ref|NP_001128529.2|  IGLFqgl.......DSLESLLLSS........................N..QLLQIQ.P.....
gi|117414162|ref|NP_208325.3|     GLNTl.........TKLCTLNLSC........................N..LITKV-.-.....
gi|19743848|ref|NP_598011.1|      ----..........----------........................-..------.-.....
gi|64085121|ref|NP_000360.2|      ----..........----------........................-..NLTYID.P.....
gi|31621309|ref|NP_036604.2|      ----..........----------........................-..------.-.....
gi|64085161|ref|NP_001018046.1|   ----..........----------........................-..NLTYID.P.....
gi|50593002|ref|NP_003081.2|      ----..........----------........................-..------.-.....
gi|5454088|ref|NP_006392.1|       ----..........----------........................-..------.-.....
gi|7657419|ref|NP_055174.1|       VLP-..........----------........................-..------.-.....
gi|5453880|ref|NP_006296.1|       ----..........----------........................-..------.-.....
gi|45827729|ref|NP_056171.2|      DGIGql........KQLSILKVDQ........................N..RLCEV-.T.....
gi|45827731|ref|NP_874365.2|      DGIGql........KQLSILKVDQ........................N..RLCEV-.T.....
gi|306922420|ref|NP_001182457.1|  ----..........----------........................-..PLRALG.G.....
gi|226342933|ref|NP_001139726.1|  PALP..........RRLRALVLPH........................N..HVAALG.A.....
gi|239582714|ref|NP_005815.2|     ----..........----------........................-..------.-.....
gi|125625324|ref|NP_001074960.1|  ----..........----------........................-..------.-.....
gi|54792102|ref|NP_001005915.1|   ----..........----------........................-..------.-.....
gi|39930571|ref|NP_932341.1|      ----..........----------........................-..------.-.....
gi|16751843|ref|NP_003259.2|      ----..........----------........................-..KIYFLH.P.....
gi|12597641|ref|NP_075052.1|      ----..........----------........................-..------.-.....
gi|4826651|ref|NP_004919.1|       ----..........----------........................-..------.-.....
gi|15529980|ref|NP_219481.1|      NLACi.........PSLRFLSLAG........................N..QIRQV-.-.....
gi|40254924|ref|NP_060979.2|      ADFGrl........VNLQHLDLLN........................N..KLVTL-.P.....
gi|14916498|ref|NP_148935.1|      VLP-..........----------........................-..------.-.....
gi|7661704|ref|NP_054776.1|       VLP-..........----------........................-..------.-.....
gi|16418445|ref|NP_443185.1|      KNAF..........NNLK------........................-..------.-.....
gi|13569879|ref|NP_112182.1|      ----..........----------........................-..------.-.....
gi|5901898|ref|NP_008923.1|       MNEL..........PYLQIASFAY........................N..QITDT-.-.....
gi|306966160|ref|NP_001182474.1|  VEAF..........VGLQ------........................-..------.-.....
gi|194239699|ref|NP_689928.3|     ----..........----------........................NplNLSVLE.R.....
gi|194239701|ref|NP_001123519.1|  ----..........----------........................NplNLSVLE.R.....
gi|13027616|ref|NP_076431.1|      PLASl.........RQLAVLNVSN........................N..RLTGL-.-.....
gi|218931217|ref|NP_001136400.1|  PLASl.........RQLAVLNVSN........................N..RLTGL-.-.....
gi|289547512|ref|NP_055649.4|     FGTFqawhgm....QFLHKLILNH........................N..PLTTVE.D.....
gi|28872863|ref|NP_056270.2|      AELGnm........VSLRELHLNN........................N..LLRVL-.P.....
gi|116325993|ref|NP_001006608.2|  FGTFqawhgm....QFLHKLILNH........................N..PLTTVE.D.....
gi|61966709|ref|NP_001013648.1|   ----..........----------........................-..YIAVI-.-.....
gi|305632814|ref|NP_001182209.1|  ----..........----------........................-..------.-.....
gi|13562088|ref|NP_112153.1|      KDALg.........KLSAKIRLSH........................N..PLHCE-.-.....
gi|75677612|ref|NP_955372.2|      FGTFqawhgm....QFLHKLILNH........................N..PLTTVE.D.....
gi|53829385|ref|NP_443120.2|      LGTFqawhgm....QFLHNLILNR........................N..PLTTVE.D.....
gi|150378449|ref|NP_892014.1|     VKYGdf........KLLEFLDLSF........................N..SLTVEA.I.....
gi|59889558|ref|NP_001012331.1|   ----..........----------........................-..------.-.....
gi|4585712|ref|NP_002520.2|       ----..........----------........................-..------.-.....
gi|19743850|ref|NP_598012.1|      GGLAeh........KYIQVVYLHN........................N..NISVVG.S.....
gi|148664213|ref|NP_001091989.1|  ----..........----------........................-..------.-.....
gi|210147571|ref|NP_001129951.1|  ----..........----------........................-..------.-.....
gi|115583679|ref|NP_653172.2|     AELGnm........VSLRELLLNN........................N..LLRVL-.P.....
gi|157785649|ref|NP_001099129.1|  NTKFwngl......KNLKLLYLHD........................N..GFAKL-.-.....
gi|288541297|ref|NP_570843.2|     IGLFqgl.......DSLESLLLSS........................N..QLLQIQ.P.....
gi|46397369|ref|NP_997002.1|      ----..........----------........................-..------.-.....
gi|239735605|ref|NP_060766.5|     ----..........----------........................-..NIPSL-.-.....
gi|33469951|ref|NP_878256.1|      ----..........----------........................K..DLTVL-.-.....
gi|53828918|ref|NP_004572.3|      ----..........----------........................K..DLTVL-.-.....
gi|205360954|ref|NP_001009944.2|  ----..........----------........................-..------.-.....
gi|205360962|ref|NP_000287.3|     ----..........----------........................-..------.-.....
gi|38348406|ref|NP_940967.1|      DCPFqg........TSLTYLDLSS........................NwgVLNGSL.A.....
gi|4758460|ref|NP_004479.1|       GALLdkm.......VLLEQLFLDH........................N..ALRGID.Q.....
gi|219555702|ref|NP_001137230.1|  VELGsv........TTLKALNLRH........................C..PLEF--.-.....
gi|219555704|ref|NP_001137231.1|  VELGsv........TTLKALNLRH........................C..PLEF--.-.....
gi|219555700|ref|NP_001137229.1|  VELGsv........TTLKALNLRH........................C..PLEF--.-.....
gi|55741567|ref|NP_085129.1|      VELGsv........TTLKALNLRH........................C..PLEF--.-.....
gi|62899065|ref|NP_060610.2|      ----..........----------........................-..------.-.....
gi|56118210|ref|NP_001007793.1|   ----..........----------........................-..------.-.....
gi|6912604|ref|NP_036535.1|       ----..........----------........................-..------.-.....
gi|55956794|ref|NP_001007157.1|   ----..........----------........................-..------.-.....
gi|59889560|ref|NP_002521.2|      ----..........----------........................-..------.-.....
gi|59889562|ref|NP_001012338.1|   ----..........----------........................-..------.-.....
gi|4503743|ref|NP_002009.1|       ----..........----------........................-..NLTTL-.H.....
gi|55770895|ref|NP_001006600.1|   ----..........----------........................-..DLTTL-.P.....
gi|226342931|ref|NP_079101.3|     MGLP..........TGLRTLQLQR........................N..QLRMLE.P.....
gi|8923909|ref|NP_061165.1|       KEIFtfe.......KTLEELYLDA........................N..QIEEL-.P.....
gi|20143971|ref|NP_006059.2|      CHPI..........VSFRHLDLSF........................N..DFKALPiC.....
gi|14042939|ref|NP_114413.1|      ----..........----------........................-..------.-.....
gi|21071028|ref|NP_036536.2|      ----..........----------........................-..------.-.....
gi|23097240|ref|NP_690852.1|      ----..........----------........................-..------.-.....
gi|65301141|ref|NP_055835.2|      LSSL..........CSLEQLHCGR........................N..QLRELT.L.....
gi|19743852|ref|NP_598013.1|      ----..........----------........................-..------.-.....
gi|223718151|ref|NP_001138779.1|  ----..........----------........................-..------.-.....
gi|55956790|ref|NP_001007098.1|   ----..........----------........................-..------.-.....
gi|65506779|ref|NP_001018076.1|   ----..........----------........................-..------.-.....
gi|312283627|ref|NP_001186011.1|  EGLP..........ESLEYLYLQN........................N..KISAVP.A.....
gi|65506769|ref|NP_001018075.1|   ----..........----------........................-..------.-.....
gi|21361306|ref|NP_006171.2|      ----..........----------........................-..------.-.....
gi|65506745|ref|NP_001018074.1|   ----..........----------........................-..------.-.....
gi|291575163|ref|NP_001167575.1|  PLPLeatg......LALSSLRLRN........................V..SWATG-.R.....
gi|291575165|ref|NP_001167576.1|  PLPLeatg......LALSSLRLRN........................V..SWATG-.R.....
gi|4557417|ref|NP_000582.1|       PLPLeatg......LALSSLRLRN........................V..SWATG-.R.....
gi|91105159|ref|NP_001035110.1|   PLPLeatg......LALSSLRLRN........................V..SWATG-.R.....
gi|4504077|ref|NP_000165.1|       ----..........----------........................-..------.-.....
gi|41327734|ref|NP_958440.1|      ----..........----------........................-..------.-.....
gi|148664188|ref|NP_689972.3|     ----..........--LQHLGLGH........................N..KLLGPL.E.....
gi|4504073|ref|NP_000398.1|       ----..........----------........................-..------.-.....
gi|54607118|ref|NP_056356.2|      ----..........----------........................-..------.-.....
gi|239582714|ref|NP_005815.2|     ----..........----------........................-..------.-.....
gi|7706093|ref|NP_057646.1|       ----..........----------........................-..------.-.....
gi|210147569|ref|NP_001129950.1|  ----..........----------........................-..------.-.....
gi|45593138|ref|NP_660299.2|      ----..........----------........................-..------.-.....
gi|34577057|ref|NP_037412.2|      ----..........----------........................-..------.-.....
gi|19718734|ref|NP_003255.2|      ----..........----------........................-..------.-.....
gi|38202222|ref|NP_938205.1|      ----..........----------........................-..------.-.....
gi|7019383|ref|NP_037413.1|       ----..........----------........................-..------.-.....
gi|8922644|ref|NP_060675.1|       ----..........----------........................-..------.-.....


