SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

L domain-like alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0053646 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1xwdc1               chh...........................................................................
ENSBTAP00000021162  gdievlnlgnngleevpdglgsalgslrvlvlrrnrfaqlpqavaelghhlteldvshnrlsvlgaea..........
ENSBTAP00000043657  tdiifvetsftvvgsrafssspnltkvvflntrvchfrpdafgglpglqdleitggnfsnfsadifsnlislskftln
ENSBTAP00000055611  ppwaqpvcpercdcqhpqhllctnrglravpktsslpspqdvltyslggnfisnitafd...................
ENSBTAP00000033782  lknlrklhinrnylvkipeyishlnnmfslefsgnfitdfpieiksckniakvelsynkimyfplgl...........
ENSBTAP00000011238  tsnitllslvhniipeinaevfqfy.....................................................
ENSBTAP00000000533  efpeniknckvltvveasvnpisklpdgfsqllnltqlylndafleflpanfgrltklqilelrenqlkml.......
ENSBTAP00000004562  v.............................................................................
ENSBTAP00000049967  pahfthfsnlkelqlhgnhleyipdgvfdhlvgltklnlgknslthls..............................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  pc............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  pg............................................................................
ENSBTAP00000030722  sshivslflqhnrirsvegrqlkaylslhvldlsanniteirstcfphglpltelnlasnristlesgafdgls....
ENSBTAP00000001560  qlcvceirpwftpqstyreattvdcndlrltripsnlssdtqvlllqsnniaktvd......................
ENSBTAP00000010138  ensmrldlskrsihil..............................................................
ENSBTAP00000023310  ipes..........................................................................
ENSBTAP00000016755  rc............................................................................
ENSBTAP00000002883  l.............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  anqnlsfnaserw.................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  a.............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  c.............................................................................
ENSBTAP00000017631  frslsalqamtlalnkihhipdyafgnlsslvvlhlhnnrihslgkk...............................
ENSBTAP00000018866  a.............................................................................
ENSBTAP00000044462  m.............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  nc............................................................................
ENSBTAP00000047707  nc............................................................................
ENSBTAP00000028386  cpqnchchsdlqhvicdkvglqkipkvsektkllnlqrnnfpvlaa................................
ENSBTAP00000050251  c.............................................................................
ENSBTAP00000009633  c.............................................................................
ENSBTAP00000005771  tprsiymeastvdcndlglsnfparlpadtqilllqtnniakieysidfp............................
ENSBTAP00000034926  st............................................................................
ENSBTAP00000016317  sgc...........................................................................
ENSBTAP00000021517  knsgv.........................................................................
ENSBTAP00000033782  lpsdnftinlkakglqefpkdilkvkyvkylyldeneiksfkgadsr...............................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  tdel..........................................................................
ENSBTAP00000017571  nl............................................................................
ENSBTAP00000055923  ssverrc.......................................................................
ENSBTAP00000012294  isvldyshcslqqvpkevfnfertleelyldanqieel........................................
ENSBTAP00000044542  flgm..........................................................................
ENSBTAP00000017322  lelhlfmlsgipdtvfdlvelevlklelipdvtippsiaqltglkelwlyhtaakieapalaflrenlralhikftdi
ENSBTAP00000001045  edvdlnhyrigkiegfevlkkvktlclrqnlikcien.........................................
ENSBTAP00000016614  atigcprdc.....................................................................
ENSBTAP00000028517  f.............................................................................
ENSBTAP00000027912  hlfmlsgvpdavfdltdldvlklelipeaklpakisqmtnlqelhlchcpakveqtafsflrdhlrclhvkftdvaei
ENSBTAP00000016858  gpcpkvchllegektidsvtsaqelrgctiingsliinirggnnlaaeleanlglieeisgylkirrsya........
ENSBTAP00000017631  m.............................................................................
ENSBTAP00000023709  psa...........................................................................
ENSBTAP00000028690  gpcpkvceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvkirhsh.........
ENSBTAP00000055273  nq............................................................................
ENSBTAP00000003618  lavef.........................................................................
ENSBTAP00000053607  k.............................................................................
ENSBTAP00000004298  i.............................................................................
ENSBTAP00000019854  cdcppnfpt.....................................................................
ENSBTAP00000047764  cdcppnfpt.....................................................................
ENSBTAP00000011082  plwrcnrhvesvdkrhcslqavpeeiyrysrsleellldanqlrel................................
ENSBTAP00000001193  nrlelplimlsglpdtvfeitelqslkleiiknvmipatiaqldnlqelslhqcsvkihsaalsflkenlkvlsvkfd
ENSBTAP00000020135  pq............................................................................
ENSBTAP00000013620  s.............................................................................
ENSBTAP00000034140  ytpr..........................................................................
ENSBTAP00000007981  cp............................................................................
ENSBTAP00000054502  qdlktk........................................................................
ENSBTAP00000015726  lps...........................................................................
ENSBTAP00000053353  slraskfqshmkhsesmsslpsereyitsldlsanelkdvdalsqnscisghlehleklelhqnaltsfpqqlcetlk
ENSBTAP00000015704  ec............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  rlelalcmlpglpdtvfelsevealrleaigditfppglsqlvhlqelsllhsparlpfssqiflrdrlkvirikcee
ENSBTAP00000011445  c.............................................................................
ENSBTAP00000024223  f.............................................................................
ENSBTAP00000048641  ewktl.........................................................................
ENSBTAP00000013790  pcgglcpkacegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipaldpeklnvfrtvreitgylni
ENSBTAP00000006460  gnkd..........................................................................
ENSBTAP00000056481  e.............................................................................
ENSBTAP00000004800  l.............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  wdtlqqvatitfqdlpgcslstlaecpnlqflslrrcgltslh...................................
ENSBTAP00000029890  c.............................................................................
ENSBTAP00000002279  ncapecncpes...................................................................
ENSBTAP00000012650  pfleslslhdcylerighvafqeqarlrslalpdnalsesyketaaa...............................
ENSBTAP00000019066  e.............................................................................
ENSBTAP00000015445  kcdgpcgkvcngigigefkdtlsinatnikhfrnctsisgdlhilpvafrgdsftrtapldpkeldilrtvk......
ENSBTAP00000013790  vcpgtlnglsvtgdaenqyqtlhklyekcevvmgnleivltghnadlsflqwirevtgyvlvamnefstlplpnlrvv
ENSBTAP00000053668  pctdicpkacdgigtgslmsaqtvdssnidkfinctkingnliflvtgihgdpynaieaidpeklnvfrtvreitgfl
ENSBTAP00000056022  lphvtqldlrdnklegldavvftnlevlhcernqlvtlnacgcflkalyassnelvqldvcpvpnylsymdvsrncle
ENSBTAP00000003973  glcpkeckvgtktidsvqaaqdlvgcthvegslilnlrqgynlelelqrslglvetitgflkikhsfalvslgffknl
ENSBTAP00000053245  sqr...........................................................................
ENSBTAP00000000176  l.............................................................................
ENSBTAP00000008348  svesinlqkhrfsdlsss............................................................
ENSBTAP00000026919  velhlfmlnglpdnvfelteievlslelipevklpsaisqlvslkelhvyhsslvvdhpalaflee............
ENSBTAP00000041110  ylki..........................................................................
ENSBTAP00000007883  k.............................................................................
ENSBTAP00000048971  rl............................................................................
ENSBTAP00000054723  rc............................................................................
ENSBTAP00000016858  vcpgmdirnnltrlhelancsvieg.....................................................
ENSBTAP00000006543  a.............................................................................
ENSBTAP00000007981  ga............................................................................