                                                                                                    
                                                                                                    
d1xkua_                             ................................................................
gi|16904383|ref|NP_065845.1|      ................................................................
gi|110825984|ref|NP_004216.2|     ................................................................
gi|76880480|ref|NP_055632.2|      ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|256217721|ref|NP_001073982.2|  ................................................................
gi|209862903|ref|NP_001129523.1|  ................................................................
gi|42544231|ref|NP_006329.2|      ................................................................
gi|42544233|ref|NP_963924.1|      ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|13194201|ref|NP_075380.1|      ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|19743846|ref|NP_598010.1|      ................................................................
gi|4503271|ref|NP_001911.1|       ................................................................
gi|7662320|ref|NP_055628.1|       ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|157426829|ref|NP_001094861.1|  ................................................................
gi|153791330|ref|NP_065924.3|     ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|52138725|ref|NP_001004432.1|   ................................................................
gi|62912474|ref|NP_001017404.1|   ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|30425563|ref|NP_848665.1|      ................................................................
gi|50263044|ref|NP_116197.4|      ................................................................
gi|156139147|ref|NP_079269.4|     ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|197927168|ref|NP_001128217.1|  ................................................................
gi|122937309|ref|NP_001073926.1|  ................................................................
gi|22749183|ref|NP_689783.1|      ................................................................
gi|7662102|ref|NP_056379.1|       ................................................................
gi|198041768|ref|NP_852607.3|     ................................................................
gi|15029530|ref|NP_071426.1|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|4502403|ref|NP_001702.1|       ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|30425553|ref|NP_848663.1|      ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|153251229|ref|NP_001258.2|     ................................................................
gi|51317373|ref|NP_065980.1|      ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|301069322|ref|NP_060150.4|     ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|153791507|ref|NP_001093130.1|  ................................................................
gi|153792227|ref|NP_060804.3|     ................................................................
gi|153792651|ref|NP_001093128.1|  ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|12007646|ref|NP_072089.1|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|109809759|ref|NP_821079.3|     ................................................................
gi|226342935|ref|NP_001139727.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|4506013|ref|NP_002703.1|       ................................................................
gi|86990456|ref|NP_849161.2|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|187829871|ref|NP_001120716.1|  ................................................................
gi|187829877|ref|NP_001120717.1|  ................................................................
gi|62241040|ref|NP_062540.2|      ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|197333706|ref|NP_001127951.1|  ................................................................
gi|34222199|ref|NP_060573.2|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|85986601|ref|NP_067647.2|      ................................................................
gi|7019381|ref|NP_037363.1|       ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|88702793|ref|NP_612449.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|41349454|ref|NP_958505.1|      ................................................................
gi|4506041|ref|NP_002716.1|       ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|71040111|ref|NP_002014.2|      ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|19923729|ref|NP_115646.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|16418467|ref|NP_443204.1|      ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|4826876|ref|NP_005005.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|18677729|ref|NP_570718.1|      ................................................................
gi|27363458|ref|NP_076941.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|40217803|ref|NP_079337.2|      ................................................................
gi|291190772|ref|NP_000164.5|     ................................................................
gi|171846278|ref|NP_940980.3|     ................................................................
gi|260593673|ref|NP_001159530.1|  ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|308818206|ref|NP_001184225.1|  ................................................................
gi|4505047|ref|NP_002336.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|31542244|ref|NP_689660.2|      ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|46094076|ref|NP_056331.2|      ................................................................
gi|5901992|ref|NP_008966.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|38490688|ref|NP_849144.2|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|13375646|ref|NP_078785.1|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|229089140|ref|NP_001019849.2|  ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|31657138|ref|NP_000136.2|      ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|188536110|ref|NP_689824.2|     ................................................................
gi|109150416|ref|NP_036425.1|     ................................................................
gi|6912638|ref|NP_036557.1|       ................................................................
gi|55741571|ref|NP_065788.1|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|149773484|ref|NP_065913.1|     ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|139948432|ref|NP_056234.2|     ................................................................
gi|90991702|ref|NP_078928.3|      ................................................................
gi|153792305|ref|NP_001093148.1|  ................................................................
gi|190014581|ref|NP_078788.2|     ................................................................
gi|120953300|ref|NP_001073379.1|  eklvdnagfchhlgtstsylslaqvwiptglcwswipitsltknsdcnflishlywn.......
gi|306140491|ref|NP_001182035.1|  nmshleilglsgakiqksdfqkiahlhlntvflgfrtlphyeegslpilnttklhivlpmdtnf
gi|306140493|ref|NP_001182036.1|  nmshleilglsgakiqksdfqkiahlhlntvflgfrtlphyeegslpilnttklhivlpmdtnf
gi|62865618|ref|NP_112218.2|      nmshleilglsgakiqksdfqkiahlhlntvflgfrtlphyeegslpilnttklhivlpmdtnf
gi|62865621|ref|NP_001017388.1|   nmshleilglsgakiqksdfqkiahlhlntvflgfrtlphyeegslpilnttklhivlpmdtnf
gi|262205665|ref|NP_001159864.1|  ................................................................
gi|5729718|ref|NP_006661.1|       ................................................................
gi|126517478|ref|NP_653252.3|     ................................................................
gi|306140495|ref|NP_001182037.1|  nmshleilglsgakiqksdfqkiahlhlntvflgfrtlphyeegslpilnttklhivlpmdtnf
gi|72534676|ref|NP_001026862.1|   ................................................................
gi|41350337|ref|NP_003254.2|      nmsqlkflglstthlekssvlpiahlniskvllvlgetygekedpeglqdfnteslhivfptnk
gi|52426787|ref|NP_002535.3|      ................................................................
gi|193788651|ref|NP_001123362.1|  ................................................................
gi|194306618|ref|NP_001123608.1|  ................................................................
gi|194306621|ref|NP_001123609.1|  ................................................................
gi|194306623|ref|NP_001123610.1|  ................................................................
gi|39930401|ref|NP_065902.1|      ................................................................
gi|157743290|ref|NP_001099051.1|  ................................................................
gi|299782601|ref|NP_001010847.1|  ................................................................
gi|341915001|ref|XP_003403925.1|  agefrgqgprgqawagapppgqglplcsllylrldrnrlraiprglpsslqlswspqdgeelhl
gi|255652962|ref|NP_001157397.1|  ................................................................
gi|255652964|ref|NP_001157398.1|  ................................................................
gi|84781739|ref|NP_001034118.1|   ................................................................
gi|30181233|ref|NP_002310.2|      ................................................................
gi|194394161|ref|NP_694992.2|     ................................................................
gi|14249428|ref|NP_116162.1|      ................................................................
gi|256017174|ref|NP_001157683.1|  ................................................................
gi|41582239|ref|NP_958934.1|      ................................................................
gi|5031809|ref|NP_005536.1|       ................................................................
gi|63003903|ref|NP_963844.2|      ................................................................
gi|223005922|ref|NP_001138549.1|  ................................................................
gi|154091020|ref|NP_065922.3|     ................................................................
gi|33859670|ref|NP_055931.1|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|256017180|ref|NP_001157685.1|  ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|34577083|ref|NP_689937.2|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|33285015|ref|NP_653199.2|      ................................................................
gi|291575177|ref|NP_852111.2|     ................................................................
gi|24308207|ref|NP_065761.1|      ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|52353306|ref|NP_001005210.1|   ................................................................
gi|10190722|ref|NP_065729.1|      ................................................................
gi|59823631|ref|NP_660333.2|      ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|219521831|ref|NP_001137140.1|  ................................................................
gi|32469517|ref|NP_862830.1|      ................................................................
gi|21313638|ref|NP_060646.2|      ................................................................
gi|21389483|ref|NP_653249.1|      ................................................................
gi|61742784|ref|NP_665893.2|      ................................................................
gi|61742786|ref|NP_665894.2|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|61966761|ref|NP_001013675.1|   ................................................................
gi|153791466|ref|NP_065754.2|     ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|194018474|ref|NP_001005214.2|  ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|4826816|ref|NP_005088.1|       ................................................................
gi|38454322|ref|NP_942015.1|      ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|164607156|ref|NP_113615.2|     ................................................................
gi|191252816|ref|NP_001122108.1|  ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|21281681|ref|NP_644807.1|      ................................................................
gi|300934750|ref|NP_116166.9|     ................................................................
gi|21281673|ref|NP_644813.1|      ................................................................
gi|66912176|ref|NP_001019782.1|   ................................................................
gi|301069324|ref|NP_001180264.1|  ................................................................
gi|116268101|ref|NP_443138.2|     ................................................................
gi|318984125|ref|NP_001188295.1|  ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|312222719|ref|NP_001185947.1|  ................................................................
gi|106067657|ref|NP_000224.2|     ................................................................
gi|206725447|ref|NP_001128689.1|  ................................................................
gi|42542396|ref|NP_964013.1|      ................................................................
gi|15487670|ref|NP_006353.2|      ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|55743114|ref|NP_060161.2|      ................................................................
gi|312222716|ref|NP_001185946.1|  ................................................................
gi|193083136|ref|NP_940908.2|     ................................................................
gi|254039592|ref|NP_116564.2|     ................................................................
gi|87298937|ref|NP_008949.4|      ................................................................
gi|13430854|ref|NP_071336.1|      ................................................................
gi|14277694|ref|NP_060279.2|      ................................................................
gi|153791282|ref|NP_001093156.1|  ................................................................
gi|194272226|ref|NP_001123563.1|  ................................................................
gi|194272228|ref|NP_001123564.1|  ................................................................
gi|194272222|ref|NP_001123562.1|  ................................................................
gi|194272224|ref|NP_112584.3|     ................................................................
gi|62988340|ref|NP_001017924.1|   ................................................................
gi|68800360|ref|NP_004941.2|      ................................................................
gi|167466264|ref|NP_001006940.3|  ................................................................
gi|31377705|ref|NP_078824.2|      ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|299758423|ref|NP_001177652.1|  ................................................................
gi|53729359|ref|NP_612370.3|      ................................................................
gi|53729361|ref|NP_001005373.1|   ................................................................
gi|53729363|ref|NP_001005374.1|   ................................................................
gi|14149694|ref|NP_056428.1|      ................................................................
gi|45439342|ref|NP_689542.2|      ................................................................
gi|217330610|ref|NP_001136098.1|  ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|117414162|ref|NP_208325.3|     ................................................................
gi|19743848|ref|NP_598011.1|      ................................................................
gi|64085121|ref|NP_000360.2|      ................................................................
gi|31621309|ref|NP_036604.2|      ................................................................
gi|64085161|ref|NP_001018046.1|   ................................................................
gi|50593002|ref|NP_003081.2|      ................................................................
gi|5454088|ref|NP_006392.1|       ................................................................
gi|7657419|ref|NP_055174.1|       ................................................................
gi|5453880|ref|NP_006296.1|       ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|306922420|ref|NP_001182457.1|  ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|125625324|ref|NP_001074960.1|  ................................................................
gi|54792102|ref|NP_001005915.1|   ................................................................
gi|39930571|ref|NP_932341.1|      ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|12597641|ref|NP_075052.1|      ................................................................
gi|4826651|ref|NP_004919.1|       ................................................................
gi|15529980|ref|NP_219481.1|      ................................................................
gi|40254924|ref|NP_060979.2|      ................................................................
gi|14916498|ref|NP_148935.1|      ................................................................
gi|7661704|ref|NP_054776.1|       ................................................................
gi|16418445|ref|NP_443185.1|      ................................................................
gi|13569879|ref|NP_112182.1|      ................................................................
gi|5901898|ref|NP_008923.1|       ................................................................
gi|306966160|ref|NP_001182474.1|  ................................................................
gi|194239699|ref|NP_689928.3|     ................................................................
gi|194239701|ref|NP_001123519.1|  ................................................................
gi|13027616|ref|NP_076431.1|      ................................................................
gi|218931217|ref|NP_001136400.1|  ................................................................
gi|289547512|ref|NP_055649.4|     ................................................................
gi|28872863|ref|NP_056270.2|      ................................................................
gi|116325993|ref|NP_001006608.2|  ................................................................
gi|61966709|ref|NP_001013648.1|   ................................................................
gi|305632814|ref|NP_001182209.1|  ................................................................
gi|13562088|ref|NP_112153.1|      ................................................................
gi|75677612|ref|NP_955372.2|      ................................................................
gi|53829385|ref|NP_443120.2|      ................................................................
gi|150378449|ref|NP_892014.1|     ................................................................
gi|59889558|ref|NP_001012331.1|   ................................................................
gi|4585712|ref|NP_002520.2|       ................................................................
gi|19743850|ref|NP_598012.1|      ................................................................
gi|148664213|ref|NP_001091989.1|  ................................................................
gi|210147571|ref|NP_001129951.1|  ................................................................
gi|115583679|ref|NP_653172.2|     ................................................................
gi|157785649|ref|NP_001099129.1|  ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|46397369|ref|NP_997002.1|      ................................................................
gi|239735605|ref|NP_060766.5|     ................................................................
gi|33469951|ref|NP_878256.1|      ................................................................
gi|53828918|ref|NP_004572.3|      ................................................................
gi|205360954|ref|NP_001009944.2|  ................................................................
gi|205360962|ref|NP_000287.3|     ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|219555702|ref|NP_001137230.1|  ................................................................
gi|219555704|ref|NP_001137231.1|  ................................................................
gi|219555700|ref|NP_001137229.1|  ................................................................
gi|55741567|ref|NP_085129.1|      ................................................................
gi|62899065|ref|NP_060610.2|      ................................................................
gi|56118210|ref|NP_001007793.1|   ................................................................
gi|6912604|ref|NP_036535.1|       ................................................................
gi|55956794|ref|NP_001007157.1|   ................................................................
gi|59889560|ref|NP_002521.2|      ................................................................
gi|59889562|ref|NP_001012338.1|   ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|14042939|ref|NP_114413.1|      ................................................................
gi|21071028|ref|NP_036536.2|      ................................................................
gi|23097240|ref|NP_690852.1|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|19743852|ref|NP_598013.1|      ................................................................
gi|223718151|ref|NP_001138779.1|  ................................................................
gi|55956790|ref|NP_001007098.1|   ................................................................
gi|65506779|ref|NP_001018076.1|   ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|65506769|ref|NP_001018075.1|   ................................................................
gi|21361306|ref|NP_006171.2|      ................................................................
gi|65506745|ref|NP_001018074.1|   ................................................................
gi|291575163|ref|NP_001167575.1|  ................................................................
gi|291575165|ref|NP_001167576.1|  ................................................................
gi|4557417|ref|NP_000582.1|       ................................................................
gi|91105159|ref|NP_001035110.1|   ................................................................
gi|4504077|ref|NP_000165.1|       ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|148664188|ref|NP_689972.3|     ................................................................
gi|4504073|ref|NP_000398.1|       ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|210147569|ref|NP_001129950.1|  ................................................................
gi|45593138|ref|NP_660299.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|8922644|ref|NP_060675.1|       ................................................................


                                                                                                    
                                                                                                    
d1xkua_                             ................................................................
gi|16904383|ref|NP_065845.1|      ................................................................
gi|110825984|ref|NP_004216.2|     ................................................................
gi|76880480|ref|NP_055632.2|      ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|256217721|ref|NP_001073982.2|  ................................................................
gi|209862903|ref|NP_001129523.1|  ................................................................
gi|42544231|ref|NP_006329.2|      ................................................................
gi|42544233|ref|NP_963924.1|      ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|13194201|ref|NP_075380.1|      ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|19743846|ref|NP_598010.1|      ................................................................
gi|4503271|ref|NP_001911.1|       ................................................................
gi|7662320|ref|NP_055628.1|       ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|157426829|ref|NP_001094861.1|  ................................................................
gi|153791330|ref|NP_065924.3|     ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|52138725|ref|NP_001004432.1|   ................................................................
gi|62912474|ref|NP_001017404.1|   ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|30425563|ref|NP_848665.1|      ................................................................
gi|50263044|ref|NP_116197.4|      ................................................................
gi|156139147|ref|NP_079269.4|     ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|197927168|ref|NP_001128217.1|  ................................................................
gi|122937309|ref|NP_001073926.1|  ................................................................
gi|22749183|ref|NP_689783.1|      ................................................................
gi|7662102|ref|NP_056379.1|       ................................................................
gi|198041768|ref|NP_852607.3|     ................................................................
gi|15029530|ref|NP_071426.1|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|4502403|ref|NP_001702.1|       ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|30425553|ref|NP_848663.1|      ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|153251229|ref|NP_001258.2|     ................................................................
gi|51317373|ref|NP_065980.1|      ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|301069322|ref|NP_060150.4|     ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|153791507|ref|NP_001093130.1|  ................................................................
gi|153792227|ref|NP_060804.3|     ................................................................
gi|153792651|ref|NP_001093128.1|  ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|12007646|ref|NP_072089.1|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|109809759|ref|NP_821079.3|     ................................................................
gi|226342935|ref|NP_001139727.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|4506013|ref|NP_002703.1|       ................................................................
gi|86990456|ref|NP_849161.2|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|187829871|ref|NP_001120716.1|  ................................................................
gi|187829877|ref|NP_001120717.1|  ................................................................
gi|62241040|ref|NP_062540.2|      ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|197333706|ref|NP_001127951.1|  ................................................................
gi|34222199|ref|NP_060573.2|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|85986601|ref|NP_067647.2|      ................................................................
gi|7019381|ref|NP_037363.1|       ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|88702793|ref|NP_612449.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|41349454|ref|NP_958505.1|      ................................................................
gi|4506041|ref|NP_002716.1|       ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|71040111|ref|NP_002014.2|      ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|19923729|ref|NP_115646.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|16418467|ref|NP_443204.1|      ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|4826876|ref|NP_005005.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|18677729|ref|NP_570718.1|      ................................................................
gi|27363458|ref|NP_076941.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|40217803|ref|NP_079337.2|      ................................................................
gi|291190772|ref|NP_000164.5|     ................................................................
gi|171846278|ref|NP_940980.3|     ................................................................
gi|260593673|ref|NP_001159530.1|  ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|308818206|ref|NP_001184225.1|  ................................................................
gi|4505047|ref|NP_002336.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|31542244|ref|NP_689660.2|      ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|46094076|ref|NP_056331.2|      ................................................................
gi|5901992|ref|NP_008966.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|38490688|ref|NP_849144.2|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|13375646|ref|NP_078785.1|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|229089140|ref|NP_001019849.2|  ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|31657138|ref|NP_000136.2|      ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|188536110|ref|NP_689824.2|     ................................................................
gi|109150416|ref|NP_036425.1|     ................................................................
gi|6912638|ref|NP_036557.1|       ................................................................
gi|55741571|ref|NP_065788.1|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|149773484|ref|NP_065913.1|     ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|139948432|ref|NP_056234.2|     ................................................................
gi|90991702|ref|NP_078928.3|      ................................................................
gi|153792305|ref|NP_001093148.1|  ................................................................
gi|190014581|ref|NP_078788.2|     ................................................................
gi|120953300|ref|NP_001073379.1|  ................................................................
gi|306140491|ref|NP_001182035.1|  wvllrdgiktskilemtnidgksqfvsyemqrnlslenaktsvlllnkvdllwddlflilqfvw
gi|306140493|ref|NP_001182036.1|  wvllrdgiktskilemtnidgksqfvsyemqrnlslenaktsvlllnkvdllwddlflilqfvw
gi|62865618|ref|NP_112218.2|      wvllrdgiktskilemtnidgksqfvsyemqrnlslenaktsvlllnkvdllwddlflilqfvw
gi|62865621|ref|NP_001017388.1|   wvllrdgiktskilemtnidgksqfvsyemqrnlslenaktsvlllnkvdllwddlflilqfvw
gi|262205665|ref|NP_001159864.1|  ................................................................
gi|5729718|ref|NP_006661.1|       ................................................................
gi|126517478|ref|NP_653252.3|     ................................................................
gi|306140495|ref|NP_001182037.1|  wvllrdgiktskilemtnidgksqfvsyemqrnlslenaktsvlllnkvdllwddlflilqfvw
gi|72534676|ref|NP_001026862.1|   ................................................................
gi|41350337|ref|NP_003254.2|      efhfildvsvktvanlelsnikcvlednkcsyflsilaklqtnpklsnltlnniettwnsfiri
gi|52426787|ref|NP_002535.3|      ................................................................
gi|193788651|ref|NP_001123362.1|  ................................................................
gi|194306618|ref|NP_001123608.1|  ................................................................