ENSBTAP00000000073  s.............................................................................
ENSBTAP00000011445  isltslpkiddfs.................................................................
ENSBTAP00000053488  s.............................................................................
ENSBTAP00000055429  acphp.........................................................................
ENSBTAP00000029877  acphp.........................................................................
ENSBTAP00000023907  cpky..........................................................................
ENSBTAP00000053245  sgfslrtlyansnrlttvnvypvpslltslelsrnllecv......................................
ENSBTAP00000039209  ev............................................................................
ENSBTAP00000054898  cphpca........................................................................
ENSBTAP00000010138  st............................................................................
ENSBTAP00000002052  kwshlklpwvdldwlidi............................................................
ENSBTAP00000055075  i.............................................................................
ENSBTAP00000046486  is............................................................................
ENSBTAP00000001716  k.............................................................................
ENSBTAP00000015445  nkltqlgtfedhflslqrmfnncevvlgnleitymqssynlsflktiqevagyvlialntvekiplenlqi.......
ENSBTAP00000048314  lqslmldannienvegplalphlkhlsmennklhlipas.......................................
ENSBTAP00000054662  klislddktilslaktsvyg..........................................................
ENSBTAP00000016614  gih...........................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  al............................................................................
ENSBTAP00000018658  irsiyifcsivtsvrsgaselpeerel...................................................
ENSBTAP00000008412  glrvl.........................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  rl............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  rhlyqgcqvvqgnleltylpadaslsflqeiqevqgyvliahnrvsqvplqrl.........................
ENSBTAP00000001716  qp............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  lrempld.......................................................................
ENSBTAP00000025116  v.............................................................................
ENSBTAP00000041953  fe............................................................................
ENSBTAP00000007913  d.............................................................................
ENSBTAP00000033684  ce............................................................................
ENSBTAP00000055758  q.............................................................................
ENSBTAP00000023771  hacpag........................................................................
ENSBTAP00000000700  rle...........................................................................
ENSBTAP00000043299  cgc...........................................................................
ENSBTAP00000042745  fq............................................................................
ENSBTAP00000045371  papcfckthpsdl.................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  q.............................................................................
ENSBTAP00000013364  ptactcnlqisdlgl...............................................................
ENSBTAP00000029056  pcapvcyglgmehlrevravtsaniqefagckkfgslaflpesfagdpdsniaplqaeqlkvfesleeitgylyisaw
ENSBTAP00000056022  ylrwfdksprvas.................................................................
ENSBTAP00000003973  evcpsldirsdvaelrrlencsvveghlqillmftatgedfrglsfprltqvtdylllfrvygleslrdlfpnla...
ENSBTAP00000006219  lppr..........................................................................
ENSBTAP00000018722  vs............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  as............................................................................
ENSBTAP00000023124  di............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  fnnisel.......................................................................
ENSBTAP00000000604  dimrnfsnaingsqifslvltrhimgssfgfsnlkdpdyhtfagla................................
ENSBTAP00000035880  v.............................................................................
ENSBTAP00000056147  en............................................................................
ENSBTAP00000026157  slprlrslvlkggqrrealgaclrgslat.................................................
ENSBTAP00000020944  s.............................................................................
ENSBTAP00000049290  nnr...........................................................................
ENSBTAP00000019433  tt............................................................................
ENSBTAP00000056147  dng...........................................................................
ENSBTAP00000002199  e.............................................................................
ENSBTAP00000054101  phn...........................................................................
ENSBTAP00000008348  tekegn........................................................................
ENSBTAP00000009238  sr............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ycpipcnckvlsp.................................................................
ENSBTAP00000049290  h.............................................................................
ENSBTAP00000013364  lseispprfp....................................................................
ENSBTAP00000025189  p.............................................................................
ENSBTAP00000021183  piekmdas......................................................................
ENSBTAP00000014533  piidge........................................................................
ENSBTAP00000056496  st............................................................................
ENSBTAP00000045371  venv..........................................................................
ENSBTAP00000014977  yvkleikdrdltdihll.............................................................
ENSBTAP00000005757  f.............................................................................
ENSBTAP00000056192  r.............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ldfqnil.......................................................................
ENSBTAP00000012486  lkpeqveqlklimskrydgsqqaldlkglrsdpdlvaqnidvvlnrrscmaatlriiee...................
ENSBTAP00000022047  g.............................................................................
ENSBTAP00000017907  vvnwsgqglqklspn...............................................................
ENSBTAP00000048314  hcpgrcs.......................................................................
ENSBTAP00000006996  lrpekmeklklafnkrfdvsqqsldlqklrfdpnlmghdieii...................................
ENSBTAP00000053866  kyien.........................................................................
ENSBTAP00000010504  f.............................................................................
ENSBTAP00000007874  k.............................................................................
ENSBTAP00000010530  v.............................................................................
ENSBTAP00000024223  pcelqph.......................................................................
ENSBTAP00000006480  fpy...........................................................................
ENSBTAP00000017067  i.............................................................................
ENSBTAP00000032951  t.............................................................................
ENSBTAP00000052860  cecrqeddfrvtc.................................................................
ENSBTAP00000004335  n.............................................................................
ENSBTAP00000006011  p.............................................................................
ENSBTAP00000016410  mdkrihlelrnrt.................................................................
ENSBTAP00000018286  l.............................................................................
ENSBTAP00000018076  elieqaaqyt....................................................................
ENSBTAP00000045522  vifs..........................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  sk............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  relvldncksndgki...............................................................
ENSBTAP00000022049  g.............................................................................
ENSBTAP00000053639  ys............................................................................
ENSBTAP00000011082  l.............................................................................
ENSBTAP00000055544  rnaln.........................................................................
ENSBTAP00000056065  rnaln.........................................................................
ENSBTAP00000021280  nalnlkgffllnc.................................................................
ENSBTAP00000000604  aiyl..........................................................................
ENSBTAP00000002392  km............................................................................
ENSBTAP00000026102  se............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  gl............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  e.............................................................................
ENSBTAP00000049967  cpse..........................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  cpptcrcafrd...................................................................
ENSBTAP00000008412  qvsdrif.......................................................................
ENSBTAP00000022237  apeevt........................................................................
ENSBTAP00000023088  rslss.........................................................................
ENSBTAP00000024242  sv............................................................................
ENSBTAP00000014881  env...........................................................................
ENSBTAP00000002011  fds...........................................................................
ENSBTAP00000044218  eenv..........................................................................
ENSBTAP00000053049  t.............................................................................
ENSBTAP00000053271  hcvkd.........................................................................
ENSBTAP00000055995  lvdkell.......................................................................
ENSBTAP00000005490  lvdkell.......................................................................
ENSBTAP00000055569  lvdkell.......................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  tf............................................................................
ENSBTAP00000023886  t.............................................................................
ENSBTAP00000004849  tf............................................................................
ENSBTAP00000041497  esilllklrg....................................................................
ENSBTAP00000003980  lpga..........................................................................
ENSBTAP00000015158  la............................................................................
ENSBTAP00000002402  ldeegirrlgaltleqpelveslslqgsyagk..............................................
ENSBTAP00000056550  ipgtyqek......................................................................
ENSBTAP00000027480  padat.........................................................................
ENSBTAP00000007444  t.............................................................................
ENSBTAP00000025849  eniiedqkdfvfvkfsglh...........................................................
ENSBTAP00000000533  vt............................................................................
ENSBTAP00000045403  dvf...........................................................................
ENSBTAP00000045610  lce...........................................................................
ENSBTAP00000014097  en............................................................................
ENSBTAP00000021517  yfpen.........................................................................
ENSBTAP00000053704  en............................................................................
ENSBTAP00000042391  qenwedctnlnlsfqdlgdpyqvenf....................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  r.............................................................................
ENSBTAP00000006728  llhw..........................................................................
ENSBTAP00000030722  a.............................................................................
ENSBTAP00000026919  i.............................................................................
ENSBTAP00000049498  t.............................................................................
ENSBTAP00000026139  daalap........................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  lksekveqmkltinkpydvhqqsldiqrllfgpdlmiydigm....................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  tceklekikfpgdlitrgigmtwnlrnsmaaslhvypgirp.....................................
ENSBTAP00000043818  ltsekleqikltmnkpydacqqaldiqrlhfgpdlitrgigmtwnrrnsmaaslhvypgirpm...............
ENSBTAP00000030439  qiklpgdlmtcdigmtqncrngmaasihihpgirpl..........................................
ENSBTAP00000053958  hnylhgitf.....................................................................
ENSBTAP00000022955  cl............................................................................
ENSBTAP00000030440  ltsekleqikltmnkpydacqqaldiqrlrfgpdlitrgigmtwnrrnsmaaslhvypgirp................
ENSBTAP00000054502  t.............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  mpl...........................................................................


                                                                         10        20               
                                                                          |         |               
d1xwdc1               ..........................................---RICHC.SNRVFLCQESKVTE...IPSDL.....
ENSBTAP00000021162  ..........................................---VGALR.ELRKLNLSHNQLPA...LPAQLga...
ENSBTAP00000043657  .......fnmlealpeglfqhmdgleslqlqgnrlqtlpqrl---FQPLR.CLKTLNLAQNLLAY...LPEELfhp..
ENSBTAP00000055611  ..........................................---FHRLG.QLRRLDLQYNQIRSl..HPKTFek...
ENSBTAP00000033782  ..........................................----CALD.SLHYLSLNGNYISE...IPVDIsf...
ENSBTAP00000011238  ..........................................-------P.ALETLDLSSNQISE...IKTSSfp...
ENSBTAP00000000533  ..........................................PKTMNRLT.QLERLDLGSNEFTE...VPEVLeq...
ENSBTAP00000004562  ..........................................-CPFRCQC.HLRVVQCSDLGLEK...VPKDL.....
ENSBTAP00000049967  ..........................................PRVFQRLS.NLQVLRLYENRLSD...IPMGCfdg..
ENSBTAP00000050839  ..........................................---CDCTS.QPQAVLCAHRRLEA...VPGGL.....
ENSBTAP00000003370  ..........................................-----SCD.GDRRVDCSGKGLTA...VPEGL.....
ENSBTAP00000053607  ..........................................-CPAQCSC.SGSTVDCHGLALRS...VPRNI.....
ENSBTAP00000054397  ..........................................--ACVCYSePKVTTSCPQQGLQA...VPADI.....
ENSBTAP00000030722  ..........................................-------R.SLLTLRLSKNRITQ...LPVKAfk...
ENSBTAP00000001560  ..........................................--ELQQLF.NLTELDFSQNNFTN...IKEVGlan..
ENSBTAP00000010138  ..........................................PSSIKELT.QLTELYLYSNKLQS...LPAEVgc...
ENSBTAP00000023310  ..........................................---ISFCK.ALQIADFSGNPLTR...LPESFpe...
ENSBTAP00000016755  ..........................................PMLCTCYP.APPTVSCQANNFSA...VPRAL.....
ENSBTAP00000002883  ..........................................PEHLRQFQ.SLETLDLSGNNISE...LKTALp....
ENSBTAP00000043683  ..........................................---CECSA.QDRAVLCHRKRFVA...VPEGI.....
ENSBTAP00000010846  ..........................................----WEQT.DLTKLIISNNKLQS...LTDDLrl...
ENSBTAP00000021903  ..........................................---CECTA.QTRAVACPRRRLTA...VPDGI.....
ENSBTAP00000000484  ..........................................-CPKNCRC.DGKIVYCESHAFAD...IPENI.....
ENSBTAP00000055691  ..........................................---CECSA.QNKSVSCHRRRLIA...IPEGI.....
ENSBTAP00000040907  ..........................................PAACSCSN.QASRVICTRRELAE...VPASI.....
ENSBTAP00000017631  ..........................................--CFDGLH.SLETLDLNYNNLDE...FPTAVrt...
ENSBTAP00000018866  ..........................................-CPPKCRC.EKLLFYCDSQGFHS...VPNTT.....
ENSBTAP00000044462  ..........................................-CPFGCHC.HLRVVQCSDLGLKA...VPKEI.....
ENSBTAP00000006288  ..........................................PCRCREAG.ILLWVDCSERGLST...VPAGL.....
ENSBTAP00000056438  ..........................................PSVCSCSN.QFSKVVCTRRGLSE...VPQGI.....
ENSBTAP00000047707  ..........................................PSVCSCSN.QFSKVVCTRRGLSE...VPQGI.....
ENSBTAP00000028386  ..........................................-NSFRAMP.NLVSLHLQHCQIRE...VAAGAfrg..
ENSBTAP00000050251  ..........................................PQACVCDN.PRRHVACRHQNLTE...VPTAI.....
ENSBTAP00000009633  ..........................................PSVCSCSN.QFSKVICVRKNLRD...VPDGI.....
ENSBTAP00000005771  ..........................................-------V.NLTGLDLSQNNLSS...VTNINvkk..
ENSBTAP00000034926  ..........................................-CPFGCQC.YSRVVHCSDLGLSS...VPSNI.....
ENSBTAP00000016317  ..........................................PRDCVCYP.APMTVSCQAHNFAA...IPEGI.....
ENSBTAP00000021517  ..........................................PDDIFKLD.DLSVLDLSYNQLTE...CPRELen...
ENSBTAP00000033782  ..........................................-----DML.GLEILSIQKNGLST...LPSEIql...
ENSBTAP00000053488  ..........................................-CPHKCRC.EASMVECSSLKLTK...IPERV.....
ENSBTAP00000022459  ..........................................-CPKGCRC.EGKMVYCESQKLQE...IPSSI.....
ENSBTAP00000044542  ..........................................--------.---SVFCSSRNLTQ...LPGGL.....
ENSBTAP00000017571  ..........................................---FQKLV.HLQELFLNQNQLAF...LPASLfth..
ENSBTAP00000055923  ..........................................--------.---SVRCDRAGLLR...VPAEF.....
ENSBTAP00000012294  ..........................................PKQLFNCQ.ALKKLSIPDNDLSN...LPTTIas...
ENSBTAP00000044542  ..........................................-------K.ALRWLDLSHNRVGSl..LEDSFpg...
ENSBTAP00000017322  .....keiplwiyslktleelhltgnlsaennrfividglre------LK.RLKVLRLKS-NLSK...LPQVVtdv..
ENSBTAP00000001045  ..........................................---LEGLQ.SLRELDLYDNQIRR...IENLDa....
ENSBTAP00000016614  ..........................................-----ACS.QEGVVDCGGIDLRE...FPGDL.....
ENSBTAP00000028517  ..........................................PAELHNVQ.SVHTVYLYGNQLDE...FPMNL.....
ENSBTAP00000027912  .pawvyllknlrelylignlnsennkmigleslrelrhlkil--------.-----H-VKSNLTK...VPSNItdv..
ENSBTAP00000016858  ..........................................--------.--------------...-----.....
ENSBTAP00000017631  ..........................................--------.-LLRVDCSDLGLSE...LPSNL.....
ENSBTAP00000023709  ..........................................--------.----LYCDSRNLRK...VPV-I.....