gi|194306621|ref|NP_001123609.1|  ................................................................
gi|194306623|ref|NP_001123610.1|  ................................................................
gi|39930401|ref|NP_065902.1|      ................................................................
gi|157743290|ref|NP_001099051.1|  ................................................................
gi|299782601|ref|NP_001010847.1|  ................................................................
gi|341915001|ref|XP_003403925.1|  gtnlieevae......................................................
gi|255652962|ref|NP_001157397.1|  ................................................................
gi|255652964|ref|NP_001157398.1|  ................................................................
gi|84781739|ref|NP_001034118.1|   ................................................................
gi|30181233|ref|NP_002310.2|      ................................................................
gi|194394161|ref|NP_694992.2|     ................................................................
gi|14249428|ref|NP_116162.1|      ................................................................
gi|256017174|ref|NP_001157683.1|  ................................................................
gi|41582239|ref|NP_958934.1|      ................................................................
gi|5031809|ref|NP_005536.1|       ................................................................
gi|63003903|ref|NP_963844.2|      ................................................................
gi|223005922|ref|NP_001138549.1|  ................................................................
gi|154091020|ref|NP_065922.3|     ................................................................
gi|33859670|ref|NP_055931.1|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|256017180|ref|NP_001157685.1|  ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|34577083|ref|NP_689937.2|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|33285015|ref|NP_653199.2|      ................................................................
gi|291575177|ref|NP_852111.2|     ................................................................
gi|24308207|ref|NP_065761.1|      ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|52353306|ref|NP_001005210.1|   ................................................................
gi|10190722|ref|NP_065729.1|      ................................................................
gi|59823631|ref|NP_660333.2|      ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|219521831|ref|NP_001137140.1|  ................................................................
gi|32469517|ref|NP_862830.1|      ................................................................
gi|21313638|ref|NP_060646.2|      ................................................................
gi|21389483|ref|NP_653249.1|      ................................................................
gi|61742784|ref|NP_665893.2|      ................................................................
gi|61742786|ref|NP_665894.2|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|61966761|ref|NP_001013675.1|   ................................................................
gi|153791466|ref|NP_065754.2|     ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|194018474|ref|NP_001005214.2|  ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|4826816|ref|NP_005088.1|       ................................................................
gi|38454322|ref|NP_942015.1|      ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|164607156|ref|NP_113615.2|     ................................................................
gi|191252816|ref|NP_001122108.1|  ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|21281681|ref|NP_644807.1|      ................................................................
gi|300934750|ref|NP_116166.9|     ................................................................
gi|21281673|ref|NP_644813.1|      ................................................................
gi|66912176|ref|NP_001019782.1|   ................................................................
gi|301069324|ref|NP_001180264.1|  ................................................................
gi|116268101|ref|NP_443138.2|     ................................................................
gi|318984125|ref|NP_001188295.1|  ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|312222719|ref|NP_001185947.1|  ................................................................
gi|106067657|ref|NP_000224.2|     ................................................................
gi|206725447|ref|NP_001128689.1|  ................................................................
gi|42542396|ref|NP_964013.1|      ................................................................
gi|15487670|ref|NP_006353.2|      ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|55743114|ref|NP_060161.2|      ................................................................
gi|312222716|ref|NP_001185946.1|  ................................................................
gi|193083136|ref|NP_940908.2|     ................................................................
gi|254039592|ref|NP_116564.2|     ................................................................
gi|87298937|ref|NP_008949.4|      ................................................................
gi|13430854|ref|NP_071336.1|      ................................................................
gi|14277694|ref|NP_060279.2|      ................................................................
gi|153791282|ref|NP_001093156.1|  ................................................................
gi|194272226|ref|NP_001123563.1|  ................................................................
gi|194272228|ref|NP_001123564.1|  ................................................................
gi|194272222|ref|NP_001123562.1|  ................................................................
gi|194272224|ref|NP_112584.3|     ................................................................
gi|62988340|ref|NP_001017924.1|   ................................................................
gi|68800360|ref|NP_004941.2|      ................................................................
gi|167466264|ref|NP_001006940.3|  ................................................................
gi|31377705|ref|NP_078824.2|      ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|299758423|ref|NP_001177652.1|  ................................................................
gi|53729359|ref|NP_612370.3|      ................................................................
gi|53729361|ref|NP_001005373.1|   ................................................................
gi|53729363|ref|NP_001005374.1|   ................................................................
gi|14149694|ref|NP_056428.1|      ................................................................
gi|45439342|ref|NP_689542.2|      ................................................................
gi|217330610|ref|NP_001136098.1|  ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|117414162|ref|NP_208325.3|     ................................................................
gi|19743848|ref|NP_598011.1|      ................................................................
gi|64085121|ref|NP_000360.2|      ................................................................
gi|31621309|ref|NP_036604.2|      ................................................................
gi|64085161|ref|NP_001018046.1|   ................................................................
gi|50593002|ref|NP_003081.2|      ................................................................
gi|5454088|ref|NP_006392.1|       ................................................................
gi|7657419|ref|NP_055174.1|       ................................................................
gi|5453880|ref|NP_006296.1|       ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|306922420|ref|NP_001182457.1|  ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|125625324|ref|NP_001074960.1|  ................................................................
gi|54792102|ref|NP_001005915.1|   ................................................................
gi|39930571|ref|NP_932341.1|      ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|12597641|ref|NP_075052.1|      ................................................................
gi|4826651|ref|NP_004919.1|       ................................................................
gi|15529980|ref|NP_219481.1|      ................................................................
gi|40254924|ref|NP_060979.2|      ................................................................
gi|14916498|ref|NP_148935.1|      ................................................................
gi|7661704|ref|NP_054776.1|       ................................................................
gi|16418445|ref|NP_443185.1|      ................................................................
gi|13569879|ref|NP_112182.1|      ................................................................
gi|5901898|ref|NP_008923.1|       ................................................................
gi|306966160|ref|NP_001182474.1|  ................................................................
gi|194239699|ref|NP_689928.3|     ................................................................
gi|194239701|ref|NP_001123519.1|  ................................................................
gi|13027616|ref|NP_076431.1|      ................................................................
gi|218931217|ref|NP_001136400.1|  ................................................................
gi|289547512|ref|NP_055649.4|     ................................................................
gi|28872863|ref|NP_056270.2|      ................................................................
gi|116325993|ref|NP_001006608.2|  ................................................................
gi|61966709|ref|NP_001013648.1|   ................................................................
gi|305632814|ref|NP_001182209.1|  ................................................................
gi|13562088|ref|NP_112153.1|      ................................................................
gi|75677612|ref|NP_955372.2|      ................................................................
gi|53829385|ref|NP_443120.2|      ................................................................
gi|150378449|ref|NP_892014.1|     ................................................................
gi|59889558|ref|NP_001012331.1|   ................................................................
gi|4585712|ref|NP_002520.2|       ................................................................
gi|19743850|ref|NP_598012.1|      ................................................................
gi|148664213|ref|NP_001091989.1|  ................................................................
gi|210147571|ref|NP_001129951.1|  ................................................................
gi|115583679|ref|NP_653172.2|     ................................................................
gi|157785649|ref|NP_001099129.1|  ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|46397369|ref|NP_997002.1|      ................................................................
gi|239735605|ref|NP_060766.5|     ................................................................
gi|33469951|ref|NP_878256.1|      ................................................................
gi|53828918|ref|NP_004572.3|      ................................................................
gi|205360954|ref|NP_001009944.2|  ................................................................
gi|205360962|ref|NP_000287.3|     ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|219555702|ref|NP_001137230.1|  ................................................................
gi|219555704|ref|NP_001137231.1|  ................................................................
gi|219555700|ref|NP_001137229.1|  ................................................................
gi|55741567|ref|NP_085129.1|      ................................................................
gi|62899065|ref|NP_060610.2|      ................................................................
gi|56118210|ref|NP_001007793.1|   ................................................................
gi|6912604|ref|NP_036535.1|       ................................................................
gi|55956794|ref|NP_001007157.1|   ................................................................
gi|59889560|ref|NP_002521.2|      ................................................................
gi|59889562|ref|NP_001012338.1|   ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|14042939|ref|NP_114413.1|      ................................................................
gi|21071028|ref|NP_036536.2|      ................................................................
gi|23097240|ref|NP_690852.1|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|19743852|ref|NP_598013.1|      ................................................................
gi|223718151|ref|NP_001138779.1|  ................................................................
gi|55956790|ref|NP_001007098.1|   ................................................................
gi|65506779|ref|NP_001018076.1|   ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|65506769|ref|NP_001018075.1|   ................................................................
gi|21361306|ref|NP_006171.2|      ................................................................
gi|65506745|ref|NP_001018074.1|   ................................................................
gi|291575163|ref|NP_001167575.1|  ................................................................
gi|291575165|ref|NP_001167576.1|  ................................................................
gi|4557417|ref|NP_000582.1|       ................................................................
gi|91105159|ref|NP_001035110.1|   ................................................................
gi|4504077|ref|NP_000165.1|       ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|148664188|ref|NP_689972.3|     ................................................................
gi|4504073|ref|NP_000398.1|       ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|210147569|ref|NP_001129950.1|  ................................................................
gi|45593138|ref|NP_660299.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|8922644|ref|NP_060675.1|       ................................................................