ENSBTAP00000028690  ..........................................--------.--------------...-----.....
ENSBTAP00000055273  ..........................................--------.-PRTVFCTARRGTT...VPLDV.....
ENSBTAP00000003618  ..........................................--------.---------FNLTQ...LPADFlqg..
ENSBTAP00000053607  ..........................................-----CRC.EGTTVDCSNQKLTK...IPDHI.....
ENSBTAP00000004298  ..........................................PSDLKNLL.KVERIYLYHNSLDE...FPTNL.....
ENSBTAP00000019854  ..........................................--------.---AMYCDNRNLKY...LPF-V.....
ENSBTAP00000047764  ..........................................--------.---AMYCDNRNLKY...LPF-V.....
ENSBTAP00000011082  ..........................................PKPFFRLL.NLRKLGLSDNEIQR...LPPEVan...
ENSBTAP00000001193  ....dmrelppwmyglrnleelylvgslshdisrnvtleslr-----DLK.SLKILSIKS-NVSK...IPQAVvdv..
ENSBTAP00000020135  ..........................................----RCVC.KGTELECVNAGLKS...VPV-V.....
ENSBTAP00000013620  ..........................................-PPMQCIC.QGLELECDEINLRA...VPS-V.....
ENSBTAP00000034140  ..........................................----SSYR.EATTVDCNDLFLTA...VPPAL.....
ENSBTAP00000007981  ..........................................--PRCSCP.RPDTVDCDGLDLRV...FPDNI.....
ENSBTAP00000054502  ..........................................-------V.NVQVIYLYENDLDE...FPVNL.....
ENSBTAP00000015726  ..........................................----MCSL.SYKTISCISADLTQ...IPPLT.....
ENSBTAP00000053353  clthldlhsnkftslptyllkmncianldvsrndigpsvvld--PAVKCP.TLKQFNLSYNQISS...LPANLgdv..
ENSBTAP00000015704  ..........................................---FCPPN.FPSSMYCDNRKLKT...IPN-I.....
ENSBTAP00000049410  ..........................................PCICQNLS.ESLSTLCAHRGLLF...VPPNV.....
ENSBTAP00000005636  .......lrevplwvfglrgleelhleglfppelaraatles---LRELK.QLKVLSLRSNAGKV...PASVTdv...
ENSBTAP00000011445  ..........................................------TV.RHEVADCSHLKLTQ...IPDDL.....
ENSBTAP00000024223  ..........................................--------.---TLDLSRNNLVT...IQQEMftr..
ENSBTAP00000048641  ..........................................PSSLLKLN.QLQEWQLHRIGLLK...IPEFIgr...
ENSBTAP00000013790  .............................qswpphmhnfsvf--------.--------------...-----.....
ENSBTAP00000006460  ..........................................--------.SQVEVNCENKGLKA...PPPDL.....
ENSBTAP00000056481  ..........................................--------.----VHCTFRYLTS...IPESI.....
ENSBTAP00000004800  ..........................................--------.------CAKKGLLF...VPPNI.....
ENSBTAP00000050251  ..........................................PRTCVCVP.ESRHSSCEGRGLQA...VPRGF.....
ENSBTAP00000040019  ..........................................--SLSNCK.RLKYIDAQENHIET...INCEN.....
ENSBTAP00000029890  ..........................................------YM.YGQTLDLSRNNIFFi..KPSDFqh...
ENSBTAP00000002279  ..........................................--------.YPSAMYCDELKLKS...VPM-V.....
ENSBTAP00000012650  ..........................................---LHGLR.GLRMLDLSGNSLTEd..M-AALmlqn.
ENSBTAP00000019066  ..........................................--CFCPPS.FPTALYCENRGLKE...IPA-I.....
ENSBTAP00000015445  ..........................................--------.--------------...-----.....
ENSBTAP00000013790  ................................rgtqvydgkf--------.--------------...-----.....
ENSBTAP00000053668  ..........................niqswppnmtdfsvfs--------.--------------...-----.....
ENSBTAP00000056022  ........................................nvPEWVCESR.KLEVLDIGHNQICE...LPARLfc...
ENSBTAP00000003973  .............................klirgdtmvdgny--------.--------------...-----.....
ENSBTAP00000053245  ..........................................--------.-ISTVDLSCHSLEE...VPEHLfy...
ENSBTAP00000000176  ..........................................--------.---SVLCPGAGLLF...VPPSL.....
ENSBTAP00000008348  ..........................................--TFRCFT.RVQELDLTAAHLNG...LPSGIeg...
ENSBTAP00000026919  ..........................................--------.NLKILRLKFTEMGK...IPRWVfh...
ENSBTAP00000041110  ..........................................--------.--TALNLDGQHLFE...ITNLEk....
ENSBTAP00000007883  ..........................................--------.---IVILNGKNITK...MPSVLek...
ENSBTAP00000048971  ..........................................-----CHC.SNGVFLCQESKVTE...IPSDL.....
ENSBTAP00000054723  ..........................................PAPCECSE.AARTVKCVNRNLTE...VPADL.....
ENSBTAP00000016858  ..........................................--------.--------------...-----.....
ENSBTAP00000006543  ..........................................-CPAACRC.YSATVECGALRLRV...VPPGI.....
ENSBTAP00000007981  ..........................................---LRPLR.GLHTLHLYGNRLDR...VPQAL.....
ENSBTAP00000000073  ..........................................PCEWLPVA.GVTTLTFVNRGLER...LPGCL.....
ENSBTAP00000011445  ..........................................---FQWLK.CLEYLNMDDNNFPG...IKRNTftg..
ENSBTAP00000053488  ..........................................-CPAMCAC.SNGIVDCRGKGLTA...IPANL.....
ENSBTAP00000055429  ..........................................-----CACyVPSEVHCTFRSLAS...VPAGI.....
ENSBTAP00000029877  ..........................................-----CACyVPSEVHCTFRSLAS...VPAGI.....
ENSBTAP00000023907  ..........................................-CVCQNLS.ESLGTLCPSKGLLF...VPPDI.....
ENSBTAP00000053245  ..........................................PDWACEAK.KIEILDVSYNLLTE...VPMRIls...
ENSBTAP00000039209  ..........................................--------.-----DMSDRGISNmldINGLFt....
ENSBTAP00000054898  ..........................................------CY.VPSEVHCTFRSLAS...VPAGI.....
ENSBTAP00000010138  ..........................................--------.--------------...-----.....
ENSBTAP00000002052  ..........................................------SC.QITELDLSANCLAS...LPSVVpwg..
ENSBTAP00000055075  ..........................................---CQNVA.PTLTMLCAKTGLLF...VPPAI.....
ENSBTAP00000046486  ..........................................-CPSACTC.SNNIVDCRGKGLTE...IPANL.....
ENSBTAP00000001716  ..........................................--------.---EVWCQGRGLLQ...VPSVL.....
ENSBTAP00000015445  ..........................................--------.--------------...-----.....
ENSBTAP00000048314  ..........................................--FFTSLQ.SLQFLSFSSNFLTK...IPINL.....
ENSBTAP00000054662  ..........................................--------.HIVSLNLHGNSLSK...LRDLSk....
ENSBTAP00000016614  ..........................................PRAFQGLK.RLHTVHLYNNALER...VPSGL.....
ENSBTAP00000006288  ..........................................--------.---------NQLHE...FPVAIqt...
ENSBTAP00000035220  ..........................................---CICTE.RHRHVDCSGRNLTT...LPSGL.....
ENSBTAP00000044349  ..........................................--------.--LRLLLPHNRLVS...LPRALgsg..
ENSBTAP00000018658  ..........................................--------.---TTNFSSMSLTK...VPEGL.....
ENSBTAP00000008412  ..........................................--------.--------------...-----.....
ENSBTAP00000029331  ..........................................--------.-----DCSGLGLTA...PPPDL.....
ENSBTAP00000043328  ..........................................-----CHC.SNGVFLCQESKVTE...IPSDL.....
ENSBTAP00000003445  ..........................................--------.-----------LRE...VPEGL.....
ENSBTAP00000029056  ..........................................--------.--------------...-----.....
ENSBTAP00000001716  ..........................................------LS.QLLNLDLSYNEIEL...VPEGFlep..
ENSBTAP00000037062  ..........................................--------.---TLNLSNRRLKH...FPRGAarsyd
ENSBTAP00000025497  ..........................................--------.--RMVDLSGSQLRR...FPVHVcs...
ENSBTAP00000025116  ..........................................--------.----LSLSGRKLRE...FPRGAanhd.
ENSBTAP00000041953  ..........................................--------.------LSGDHWKE...FPDSLke...
ENSBTAP00000007913  ..........................................--------.-----------LQA...VPSGF.....
ENSBTAP00000033684  ..........................................---VYTYL.HEKYLDCQERKLVY...VLPDW.....
ENSBTAP00000055758  ..........................................--------.----LELSGRRLRR...LPSAVca...
ENSBTAP00000023771  ..........................................----CACT.DPHTVDCRDRGLPS...VPDPF.....
ENSBTAP00000000700  ..........................................--------.KHKNLFLNYRNLQH...FPLELlkdeg
ENSBTAP00000043299  ..........................................PERCRCHS.PSNSVDCSRQGLAE...IPSDL.....
ENSBTAP00000042745  ..........................................--------.------LKDRGLTE...FPSELqkl..
ENSBTAP00000045371  ..........................................--------.-GLSVNCQEKNIQS...MSELIpk...
ENSBTAP00000046486  ..........................................-CPDRCRC.EGTIVDCSNQKLAR...IPSHL.....
ENSBTAP00000056638  ..........................................--------.--------------...-----.....
ENSBTAP00000013364  ..........................................--------.---NVNCQERKIES...IAELQpk...
ENSBTAP00000029056  .................pdslpdlsvfqnlrvirgrvlhdga--------.--------------...-----.....
ENSBTAP00000056022  ..........................................-------Q.RISSVDLSCCSLEH...LPANLfy...
ENSBTAP00000003973  ..........................................--------.--------------...-----.....
ENSBTAP00000006219  ..........................................--------.--------------...-----.....
ENSBTAP00000018722  ..........................................-CPASCLC.ASNILSCSKQQLPN...VPHSL.....
ENSBTAP00000003370  ..........................................--------.---------NNLGE...FPQAIka...
ENSBTAP00000005510  ..........................................-CPVLCTC.HNQAVDCSGQRLFS...VPPEL.....
ENSBTAP00000023124  ..........................................--------.--------------...-----.....
ENSBTAP00000003856  ..........................................--------.------LSKNRLVE...VPMELch...
ENSBTAP00000002625  ..........................................-CPTACIC.ATDIVSCTNKNLSR...VPGNL.....
ENSBTAP00000052577  ..........................................--------.--------------...----Lpr...
ENSBTAP00000000604  ..........................................--------.--------------...-----.....
ENSBTAP00000035880  ..........................................--------.----VDMSKTSLIH...VPKDL.....
ENSBTAP00000056147  ..........................................--------.-VLNINCENKGFTT...VSLLQpp...
ENSBTAP00000026157  ..........................................--------.--------------...-----.....
ENSBTAP00000020944  ..........................................--------.----LTLSDLDLTD...VSILCg....
ENSBTAP00000049290  ..........................................--------.----------NVSS...LADLKpk...
ENSBTAP00000019433  ..........................................--------.-----NCSFAGKHE...IPMDI.....
ENSBTAP00000056147  ..........................................--------.--LNVNCQERKFTN...ISDLQpk...
ENSBTAP00000002199  ..........................................--------.----VICTGIQLTE...YPSDI.....
ENSBTAP00000054101  ..........................................-CPHKCVC.AADLLDCAGLGLRE...VPVTL.....
ENSBTAP00000008348  ..........................................--------.--RTYNCENLGLRE...IPDTL.....
ENSBTAP00000009238  ..........................................--------.---AVLCNDLDMNE...VPTNF.....
ENSBTAP00000006107  ..........................................--------.--------------...-----.....
ENSBTAP00000005757  ..........................................--------.SGLLIHCQERNIES...LSDLKpp...
ENSBTAP00000049290  ..........................................--------.----VDCEKKGFTS...LQRFTap...
ENSBTAP00000013364  ..........................................--------.--------------...-----.....
ENSBTAP00000025189  ..........................................--------.--------------...-----.....
ENSBTAP00000021183  ..........................................--------.--------------...-----.....
ENSBTAP00000014533  ..........................................--------.--------------...-----.....
ENSBTAP00000056496  ..........................................--------.--------------...-----.....
ENSBTAP00000045371  ..........................................--------.--LYVNCEKVSVYR...PNQLKpp...
ENSBTAP00000014977  ..........................................----RSYI.HLRYVDVSENHLTD...LSPLNh....
ENSBTAP00000005757  ..........................................--------.--------------...-----.....
ENSBTAP00000056192  ..........................................--------.--------------...-----.....
ENSBTAP00000009548  ..........................................--------.--------------...IPQHI.....
ENSBTAP00000052577  ..........................................PCYCEVKE.SLFHIHCDSKGFTN...ISQITef...
ENSBTAP00000011591  ..........................................--------.--------------...-----.....
ENSBTAP00000012486  ..........................................--------.--------------...-----.....
ENSBTAP00000022047  ..........................................--------.--------------...-----.....
ENSBTAP00000017907  ..........................................---LPCEA.DIHTLILDKNQIIK...LENLEk....
ENSBTAP00000048314  ..........................................--------.CDSEQSVQCYRLTE...VPSGI.....
ENSBTAP00000006996  ..........................................--------.--------------...-----.....
ENSBTAP00000053866  ..........................................--------.--------------...-----.....
ENSBTAP00000010504  ..........................................PTCLLCTC.ISTTVYCDDHELDA...IPP-L.....
ENSBTAP00000007874  ..........................................--------.---RLDLSKMGITT...FPKCIlr...
ENSBTAP00000010530  ..........................................--------.--------------...-----.....
ENSBTAP00000024223  ..........................................--------.--GQVDCNWLFLKS...VPHFSagap.
ENSBTAP00000006480  ..........................................--------.SLEHLQTSYCGLVR...VDMRMlc...
ENSBTAP00000017067  ..........................................--------.--------------...-----.....
ENSBTAP00000032951  ..........................................--------.----LKCVSISLGE...IPRNL.....
ENSBTAP00000052860  ..........................................--------.---------KDIQS...IPS-L.....
ENSBTAP00000004335  ..........................................--------.--------------...-----.....
ENSBTAP00000006011  ..........................................--------.--------------...-----.....
ENSBTAP00000016410  ..........................................--------.--------------...-----.....
ENSBTAP00000018286  ..........................................PTCLICVC.LGSSVYCDDADLEN...IPP-L.....
ENSBTAP00000018076  ..........................................-----NAV.RDRELDLRGYKIPV...IENLGat...
ENSBTAP00000045522  ..........................................--------.--------------...-----.....
ENSBTAP00000046486  ..........................................-CPEQCTC.VETVVRCSNRGLRA...LPKGI.....
ENSBTAP00000031247  ..........................................--------.--------------...-----.....