                                                                                                    
                                                                                                    
d1xkua_                             ................................................................
gi|16904383|ref|NP_065845.1|      ................................................................
gi|110825984|ref|NP_004216.2|     ................................................................
gi|76880480|ref|NP_055632.2|      ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|256217721|ref|NP_001073982.2|  ................................................................
gi|209862903|ref|NP_001129523.1|  ................................................................
gi|42544231|ref|NP_006329.2|      ................................................................
gi|42544233|ref|NP_963924.1|      ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|13194201|ref|NP_075380.1|      ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|19743846|ref|NP_598010.1|      ................................................................
gi|4503271|ref|NP_001911.1|       ................................................................
gi|7662320|ref|NP_055628.1|       ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|157426829|ref|NP_001094861.1|  ................................................................
gi|153791330|ref|NP_065924.3|     ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|52138725|ref|NP_001004432.1|   ................................................................
gi|62912474|ref|NP_001017404.1|   ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|30425563|ref|NP_848665.1|      ................................................................
gi|50263044|ref|NP_116197.4|      ................................................................
gi|156139147|ref|NP_079269.4|     ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|197927168|ref|NP_001128217.1|  ................................................................
gi|122937309|ref|NP_001073926.1|  ................................................................
gi|22749183|ref|NP_689783.1|      ................................................................
gi|7662102|ref|NP_056379.1|       ................................................................
gi|198041768|ref|NP_852607.3|     ................................................................
gi|15029530|ref|NP_071426.1|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|4502403|ref|NP_001702.1|       ................................................................
gi|62912470|ref|NP_001017403.1|   ................................................................
gi|30425553|ref|NP_848663.1|      ................................................................
gi|4504379|ref|NP_003658.1|       ................................................................
gi|153251229|ref|NP_001258.2|     ................................................................
gi|51317373|ref|NP_065980.1|      ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|301069322|ref|NP_060150.4|     ................................................................
gi|188528675|ref|NP_003052.2|     ................................................................
gi|153791507|ref|NP_001093130.1|  ................................................................
gi|153792227|ref|NP_060804.3|     ................................................................
gi|153792651|ref|NP_001093128.1|  ................................................................
gi|238908508|ref|NP_001155000.1|  ................................................................
gi|12007646|ref|NP_072089.1|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|109809759|ref|NP_821079.3|     ................................................................
gi|226342935|ref|NP_001139727.1|  ................................................................
gi|40255157|ref|NP_700356.2|      ................................................................
gi|4506013|ref|NP_002703.1|       ................................................................
gi|86990456|ref|NP_849161.2|      ................................................................
gi|194440719|ref|NP_612490.1|     ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|187829871|ref|NP_001120716.1|  ................................................................
gi|187829877|ref|NP_001120717.1|  ................................................................
gi|62241040|ref|NP_062540.2|      ................................................................
gi|225579152|ref|NP_001139478.1|  ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|197333706|ref|NP_001127951.1|  ................................................................
gi|34222199|ref|NP_060573.2|      ................................................................
gi|4826772|ref|NP_004961.1|       ................................................................
gi|85986601|ref|NP_067647.2|      ................................................................
gi|7019381|ref|NP_037363.1|       ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|88702793|ref|NP_612449.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|41349454|ref|NP_958505.1|      ................................................................
gi|4506041|ref|NP_002716.1|       ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|71040111|ref|NP_002014.2|      ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|19923729|ref|NP_115646.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|16418467|ref|NP_443204.1|      ................................................................
gi|11321571|ref|NP_003053.1|      ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|4826876|ref|NP_005005.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|18677729|ref|NP_570718.1|      ................................................................
gi|27363458|ref|NP_076941.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|40217803|ref|NP_079337.2|      ................................................................
gi|291190772|ref|NP_000164.5|     ................................................................
gi|171846278|ref|NP_940980.3|     ................................................................
gi|260593673|ref|NP_001159530.1|  ................................................................
gi|45505137|ref|NP_714914.2|      ................................................................
gi|308818206|ref|NP_001184225.1|  ................................................................
gi|4505047|ref|NP_002336.1|       ................................................................
gi|312283621|ref|NP_001186009.1|  ................................................................
gi|312283625|ref|NP_001186010.1|  ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|31542244|ref|NP_689660.2|      ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|46094076|ref|NP_056331.2|      ................................................................
gi|5901992|ref|NP_008966.1|       ................................................................
gi|54792100|ref|NP_001973.2|      ................................................................
gi|4759146|ref|NP_004778.1|       ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|38490688|ref|NP_849144.2|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|4885215|ref|NP_005226.1|       ................................................................
gi|110825958|ref|NP_001036064.1|  ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|20302168|ref|NP_619542.1|      ................................................................
gi|4507531|ref|NP_003256.1|       ................................................................
gi|13375646|ref|NP_078785.1|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|229089140|ref|NP_001019849.2|  ................................................................
gi|119395738|ref|NP_001073285.1|  ................................................................
gi|119395736|ref|NP_000199.2|     ................................................................
gi|31657138|ref|NP_000136.2|      ................................................................
gi|41327732|ref|NP_958439.1|      ................................................................
gi|41327736|ref|NP_958441.1|      ................................................................
gi|29725609|ref|NP_005219.2|      ................................................................
gi|188536110|ref|NP_689824.2|     ................................................................
gi|109150416|ref|NP_036425.1|     ................................................................
gi|6912638|ref|NP_036557.1|       ................................................................
gi|55741571|ref|NP_065788.1|      ................................................................
gi|193083139|ref|NP_001122394.1|  ................................................................
gi|5031707|ref|NP_005503.1|       ................................................................
gi|41281398|ref|NP_031399.2|      ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|4557665|ref|NP_000866.1|       ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|54792096|ref|NP_004439.2|      ................................................................
gi|54792098|ref|NP_001005862.1|   ................................................................
gi|62912472|ref|NP_067649.2|      ................................................................
gi|149773484|ref|NP_065913.1|     ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|139948432|ref|NP_056234.2|     ................................................................
gi|90991702|ref|NP_078928.3|      ................................................................
gi|153792305|ref|NP_001093148.1|  ................................................................
gi|190014581|ref|NP_078788.2|     ................................................................
gi|120953300|ref|NP_001073379.1|  ................................................................
gi|306140491|ref|NP_001182035.1|  htsvehfqirnvtfggkayldhnsfdysntvmrtiklehvhfrvfyiqqdkiyllltkmdienl
gi|306140493|ref|NP_001182036.1|  htsvehfqirnvtfggkayldhnsfdysntvmrtiklehvhfrvfyiqqdkiyllltkmdienl
gi|62865618|ref|NP_112218.2|      htsvehfqirnvtfggkayldhnsfdysntvmrtiklehvhfrvfyiqqdkiyllltkmdienl
gi|62865621|ref|NP_001017388.1|   htsvehfqirnvtfggkayldhnsfdysntvmrtiklehvhfrvfyiqqdkiyllltkmdienl
gi|262205665|ref|NP_001159864.1|  ................................................................
gi|5729718|ref|NP_006661.1|       ................................................................
gi|126517478|ref|NP_653252.3|     ................................................................
gi|306140495|ref|NP_001182037.1|  htsvehfqirnvtfggkayldhnsfdysntvmrtiklehvhfrvfyiqqdkiyllltkmdienl
gi|72534676|ref|NP_001026862.1|   ................................................................
gi|41350337|ref|NP_003254.2|      lqlvwhttvwyfsisnvklqgqldfrdfdysgtslkalsihqvvsdvfgfpqsyiyeifsnmni
gi|52426787|ref|NP_002535.3|      ................................................................
gi|193788651|ref|NP_001123362.1|  ................................................................
gi|194306618|ref|NP_001123608.1|  ................................................................
gi|194306621|ref|NP_001123609.1|  ................................................................
gi|194306623|ref|NP_001123610.1|  ................................................................
gi|39930401|ref|NP_065902.1|      ................................................................
gi|157743290|ref|NP_001099051.1|  ................................................................
gi|299782601|ref|NP_001010847.1|  ................................................................
gi|341915001|ref|XP_003403925.1|  ................................................................
gi|255652962|ref|NP_001157397.1|  ................................................................
gi|255652964|ref|NP_001157398.1|  ................................................................
gi|84781739|ref|NP_001034118.1|   ................................................................
gi|30181233|ref|NP_002310.2|      ................................................................
gi|194394161|ref|NP_694992.2|     ................................................................
gi|14249428|ref|NP_116162.1|      ................................................................
gi|256017174|ref|NP_001157683.1|  ................................................................
gi|41582239|ref|NP_958934.1|      ................................................................
gi|5031809|ref|NP_005536.1|       ................................................................
gi|63003903|ref|NP_963844.2|      ................................................................
gi|223005922|ref|NP_001138549.1|  ................................................................
gi|154091020|ref|NP_065922.3|     ................................................................
gi|33859670|ref|NP_055931.1|      ................................................................
gi|8394456|ref|NP_059138.1|       ................................................................
gi|256017180|ref|NP_001157685.1|  ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|34577083|ref|NP_689937.2|      ................................................................
gi|167555127|ref|NP_005573.2|     ................................................................
gi|33285015|ref|NP_653199.2|      ................................................................
gi|291575177|ref|NP_852111.2|     ................................................................
gi|24308207|ref|NP_065761.1|      ................................................................
gi|31657140|ref|NP_055030.1|      ................................................................
gi|52353306|ref|NP_001005210.1|   ................................................................
gi|10190722|ref|NP_065729.1|      ................................................................
gi|59823631|ref|NP_660333.2|      ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|95113664|ref|NP_060684.4|      ................................................................
gi|219521831|ref|NP_001137140.1|  ................................................................
gi|32469517|ref|NP_862830.1|      ................................................................
gi|21313638|ref|NP_060646.2|      ................................................................
gi|21389483|ref|NP_653249.1|      ................................................................
gi|61742784|ref|NP_665893.2|      ................................................................
gi|61742786|ref|NP_665894.2|      ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|61966761|ref|NP_001013675.1|   ................................................................
gi|153791466|ref|NP_065754.2|     ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|157694513|ref|NP_060960.2|     ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|221136957|ref|NP_001137475.1|  ................................................................
gi|221136961|ref|NP_001137476.1|  ................................................................
gi|221136965|ref|NP_001137477.1|  ................................................................
gi|221136969|ref|NP_001137478.1|  ................................................................
gi|221136977|ref|NP_001137480.1|  ................................................................
gi|221136981|ref|NP_001137481.1|  ................................................................
gi|221136985|ref|NP_001137482.1|  ................................................................
gi|33504581|ref|NP_115928.1|      ................................................................
gi|194018474|ref|NP_001005214.2|  ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|291219891|ref|NP_919431.2|     ................................................................
gi|4826816|ref|NP_005088.1|       ................................................................
gi|38454322|ref|NP_942015.1|      ................................................................
gi|40217817|ref|NP_443142.1|      ................................................................
gi|164607156|ref|NP_113615.2|     ................................................................
gi|191252816|ref|NP_001122108.1|  ................................................................
gi|40217823|ref|NP_056382.1|      ................................................................
gi|27436867|ref|NP_775101.1|      ................................................................
gi|296080773|ref|NP_001171678.1|  ................................................................
gi|296080775|ref|NP_001171679.1|  ................................................................
gi|40217825|ref|NP_115605.2|      ................................................................
gi|21281681|ref|NP_644807.1|      ................................................................
gi|300934750|ref|NP_116166.9|     ................................................................
gi|21281673|ref|NP_644813.1|      ................................................................
gi|66912176|ref|NP_001019782.1|   ................................................................