ENSBTAP00000024223  ..........................................PGALLGLG.NLTHLSLKYNNLTE...VPRRL.....
ENSBTAP00000028486  ..........................................--------.--------------...-----.....
ENSBTAP00000022049  ..........................................--------.--------------...-----.....
ENSBTAP00000053639  ..........................................--------.-------------L...IPANI.....
ENSBTAP00000011082  ..........................................--------.--------------...-----.....
ENSBTAP00000055544  ..........................................--------.--------------...-----.....
ENSBTAP00000056065  ..........................................--------.--------------...-----.....
ENSBTAP00000021280  ..........................................--------.--------------...-PDLTpl...
ENSBTAP00000000604  ..........................................--------.--------SCNLTQ...VPQ-V.....
ENSBTAP00000002392  ..........................................--------.--------------...-----.....
ENSBTAP00000026102  ..........................................------LH.SVRKLNCWGSRLTD...ISICRe....
ENSBTAP00000053488  ..........................................--------.--------------...-----.....
ENSBTAP00000054460  ..........................................--------.--------------...-----.....
ENSBTAP00000015694  ..........................................PTCLLCVC.LSGSVYCEEVDIDA...VPP-L.....
ENSBTAP00000007978  ..........................................--------.--------------...-----.....
ENSBTAP00000049967  ..........................................----CTCS.RASQVECTGARIAV...VPTPL.....
ENSBTAP00000055245  ..........................................PTCLLCVC.LSGSVYCEEVDIDA...VPP-L.....
ENSBTAP00000044315  ..........................................--------.----VTCSNANLKE...IPRDL.....
ENSBTAP00000017571  ..........................................--------.---AAQCSRGTVAG...IAALGl....
ENSBTAP00000008412  ..........................................--------.--------------...-----.....
ENSBTAP00000022237  ..........................................--------.--------------...-----.....
ENSBTAP00000023088  ..........................................--------.--------------...-----.....
ENSBTAP00000024242  ..........................................--------.----LVLNSCGITC...AGDEKeiaaf
ENSBTAP00000014881  ..........................................---LQYLK.KITHINFSDKNIDA...IEDLSl....
ENSBTAP00000002011  ..........................................-------F.SLTRVGCSGLGPHI...VPVPI.....
ENSBTAP00000044218  ..........................................---LQYLK.KITHINFSDKNIDA...IEDLSl....
ENSBTAP00000053049  ..........................................--------.----FRCSQAGLSA...VPTSI.....
ENSBTAP00000053271  ..........................................--------.--------------...-----.....
ENSBTAP00000055995  ..........................................--------.--------------...-----.....
ENSBTAP00000005490  ..........................................--------.--------------...-----.....
ENSBTAP00000055569  ..........................................--------.--------------...-----.....
ENSBTAP00000023769  ..........................................--------.----VHCSARGLQE...VPRDI.....
ENSBTAP00000054129  ..........................................--------.--------------...-----.....
ENSBTAP00000023886  ..........................................--------.--------------...-----.....
ENSBTAP00000004849  ..........................................--------.--------------...-----.....
ENSBTAP00000041497  ..........................................--------.--------------...-----.....
ENSBTAP00000003980  ..........................................--------.--------------...-----.....
ENSBTAP00000015158  ..........................................--------.--------------...-----.....
ENSBTAP00000002402  ..........................................--------.--------------...-----.....
ENSBTAP00000056550  ..........................................--------.--------------...-----.....
ENSBTAP00000027480  ..........................................--------.--------------...-----.....
ENSBTAP00000007444  ..........................................--------.----LDLAECKLVS...FPVGIykvlr
ENSBTAP00000025849  ..........................................--------.--------------...-----.....
ENSBTAP00000000533  ..........................................--------.--------------...-----.....
ENSBTAP00000045403  ..........................................--------.--------------...-----.....
ENSBTAP00000045610  ..........................................--------.----------NARS...IPRTV.....
ENSBTAP00000014097  ..........................................--------.--------------...-----.....
ENSBTAP00000021517  ..........................................--------.--------------...-----.....
ENSBTAP00000053704  ..........................................--------.--------------...-----.....
ENSBTAP00000042391  ..........................................--------.--------------...-----.....
ENSBTAP00000002883  ..........................................--------.----LDCSRQRLAH...LPEPL.....
ENSBTAP00000019525  ..........................................--------.--------------...-----.....
ENSBTAP00000006728  ..........................................--------.--------------...-----.....
ENSBTAP00000030722  ..........................................----ACTC.AGDYLDCGGRGLAA...LPGDL.....
ENSBTAP00000026919  ..........................................--------.--------------...-----.....
ENSBTAP00000049498  ..........................................--------.--------------...-----.....
ENSBTAP00000026139  ..........................................--------.--------------...-----.....
ENSBTAP00000046486  ..........................................--------.--------------...-----.....
ENSBTAP00000026263  ..........................................--------.--------------...-----.....
ENSBTAP00000056597  ..........................................--------.--------------...-----.....
ENSBTAP00000046208  ..........................................--------.--------------...-----.....
ENSBTAP00000043818  ..........................................--------.--------------...-----.....
ENSBTAP00000030439  ..........................................--------.--------------...-----.....
ENSBTAP00000053958  ..........................................--------.--------------...-----.....
ENSBTAP00000022955  ..........................................--------.--------------...-----.....
ENSBTAP00000030440  ..........................................--------.--------------...-----.....
ENSBTAP00000054502  ..........................................-CPSVCRC.DNGFIYCNDRGLTS...IPADI.....
ENSBTAP00000004298  ..........................................PCPSVCRC.DAGFIYCNDRFLTS...IPTGI.....
ENSBTAP00000041674  ..........................................-------D.SVRWLDLQNCSLKD...PGPNFpq...