gi|301069324|ref|NP_001180264.1|  ................................................................
gi|116268101|ref|NP_443138.2|     ................................................................
gi|318984125|ref|NP_001188295.1|  ................................................................
gi|40217820|ref|NP_055741.2|      ................................................................
gi|312222719|ref|NP_001185947.1|  ................................................................
gi|106067657|ref|NP_000224.2|     ................................................................
gi|206725447|ref|NP_001128689.1|  ................................................................
gi|42542396|ref|NP_964013.1|      ................................................................
gi|15487670|ref|NP_006353.2|      ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|55743114|ref|NP_060161.2|      ................................................................
gi|312222716|ref|NP_001185946.1|  ................................................................
gi|193083136|ref|NP_940908.2|     ................................................................
gi|254039592|ref|NP_116564.2|     ................................................................
gi|87298937|ref|NP_008949.4|      ................................................................
gi|13430854|ref|NP_071336.1|      ................................................................
gi|14277694|ref|NP_060279.2|      ................................................................
gi|153791282|ref|NP_001093156.1|  ................................................................
gi|194272226|ref|NP_001123563.1|  ................................................................
gi|194272228|ref|NP_001123564.1|  ................................................................
gi|194272222|ref|NP_001123562.1|  ................................................................
gi|194272224|ref|NP_112584.3|     ................................................................
gi|62988340|ref|NP_001017924.1|   ................................................................
gi|68800360|ref|NP_004941.2|      ................................................................
gi|167466264|ref|NP_001006940.3|  ................................................................
gi|31377705|ref|NP_078824.2|      ................................................................
gi|21361633|ref|NP_060238.3|      ................................................................
gi|122937315|ref|NP_001073929.1|  ................................................................
gi|299758423|ref|NP_001177652.1|  ................................................................
gi|53729359|ref|NP_612370.3|      ................................................................
gi|53729361|ref|NP_001005373.1|   ................................................................
gi|53729363|ref|NP_001005374.1|   ................................................................
gi|14149694|ref|NP_056428.1|      ................................................................
gi|45439342|ref|NP_689542.2|      ................................................................
gi|217330610|ref|NP_001136098.1|  ................................................................
gi|288541295|ref|NP_001128529.2|  ................................................................
gi|117414162|ref|NP_208325.3|     ................................................................
gi|19743848|ref|NP_598011.1|      ................................................................
gi|64085121|ref|NP_000360.2|      ................................................................
gi|31621309|ref|NP_036604.2|      ................................................................
gi|64085161|ref|NP_001018046.1|   ................................................................
gi|50593002|ref|NP_003081.2|      ................................................................
gi|5454088|ref|NP_006392.1|       ................................................................
gi|7657419|ref|NP_055174.1|       ................................................................
gi|5453880|ref|NP_006296.1|       ................................................................
gi|45827729|ref|NP_056171.2|      ................................................................
gi|45827731|ref|NP_874365.2|      ................................................................
gi|306922420|ref|NP_001182457.1|  ................................................................
gi|226342933|ref|NP_001139726.1|  ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|125625324|ref|NP_001074960.1|  ................................................................
gi|54792102|ref|NP_001005915.1|   ................................................................
gi|39930571|ref|NP_932341.1|      ................................................................
gi|16751843|ref|NP_003259.2|      ................................................................
gi|12597641|ref|NP_075052.1|      ................................................................
gi|4826651|ref|NP_004919.1|       ................................................................
gi|15529980|ref|NP_219481.1|      ................................................................
gi|40254924|ref|NP_060979.2|      ................................................................
gi|14916498|ref|NP_148935.1|      ................................................................
gi|7661704|ref|NP_054776.1|       ................................................................
gi|16418445|ref|NP_443185.1|      ................................................................
gi|13569879|ref|NP_112182.1|      ................................................................
gi|5901898|ref|NP_008923.1|       ................................................................
gi|306966160|ref|NP_001182474.1|  ................................................................
gi|194239699|ref|NP_689928.3|     ................................................................
gi|194239701|ref|NP_001123519.1|  ................................................................
gi|13027616|ref|NP_076431.1|      ................................................................
gi|218931217|ref|NP_001136400.1|  ................................................................
gi|289547512|ref|NP_055649.4|     ................................................................
gi|28872863|ref|NP_056270.2|      ................................................................
gi|116325993|ref|NP_001006608.2|  ................................................................
gi|61966709|ref|NP_001013648.1|   ................................................................
gi|305632814|ref|NP_001182209.1|  ................................................................
gi|13562088|ref|NP_112153.1|      ................................................................
gi|75677612|ref|NP_955372.2|      ................................................................
gi|53829385|ref|NP_443120.2|      ................................................................
gi|150378449|ref|NP_892014.1|     ................................................................
gi|59889558|ref|NP_001012331.1|   ................................................................
gi|4585712|ref|NP_002520.2|       ................................................................
gi|19743850|ref|NP_598012.1|      ................................................................
gi|148664213|ref|NP_001091989.1|  ................................................................
gi|210147571|ref|NP_001129951.1|  ................................................................
gi|115583679|ref|NP_653172.2|     ................................................................
gi|157785649|ref|NP_001099129.1|  ................................................................
gi|288541297|ref|NP_570843.2|     ................................................................
gi|46397369|ref|NP_997002.1|      ................................................................
gi|239735605|ref|NP_060766.5|     ................................................................
gi|33469951|ref|NP_878256.1|      ................................................................
gi|53828918|ref|NP_004572.3|      ................................................................
gi|205360954|ref|NP_001009944.2|  ................................................................
gi|205360962|ref|NP_000287.3|     ................................................................
gi|38348406|ref|NP_940967.1|      ................................................................
gi|4758460|ref|NP_004479.1|       ................................................................
gi|219555702|ref|NP_001137230.1|  ................................................................
gi|219555704|ref|NP_001137231.1|  ................................................................
gi|219555700|ref|NP_001137229.1|  ................................................................
gi|55741567|ref|NP_085129.1|      ................................................................
gi|62899065|ref|NP_060610.2|      ................................................................
gi|56118210|ref|NP_001007793.1|   ................................................................
gi|6912604|ref|NP_036535.1|       ................................................................
gi|55956794|ref|NP_001007157.1|   ................................................................
gi|59889560|ref|NP_002521.2|      ................................................................
gi|59889562|ref|NP_001012338.1|   ................................................................
gi|4503743|ref|NP_002009.1|       ................................................................
gi|55770895|ref|NP_001006600.1|   ................................................................
gi|226342931|ref|NP_079101.3|     ................................................................
gi|8923909|ref|NP_061165.1|       ................................................................
gi|20143971|ref|NP_006059.2|      ................................................................
gi|14042939|ref|NP_114413.1|      ................................................................
gi|21071028|ref|NP_036536.2|      ................................................................
gi|23097240|ref|NP_690852.1|      ................................................................
gi|65301141|ref|NP_055835.2|      ................................................................
gi|19743852|ref|NP_598013.1|      ................................................................
gi|223718151|ref|NP_001138779.1|  ................................................................
gi|55956790|ref|NP_001007098.1|   ................................................................
gi|65506779|ref|NP_001018076.1|   ................................................................
gi|312283627|ref|NP_001186011.1|  ................................................................
gi|65506769|ref|NP_001018075.1|   ................................................................
gi|21361306|ref|NP_006171.2|      ................................................................
gi|65506745|ref|NP_001018074.1|   ................................................................
gi|291575163|ref|NP_001167575.1|  ................................................................
gi|291575165|ref|NP_001167576.1|  ................................................................
gi|4557417|ref|NP_000582.1|       ................................................................
gi|91105159|ref|NP_001035110.1|   ................................................................
gi|4504077|ref|NP_000165.1|       ................................................................
gi|41327734|ref|NP_958440.1|      ................................................................
gi|148664188|ref|NP_689972.3|     ................................................................
gi|4504073|ref|NP_000398.1|       ................................................................
gi|54607118|ref|NP_056356.2|      ................................................................
gi|239582714|ref|NP_005815.2|     ................................................................
gi|7706093|ref|NP_057646.1|       ................................................................
gi|210147569|ref|NP_001129950.1|  ................................................................
gi|45593138|ref|NP_660299.2|      ................................................................
gi|34577057|ref|NP_037412.2|      ................................................................
gi|19718734|ref|NP_003255.2|      ................................................................
gi|38202222|ref|NP_938205.1|      ................................................................
gi|7019383|ref|NP_037413.1|       ................................................................
gi|8922644|ref|NP_060675.1|       ................................................................