                         30             40                  50             60                       
                          |              |                   |              |                       
d1xwdc1               ..PRNAIELRFVLT.....KLRV.IQ......K...GAFS...GFGD..LEKIEISQNDV...............LEV
ENSBTAP00000021162  ..LVHLEELDVSFN.....RLAH.LP......D...S-FA...GLSR..LRTLDVDHNQ-...............LTA
ENSBTAP00000043657  ..LGRLQTLRLSNN.....QLAS.LP......R...GLFS...RLGS..LQELFLDGNS-...............ISE
ENSBTAP00000055611  ..LSRLEELYLGNN.....LLQA.LA......P...GTLA...PLRK..LRILYANGNE-...............IGR
ENSBTAP00000033782  ..NKQLLHLEFNEN.....KLLL.F-......S...EHLC...SLIN..LEYLDLGKNK-...............IRK
ENSBTAP00000011238  ..RMQLKYLNLSNN.....RITV.LE......A...GCFD...NLSSs.LLVVKLNRNR-...............ISM
ENSBTAP00000000533  ..LSGLKEFWMDGN.....RLTF.IP......-...GFIG...SLKQ..LTYLDISKNN-...............IEM
ENSBTAP00000004562  ..PPDTALLDLQNN.....KITE.IK......D...GDFK...NLKN..LHTLILINNK-...............ISK
ENSBTAP00000049967  ..LSNLQELALQQN.....QIGM.LS......P...GLFH...NNRN..LQKLYLSNNH-...............ISQ
ENSBTAP00000050839  ..PLDTELLDLSGN.....RLWG.LQ......Q...GMLS...RLGQ..LRELDLSYNQ-...............LST
ENSBTAP00000003370  ..SAFTQLLDISMN.....NITQ.LP......E...DAFK...NFPF..LEELRLAGND-...............LSF
ENSBTAP00000053607  ..PRNTERLDLNGN.....NITR.IT......K...TDFA...GLRH..LRVLQLMENK-...............ITT
ENSBTAP00000054397  ..PAASQRVFLHGN.....RIAY.VP......A...ASFR...ACRN..LTILWLHSNA-...............LAH
ENSBTAP00000030722  ..LPRLTQLDLNRN.....RIRL.IE......G...LTFQ...GLDS..LEVLRLQRNN-...............ISK
ENSBTAP00000001560  ..LTQLTTLHLEEN.....QITE.MN......D...YCLQ...DLSN..LQELYINHNQ-...............IST
ENSBTAP00000010138  ..LVNLMTLALSEN.....SLTS.LP......D...S-LD...NLKK..LRMLDLRHNK-...............LRE
ENSBTAP00000023310  ..LQNLTCLSVNDI.....SLQS.LP......E...N-IG...NLYN..LASLELRENL-...............LTY
ENSBTAP00000016755  ..PPGTQRLFLQNN.....LIGA.LR......P...GSFG...--PS..LLTLWLFSNN-...............LSA
ENSBTAP00000002883  ..PLQLKYLYINSN.....RVTS.ME......P...GYFD...NLASt.LLVLKLNRNR-...............ISA
ENSBTAP00000043683  ..PTETRLLDLGKN.....RIKT.LN......Q...DEFA...SFPH..LEELELNENI-...............VSA
ENSBTAP00000010846  ..LPALTVLDIHDN.....QLTS.LP......S...A-IR...ELEN..LQKLNVSHNK-...............LKI
ENSBTAP00000021903  ..PAETRLLELSRN.....RIRC.LN......P...GDLA...ALPL..LEELDLSENV-...............IAH
ENSBTAP00000000484  ..SGGSQGLSLRFN.....SIQK.LK......S...NQFA...SLNQ..LIWLYLDHNY-...............ISS
ENSBTAP00000055691  ..PIETKILDLSKN.....RLKS.IN......P...EEFI...SYPL..LEEIDLSDNI-...............IAN
ENSBTAP00000040907  ..PVNTRYLNLQEN.....GIQV.IR......T...DTFK...HLRH..LEILQLSKNL-...............VRK
ENSBTAP00000017631  ..LSNLKELGFHSN.....NIKS.IP......E...KAFV...GNPS..LITIHFYDNP-...............IQL
ENSBTAP00000018866  ..DKGSLGLSLRHN.....HITE.LE......R...DQFA...SFSQ..LTWLHLDHNQ-...............IST
ENSBTAP00000044462  ..SPDTTLLDLQNN.....DISE.LR......K...DDFK...GLQH..LYALVLVNNK-...............ISK
ENSBTAP00000006288  ..DPLTAYLDLSMN.....SLTE.LW......P...GVFH...HLRF..LEELRLSGNR-...............LAH
ENSBTAP00000056438  ..PSNTRYLNLMEN.....NIQM.IQ......A...DTFR...HLHH..LEVLQLGRNS-...............IRQ
ENSBTAP00000047707  ..PSNTRYLNLMEN.....NIQM.IQ......A...DTFR...HLHH..LEVLQLGRNS-...............IRQ
ENSBTAP00000028386  ..LKQLIYLYLSHN.....DIRV.LR......A...GAFD...DLTE..LTYLYLDHNK-...............VTE
ENSBTAP00000050251  ..PELTQRLDLQGN.....MLKE.IP......P...AAFR...DLPH..LTHLDLRRCQ-...............VEL
ENSBTAP00000009633  ..STNTRLLNLHEN.....QIQI.IK......V...NSFK...HLRH..LEILQLSRNH-...............IRT
ENSBTAP00000005771  ..MPQLLSVYLEEN.....KLTE.LP......E...KCLS...GLSN..LQELYINHNL-...............LST
ENSBTAP00000034926  ..PFDTRMVDLQNN.....KIKE.IK......E...NDFK...GLTS..LYALILNNNK-...............LTK
ENSBTAP00000016317  ..PEDSERIFLQNN.....HITL.LR......Q...GHFS...--PA..MVTLWIYSNN-...............ITF
ENSBTAP00000021517  ..AKNMLVLNLSHN.....SIDS.IP......N...QLFI...NLTD..LLYLDLSENR-...............LES
ENSBTAP00000033782  ..LHNLKLLNVSYN.....QISH.IP......K...E-IS...QLGN..IKELFLNNNC-...............IED
ENSBTAP00000053488  ..PQATAELRLNNN.....EISI.LE......At..GMFK...KLTH..LKKINLSNNK-...............VSE
ENSBTAP00000022459  ..SAGCLGLSLRYN.....SLQK.LK......Y...NQFK...GLNQ..LTWLYLDHNH-...............ISN
ENSBTAP00000044542  ..PPGTRALWLDGN.....NFSS.IP......A...AAFR...NLSG..LGFLNLQGSG-...............LAS
ENSBTAP00000017571  ..LGNLKLLDLSGN.....NLTH.LP......E...GLFG...VQVK..LQKLLLHSNR-...............LAS
ENSBTAP00000055923  ..PCEAASIDLDRN.....GLRF.LG......E...RAFG...TLPS..LRRLSLRHNN-...............LSF
ENSBTAP00000012294  ..LVNLKELDISKN.....GVQE.FP......E...N-IK...CCKC..LTIIEASVNP-...............ISK
ENSBTAP00000044542  ..LLGLHVLRLSHN.....VLAG.LR......P...RTFK...DLHF..LEELQLGHNR-...............LRQ
ENSBTAP00000017322  ..GVHLQKLSINNE.....GTKL.IV......L...NSLK...KMAN..LTELELIRCD-...............LER
ENSBTAP00000001045  ..LTELEVLDISFN.....LLRN.IE......G...--ID...KLTR..LKKLFLVNNK-...............INK
ENSBTAP00000016614  ..PEHTNHLSLQNN.....QLEK.IY......P...RELS...RLHR..LETLNLQNNR-...............LTS
ENSBTAP00000028517  ..PKNVRVLHLQEN.....NIQT.IS......R...AALA...QLLK..LEELHLDDNS-...............IST
ENSBTAP00000027912  ..APHLTKLVIHND.....GTKL.LV......L...NSLK...KMMN..VAELELQNCE-...............LER
ENSBTAP00000016858  ..------------.....----.--......-...--LV...SLSF..FRKLRLIRGE-...............TLE
ENSBTAP00000017631  ..SVFTSYLDLSMN.....NISQ.LP......P...SPLH...SLRF..LEELRLAGNA-...............LTY
ENSBTAP00000023709  ..PSRIHYLYLQNN.....FITE.LP......V...ESFK...NATG..LRWINLDNNR-...............IRK