                                                                           120                 130  
                                                                             |                   |  
d1xkua_                             .....................................SV..F...NGL.....N..QMIVVELG
gi|16904383|ref|NP_065845.1|      .....................................GS..I...GKL.....K..MLVYLDMS
gi|110825984|ref|NP_004216.2|     .....................................DS..L...SCL.....S..RLRTLDVD
gi|76880480|ref|NP_055632.2|      .....................................NA..F...AQL.....G..KLRFLNLS
gi|288541297|ref|NP_570843.2|     .....................................SV..F...MQL.....P..QLNRLTLF
gi|256217721|ref|NP_001073982.2|  .....................................QV..F...SQL.....F..CLERLWLQ
gi|209862903|ref|NP_001129523.1|  .....................................GA..F...WGL.....S..NMEILQLD
gi|42544231|ref|NP_006329.2|      .....................................MN..F...RPL.....A..NLRSLVLA
gi|42544233|ref|NP_963924.1|      .....................................MN..F...RPL.....A..NLRSLVLA
gi|288541295|ref|NP_001128529.2|  .....................................SV..F...MQL.....P..QLNRLTLF
gi|54607118|ref|NP_056356.2|      .....................................GA..F...WGL.....S..KMHVLHLE
gi|55770895|ref|NP_001006600.1|   .....................................EG..I...STC.....E..NLQDLLLS
gi|13194201|ref|NP_075380.1|      .....................................AT..F...HGL.....G..RLHTLHLD
gi|8923909|ref|NP_061165.1|       .....................................EG..I...STC.....E..NLQDLLLS
gi|19743846|ref|NP_598010.1|      .....................................VT..F...NGL.....N..QMIVIELG
gi|4503271|ref|NP_001911.1|       .....................................VT..F...NGL.....N..QMIVIELG
gi|7662320|ref|NP_055628.1|       .....................................GW..L...YGL.....R..MLQQLYVS
gi|238908508|ref|NP_001155000.1|  .....................................EH..F...CSL.....I..NLKYLDLG
gi|11321571|ref|NP_003053.1|      .....................................KA..F...RGI.....T..DVKNLQLD
gi|188528675|ref|NP_003052.2|     .....................................KA..F...RGA.....T..DLKNLQLD
gi|4759146|ref|NP_004778.1|       .....................................KA..F...RGA.....V..DIKNLQLD
gi|157694513|ref|NP_060960.2|     .....................................DS..F...EGL.....V..QLRHLWLD
gi|157426829|ref|NP_001094861.1|  .....................................YT..F...QDL.....H..SLRRLEVG
gi|153791330|ref|NP_065924.3|     .....................................MN..F...KPL.....A..NLRSLVLA
gi|41281398|ref|NP_031399.2|      .....................................AE..I...GEL.....C..NLITLDVA
gi|52138725|ref|NP_001004432.1|   .....................................GA..F...GEL.....G..SLQKLEVG
gi|62912474|ref|NP_001017404.1|   .....................................KA..F...MGN.....P..LLQTIHFY
gi|21361633|ref|NP_060238.3|      .....................................AS..F...SSL.....S..SLVRLNLS
gi|30425563|ref|NP_848665.1|      .....................................DT..F...QGL.....E..RLQSLHLY
gi|50263044|ref|NP_116197.4|      .....................................YM..F...QDL.....Y..NLKSLEVG
gi|156139147|ref|NP_079269.4|     .....................................EQ..F...KGL.....R..KLIILHLR
gi|4758460|ref|NP_004479.1|       .....................................GA..F...DRL.....P..NLSSLTLS
gi|197927168|ref|NP_001128217.1|  .....................................EQ..F...KGL.....R..KLIILHLR
gi|122937309|ref|NP_001073926.1|  .....................................YA..F...NRV.....P..SLRRLDLG
gi|22749183|ref|NP_689783.1|      .....................................YM..F...QDL.....H..NLKSLEVG
gi|7662102|ref|NP_056379.1|       .....................................EL..F...YGL.....R..KLQTLHLR
gi|198041768|ref|NP_852607.3|     .....................................GT..F...VGM.....V..ALRILDLS
gi|15029530|ref|NP_071426.1|      .....................................YA..F...NRV.....P..SLMRLDLG
gi|194440719|ref|NP_612490.1|     .....................................GT..F...GAL.....G..ALATLNLA
gi|4502403|ref|NP_001702.1|       .....................................GV..F...SGL.....R..NMNCIEMG
gi|62912470|ref|NP_001017403.1|   .....................................RS..F...EGL.....S..SLRHLWLD
gi|30425553|ref|NP_848663.1|      .....................................--..-...---.....-..--------
gi|4504379|ref|NP_003658.1|       .....................................SC..F...SGL.....H..SLRHLWLD
gi|153251229|ref|NP_001258.2|     .....................................GL..L...SPL.....V..NLFILQLN
gi|51317373|ref|NP_065980.1|      .....................................YA..F...NRI.....P..SLRRLDLG
gi|4503743|ref|NP_002009.1|       .....................................TS..L...EGL.....S..NLADVDLS
gi|301069322|ref|NP_060150.4|     .....................................DT..F...KGM.....N..ALHVLEMS
gi|188528675|ref|NP_003052.2|     .....................................DS..F...TGL.....R..NVRLLSLY
gi|153791507|ref|NP_001093130.1|  .....................................MN..F...KPL.....I..NLRSLVIA
gi|153792227|ref|NP_060804.3|     .....................................MN..F...KPL.....I..NLRSLVIA
gi|153792651|ref|NP_001093128.1|  .....................................MN..F...KPL.....I..NLRSLVIA
gi|238908508|ref|NP_001155000.1|  .....................................DT..L...PSL.....K..TLRVLNLE
gi|12007646|ref|NP_072089.1|      .....................................GA..L...RGL.....A..NLTHAHLE
gi|4826772|ref|NP_004961.1|       .....................................GL..F...EGL.....G..SLWDLNLG
gi|225579152|ref|NP_001139478.1|  .....................................GL..F...EGL.....G..SLWDLNLG
gi|109809759|ref|NP_821079.3|     .....................................EQ..F...RGL.....R..KLLSLHLR
gi|226342935|ref|NP_001139727.1|  .....................................DAttF...SKL.....H..SLEYLDLS
gi|40255157|ref|NP_700356.2|      .....................................GW..L...YGL.....L..MLQELHLS
gi|4506013|ref|NP_002703.1|       .....................................EN..L...SNL.....H..QLQMLELG
gi|86990456|ref|NP_849161.2|      .....................................DL..F...HGL.....R..KLTTLHMR
gi|194440719|ref|NP_612490.1|     .....................................AA..L...RAL.....P..SLFSLHLQ
gi|45505137|ref|NP_714914.2|      .....................................LT..F...GQK.....P..NLRSVYLH
gi|187829871|ref|NP_001120716.1|  .....................................HS..I...FSL.....H..NLQEIDLK
gi|187829877|ref|NP_001120717.1|  .....................................HS..I...FSL.....H..NLQEIDLK
gi|62241040|ref|NP_062540.2|      .....................................HS..I...FSL.....H..NLQEIDLK
gi|225579152|ref|NP_001139478.1|  .....................................QV..F...RGL.....G..KLHSLHLE
gi|45827729|ref|NP_056171.2|      .....................................DG..F...TQL.....R..SLAHLALN
gi|45827731|ref|NP_874365.2|      .....................................DG..F...TQL.....R..SLAHLALN
gi|122937315|ref|NP_001073929.1|  .....................................GS..F...RCL.....V..NLRFLDLS
gi|197333706|ref|NP_001127951.1|  .....................................HA..I...FSL.....S..NLQELDLK
gi|34222199|ref|NP_060573.2|      .....................................HA..I...FSL.....S..NLQELDLK
gi|4826772|ref|NP_004961.1|       .....................................QV..F...RGL.....G..KLHSLHLE
gi|85986601|ref|NP_067647.2|      .....................................PT..F...YGL.....N..SLILLVLM
gi|7019381|ref|NP_037363.1|       .....................................MA..F...QNL.....T..SLERLIVD
gi|119395738|ref|NP_001073285.1|  .....................................--..-...---.....-..--------
gi|119395736|ref|NP_000199.2|     .....................................--..-...---.....-..--------
gi|62912472|ref|NP_067649.2|      .....................................RS..F...EGL.....S..SLRHLWLD
gi|88702793|ref|NP_612449.2|      .....................................GA..F...DTL.....D..RLLELKLQ
gi|4557665|ref|NP_000866.1|       .....................................--..-...---.....-..--------
gi|41349454|ref|NP_958505.1|      .....................................GV..F...SKL.....E..NLLLLDLQ
gi|4506041|ref|NP_002716.1|       .....................................GV..F...SKL.....E..NLLLLDLQ
gi|38202222|ref|NP_938205.1|      .....................................PS..L...QGL.....T..SLKRLVLD
gi|7019383|ref|NP_037413.1|       .....................................PS..L...QGL.....T..SLKRLVLD
gi|312283621|ref|NP_001186009.1|  .....................................LT..F...GQK.....P..NLRSVYLH
gi|312283625|ref|NP_001186010.1|  .....................................LT..F...GQK.....P..NLRSVYLH
gi|71040111|ref|NP_002014.2|      .....................................NA..L...EGL.....E..NLTALYLQ
gi|312283627|ref|NP_001186011.1|  .....................................NV..L...TPI.....R..SLEYLLLH
gi|19923729|ref|NP_115646.2|      .....................................HA..V...FSL.....L..SLQELDLK
gi|95113664|ref|NP_060684.4|      .....................................ES..F...PEL.....Q..NLTCLSVN
gi|16418467|ref|NP_443204.1|      .....................................SW..L...HGL.....K..ALGHLDLS
gi|11321571|ref|NP_003053.1|      .....................................DT..F...AGL.....S..SVRLLSLY
gi|226342933|ref|NP_001139726.1|  .....................................LT..F...GEK.....P..ALRSVYLH
gi|4826876|ref|NP_005005.1|       .....................................NA..M...DGL.....V..NLTMLDLC
gi|54792100|ref|NP_001973.2|      .....................................--..-...---.....-..--------
gi|18677729|ref|NP_570718.1|      .....................................RL..F...TGL.....N..SLFFLSMV
gi|27363458|ref|NP_076941.2|      .....................................-S..L...RGP.....V..NLQHLILS
gi|34577057|ref|NP_037412.2|      .....................................HA..F...KGL.....N..SLRRLVLD
gi|8394456|ref|NP_059138.1|       .....................................QQ..L...CS-.....T..SLRALDFS
gi|40217803|ref|NP_079337.2|      .....................................EH..V...RKL.....R..SLEQLYLS
gi|291190772|ref|NP_000164.5|     .....................................--..-...---.....-..--------
gi|171846278|ref|NP_940980.3|     .....................................CS..P...LRL.....K..ELKILNLS
gi|260593673|ref|NP_001159530.1|  .....................................RL..F...TGL.....N..SLFFLSMV
gi|45505137|ref|NP_714914.2|      .....................................GA..L...VGM.....A..QLRELYLT
gi|308818206|ref|NP_001184225.1|  .....................................ES..L...SDL.....N..QLVTLELE
gi|4505047|ref|NP_002336.1|       .....................................GS..F...EGL.....V..NLTFIHLQ
gi|312283621|ref|NP_001186009.1|  .....................................GA..L...VGM.....A..QLRELYLT
gi|312283625|ref|NP_001186010.1|  .....................................GA..L...VGM.....A..QLRELYLT
gi|41327732|ref|NP_958439.1|      .....................................--..-...---.....-..--------
gi|41327736|ref|NP_958441.1|      .....................................--..-...---.....-..--------
gi|7706093|ref|NP_057646.1|       .....................................SR..T...MES.....E..SLRTLEFR
gi|29725609|ref|NP_005219.2|      .....................................--..-...---.....-..--------
gi|31542244|ref|NP_689660.2|      .....................................DM..F...SGL.....S..NLHHLILN
gi|110825958|ref|NP_001036064.1|  .....................................--..-...---.....-..--------
gi|4885215|ref|NP_005226.1|       .....................................--..-...---.....-..--------
gi|46094076|ref|NP_056331.2|      .....................................SA..F...TTH.....SqgRALHVDLS
gi|5901992|ref|NP_008966.1|       .....................................GT..F...SNL.....E..NLTLLDLQ
gi|54792100|ref|NP_001973.2|      .....................................--..-...---.....-..--------
gi|4759146|ref|NP_004778.1|       .....................................DS..F...IGL.....S..SVRLLSLY
gi|4507531|ref|NP_003256.1|       .....................................NS..F...ALV.....P..SLQRLMLR
gi|38490688|ref|NP_849144.2|      .....................................--..-...---.....-..--------
gi|65301141|ref|NP_055835.2|      .....................................PT..L...VEH.....I..PLEVLDLQ
gi|193083139|ref|NP_001122394.1|  .....................................--..-...---.....-..--------
gi|5031707|ref|NP_005503.1|       .....................................--..-...---.....-..--------
gi|4885215|ref|NP_005226.1|       .....................................--..-...-QF.....Q..SLKEISAG
gi|110825958|ref|NP_001036064.1|  .....................................--..-...-QF.....Q..SLKEISAG
gi|291219891|ref|NP_919431.2|     .....................................ER..L...ER-.....T..SVEVLDVQ
gi|20302168|ref|NP_619542.1|      .....................................KY..N...LES.....K..SLVELVFS
gi|4507531|ref|NP_003256.1|       .....................................NP..F...VKQ.....K..NLITLDLS
gi|13375646|ref|NP_078785.1|      .....................................GQ..L...RGL.....V..NLRHLILS
gi|167555127|ref|NP_005573.2|     .....................................QA..F...KEC.....P..QLELLDLA
gi|31657140|ref|NP_055030.1|      .....................................--..-...---.....-..--------
gi|41327734|ref|NP_958440.1|      .....................................--..-...---.....-..--------
gi|229089140|ref|NP_001019849.2|  .....................................--..-...---.....-..--------
gi|119395738|ref|NP_001073285.1|  .....................................ES..L...KD-.....-..--------
gi|119395736|ref|NP_000199.2|     .....................................ES..L...KD-.....-..--------
gi|31657138|ref|NP_000136.2|      .....................................EA..F...QNL.....P..NLQYLLIS
gi|41327732|ref|NP_958439.1|      .....................................--..-...---.....-..--------
gi|41327736|ref|NP_958441.1|      .....................................--..-...---.....-..--------
gi|29725609|ref|NP_005219.2|      .....................................--..-...---.....-..--------
gi|188536110|ref|NP_689824.2|     .....................................RA..F...ACF.....P..ALQLLNLS
gi|109150416|ref|NP_036425.1|     .....................................DS..F...QHL.....P..KLERLFLH
gi|6912638|ref|NP_036557.1|       .....................................RG..F...GSL.....P..ALEVLDLT
gi|55741571|ref|NP_065788.1|      .....................................DT..L...RGL.....V..NLQHLIVN
gi|193083139|ref|NP_001122394.1|  .....................................YT..F...ANL.....A..SLQRLNLQ
gi|5031707|ref|NP_005503.1|       .....................................YT..F...ANL.....A..SLQRLNLQ
gi|41281398|ref|NP_031399.2|      .....................................ED..V...SGL.....V..SLEVLILS
gi|54792096|ref|NP_004439.2|      .....................................--..-...---.....-..--------
gi|4557665|ref|NP_000866.1|       .....................................--..-...---.....-..--------
gi|54792098|ref|NP_001005862.1|   .....................................--..-...---.....-..--------
gi|54792096|ref|NP_004439.2|      .....................................--..-...---.....-..--------
gi|54792098|ref|NP_001005862.1|   .....................................--..-...---.....-..--------
gi|62912472|ref|NP_067649.2|      .....................................GM..C...Q--.....-..--------
gi|149773484|ref|NP_065913.1|     .....................................DQ..L...RGL.....G..NLRHLILG
gi|16751843|ref|NP_003259.2|      .....................................--..-...---.....-..--------
gi|139948432|ref|NP_056234.2|     .....................................QA..F...NGL.....T..SLRLLHLE
gi|90991702|ref|NP_078928.3|      .....................................LF..L...HSF.....K..SLNSLNVS
gi|153792305|ref|NP_001093148.1|  .....................................PE..L...LAL.....R..GLRTLLAK
gi|190014581|ref|NP_078788.2|     .....................................PE..L...GDC.....E..NLERLDCS
gi|120953300|ref|NP_001073379.1|  .....................................CG..L...ESL.....K..NLQQLILD
gi|306140491|ref|NP_001182035.1|  ...tisnaqmphmlfpnyptkfqylnfanniltdelfKR..T...IQL.....P..HLKTLILN
gi|306140493|ref|NP_001182036.1|  ...tisnaqmphmlfpnyptkfqylnfanniltdelfKR..T...IQL.....P..HLKTLILN
gi|62865618|ref|NP_112218.2|      ...tisnaqmphmlfpnyptkfqylnfanniltdelfKR..T...IQL.....P..HLKTLILN
gi|62865621|ref|NP_001017388.1|   ...tisnaqmphmlfpnyptkfqylnfanniltdelfKR..T...IQL.....P..HLKTLILN
gi|262205665|ref|NP_001159864.1|  .....................................--..-...---.....-..--------
gi|5729718|ref|NP_006661.1|       .....................................--..-...---.....-..--------
gi|126517478|ref|NP_653252.3|     .....................................ET..F...GDL.....L..RLERLFLH
gi|306140495|ref|NP_001182037.1|  ...tisnaqmphmlfpnyptkfqylnfanniltdelfKR..T...IQL.....P..HLKTLILN
gi|72534676|ref|NP_001026862.1|   .....................................CE..I...ET-.....-..LISMLQIP
gi|41350337|ref|NP_003254.2|      knftvsgtrmvhmlcpskispflhldfsnnlltdtvfEN..C...GHL.....T..ELETLILQ
gi|52426787|ref|NP_002535.3|      .....................................SD..T...AYQ.....W..NLKYLDVS
gi|193788651|ref|NP_001123362.1|  .....................................GA..C...DGL.....Q..NLILLNLN
gi|194306618|ref|NP_001123608.1|  .....................................--..-...---.....-..--------
gi|194306621|ref|NP_001123609.1|  .....................................--..-...---.....-..--------
gi|194306623|ref|NP_001123610.1|  .....................................--..-...---.....-..--------
gi|39930401|ref|NP_065902.1|      .....................................--..-...---.....-..--------
gi|157743290|ref|NP_001099051.1|  .....................................AE..L...SLC.....R..KLEVLSLS
gi|299782601|ref|NP_001010847.1|  .....................................DA..F...ETL.....E..SLQVLELN
gi|341915001|ref|XP_003403925.1|  .....................................GA..L...SHI.....H..SLSVLVLS
gi|255652962|ref|NP_001157397.1|  .....................................GL..F...DGL.....L..ALRSLSLR
gi|255652964|ref|NP_001157398.1|  .....................................GL..F...DGL.....L..ALRSLSLR
gi|84781739|ref|NP_001034118.1|   .....................................GL..F...DGL.....L..ALRSLSLR
gi|30181233|ref|NP_002310.2|      .....................................PD..I...GTL.....G..SLRQLDVS
gi|194394161|ref|NP_694992.2|     .....................................ST..F...GQL.....S..ALKTLSLS
gi|14249428|ref|NP_116162.1|      .....................................EE..I...GHL.....R..HLMELDVS
gi|256017174|ref|NP_001157683.1|  .....................................EE..I...GQL.....K..QLMELDVS
gi|41582239|ref|NP_958934.1|      .....................................--..-...---.....-..--------
gi|5031809|ref|NP_005536.1|       .....................................--..-...---.....-..--------
gi|63003903|ref|NP_963844.2|      .....................................PE..L...GQL.....Q..NLQILALD
gi|223005922|ref|NP_001138549.1|  .....................................DG..L...CRL.....P..RLTRLYLG
gi|154091020|ref|NP_065922.3|     .....................................EE..I...GKL.....K..DLMELDIS
gi|33859670|ref|NP_055931.1|      .....................................EE..I...GQL.....K..QLMELDVS
gi|8394456|ref|NP_059138.1|       .....................................AS..L...AGL.....H..ALRFLFMD
gi|256017180|ref|NP_001157685.1|  .....................................EE..I...GQL.....K..QLMELDVS
gi|27436867|ref|NP_775101.1|      .....................................--..-...---.....-..--KKLHVN
gi|296080773|ref|NP_001171678.1|  .....................................--..-...---.....-..--KKLHVN
gi|296080775|ref|NP_001171679.1|  .....................................--..-...---.....-..--KKLHVN
gi|34577083|ref|NP_689937.2|      .....................................RG..F...GSL.....P..ALEVLDLT
gi|167555127|ref|NP_005573.2|     .....................................IP..V...HNL.....E..NLESLYLG
gi|33285015|ref|NP_653199.2|      .....................................PE..I...GRL.....R..ALRHLRLA
gi|291575177|ref|NP_852111.2|     .....................................--..-...---.....-..--------
gi|24308207|ref|NP_065761.1|      .....................................AE..P...PGL.....P..QLQSLNLS
gi|31657140|ref|NP_055030.1|      .....................................--..-...---.....-..--------
gi|52353306|ref|NP_001005210.1|   .....................................QA..F...QGL.....M..QLRDLDLS
gi|10190722|ref|NP_065729.1|      .....................................--..-...---.....-..--------
gi|59823631|ref|NP_660333.2|      .....................................--..-...---.....-..--------
gi|40217820|ref|NP_055741.2|      .....................................--..-...---.....-..--KKLYLS
gi|95113664|ref|NP_060684.4|      .....................................DG..I...GKL.....K..KLSILKVD
gi|219521831|ref|NP_001137140.1|  .....................................AV..F...QEL.....K..VLEVLLLY
gi|32469517|ref|NP_862830.1|      .....................................AV..F...QEL.....K..VLEVLLLY
gi|21313638|ref|NP_060646.2|      .....................................--..-...---.....-..--------
gi|21389483|ref|NP_653249.1|      .....................................CD..L...SAY.....H..ALTKLILD
gi|61742784|ref|NP_665893.2|      .....................................EA..L...GAL.....P..ALTFLTVT
gi|61742786|ref|NP_665894.2|      .....................................EA..L...GAL.....P..ALTFLTVT