ENSBTAP00000028690  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000055273  ..PPDTVGLYIFEN.....GITT.LD......A...GSFA...GLPG..LQLLDLSQNQ-...............IAS
ENSBTAP00000003618  ..VPNLQELHLSSN.....RLED.FS......P...KFLL...PVPQ..LKVLDLTRNS-...............LTG
ENSBTAP00000053607  ..PQYTAELRLNNN.....EFTV.LE......At..GIFK...KLPQ..LRKINFSNNK-...............ITD
ENSBTAP00000004298  ..PKYVKELHLQEN.....NIRT.IT......Y...DSLS...KIPY..LEELHLDDNS-...............VSA
ENSBTAP00000019854  ..PSRMKYVYFQNN.....QISS.IQ......E...GVFD...NATG..LLWIALHGNQ-...............ITS
ENSBTAP00000047764  ..PSRMKYVYFQNN.....QISS.IQ......E...GVFD...NATG..LLWIALHGNQ-...............ITS
ENSBTAP00000011082  ..FMQLVELDVSRN.....DIPE.IP......E...S-IK...FCKA..LEIADFSGNP-...............LSR
ENSBTAP00000001193  ..SSHLQKMCIHND.....GTKL.VM......L...NNLK...KMTN..LTELELVHCD-...............LER
ENSBTAP00000020135  ..SSNVTLLSLKKN.....NIHS.LS......D...KVFI...KYTE..LKKIFLQRNC-...............ITY
ENSBTAP00000013620  ..SSNVTFMSLRRN.....LIRK.LP......P...NVFK...RYHG..LQTLCLQNNK-...............IRS
ENSBTAP00000034140  ..PAGTQTLLLQSN.....SIVR.VD......Q...SELG...YLAN..LTELDLSQNS-...............FSD
ENSBTAP00000007981  ..TRAAQHLSLQNN.....QLQE.LP......Y...NELS...RLSG..LRTLNLHNNL-...............ISS
ENSBTAP00000054502  ..PRSLRELHLQDN.....NVRT.IA......R...DSLA...RIPL..LEKLHLDDNSV...............-ST
ENSBTAP00000015726  ..APEITSLELIDN.....SITS.IP......D...EAFN...G-LN..LERLDLSKNN-...............ITS
ENSBTAP00000053353  ..VEKLEQLILEGN.....KISE.IC......S...--PL...SLKE..LKILNLSKNH-...............ISS
ENSBTAP00000015704  ..PAHIQQVYLQFN.....EIEA.VT......A...DSFI...NATH..LKEINLSHNK-...............IKS
ENSBTAP00000049410  ..DRRTVELRLADN.....FIQA.LG......P...PDFR...NMTG..LVDLTLSRNA-...............ITR
ENSBTAP00000005636  ..AGHLQRLSLHND.....GARL.LA......L...NSLK...KLAA..LRELELVACG-...............LER
ENSBTAP00000011445  ..PTNITVLNLTHN.....QLRR.LP......P...ANFT...RYSQ..LTILDGGFNS-...............ISK
ENSBTAP00000024223  ..LSRLQCLRLSHN.....SISQ.AV......Ng..SQFV...PLTS..LRVLDLSHNK-...............LDL
ENSBTAP00000048641  ..FQNLIVLDLSRN.....TITE.IP......R...G-IG...LLTR..LQELILSYNR-...............IKT
ENSBTAP00000013790  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000006460  ..PADTAILHLGEN.....PLGT.FS......M...ASVL...NLSQ..LTELFLGKSQ-...............LTS
ENSBTAP00000056481  ..PPNVERINLGYN.....SLVR.LT......E...ADFS...GLNK..LELLLLHSNG-...............IHT
ENSBTAP00000004800  ..DRRTVELRLADN.....FVTN.IK......R...KDFA...NMTS..LVDLTLSRNT-...............ISF
ENSBTAP00000050251  ..PNDTQLLDLRRN.....RFPV.VP......Q...AAFP...GLGR..LVSLHLQHCG-...............LTE
ENSBTAP00000040019  ..LENLCIVLLNKN.....QLTS.LH......G...--LD...GCTN..IQSLELSHNK-...............ITR
ENSBTAP00000029890  ..LSFLKCLNLSGN.....SISQtLN......G...SEFQ...PLVE..LKYLDFSNNR-...............LDL
ENSBTAP00000002279  ..PPGIKYLYLRNN.....QIDH.ID......D...KAFE...NVTD..LQWLILDHNL-...............LEN
ENSBTAP00000012650  ..LSSLESVSLARN.....IIMR.LD......E...SVFE...GLGH..LRELDLQRNY-...............IFE
ENSBTAP00000019066  ..PSRIWYLYLENN.....LIET.IP......E...KPFE...NATQ..LRWINLNKNK-...............ITN
ENSBTAP00000015445  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000013790  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000053668  ..------------.....----.--......-...----...----..--------N--...............LVT
ENSBTAP00000056022  ..NSSLRKLLAGHN.....RMAR.LP......E...--SL...ERTS..VEVLDVQHNQ-...............LLE
ENSBTAP00000003973  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000053245  ..SQDITYLNLRHN.....FMQL.ER......PgglDTFY...KFSQ..LKGLNLSHNK-...............LGS
ENSBTAP00000000176  ..DRRAAELRLADN.....FIAT.VR......R...RDLA...NMTG..LLHLSLSRNT-...............IRH
ENSBTAP00000008348  ..MNSLKKLVLNAN.....SFDQ.LC......Q...INAA...SFPS..LRDLYIKGNMR...............KLD
ENSBTAP00000026919  ..LKNLKELYLSGCvlpe.QVST.MQ......L...EGFQ...DLKN..LRTLYLKSS--...............LSR
ENSBTAP00000041110  ..LENLKWASFSNN.....NLTK.ME......G...--LE...SCVN..LEELTLDGNC-...............ISK
ENSBTAP00000007883  ..LPGLKTLYLQNN.....QISK.VC......P...E-IS...NLTQ..LTALNLGNNL-...............LEE
ENSBTAP00000048971  ..PRDAVELRFVLT.....KLRV.IP......K...GAFS...GFGD..LEKIEISQNDV...............LEV
ENSBTAP00000054723  ..PPYVRNLFLTGN.....QLAV.LP......A...GAFArrpPLAD..LAALNLSGNR-...............LKE
ENSBTAP00000016858  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000006543  ..PPGTQTLFLQDN.....SIAR.LE......P...GILA...PLAS..LRHLYLHNNS-...............LHA
ENSBTAP00000007981  ..PRRLRALVLPHN.....RVAA.LG......A...RDLT...STPR..LAELNLAYNC-...............LAS
ENSBTAP00000000073  ..PRALRSLDGSHN.....LLRA.LS......A...PELG...HLPQ..LQVLTLRHNR-...............ITA
ENSBTAP00000011445  ..LVRLKFLSLSNSfs...SLRT.LT......N...ETFL...SLAGcpLLLLNLTKNK-...............ISK
ENSBTAP00000053488  ..PEAMTEIRLELN.....GIKS.IP......P...GAFS...PYRK..LRRIDLSNNQ-...............ISE
ENSBTAP00000055429  ..SPHVERINLGFN.....SIQA.LS......E...TSFT...GLTK..LELLMIHGND-...............IPS
ENSBTAP00000029877  ..SPHVERINLGFN.....SIQA.LS......E...TSFT...GLTK..LELLMIHGND-...............IPS
ENSBTAP00000023907  ..DRRTVELRLGGN.....FIIH.IG......R...QDFA...NMTG..LVDLTLSRNT-...............ISH
ENSBTAP00000053245  ..SLSLRKLMVGHN.....HVQS.LP......T...--LV...EHIP..LEVLDVQHNL-...............LTR
ENSBTAP00000039209  ..LSHITQLVLSHN.....KLTT.VP......P...N-IA...ELKN..LEVLNFFNNQ-...............IEE
ENSBTAP00000054898  ..SPHVERINLGFN.....SIQA.LS......E...TSFT...GLTK..LELLMIHGND-...............IPS
ENSBTAP00000010138  ..---IYSLNMEHN.....RINK.IP......F...GIFS...RAKV..LSKLNMKDNQ-...............LTS
ENSBTAP00000002052  ..LINLRKLNLSDN.....HLGE.LP......SvqsSDEI...ICSR..LLEIDISSNK-...............LSH
ENSBTAP00000055075  ..DRRVVELRLTDN.....FIAA.IR......R...RDFA...NMTS..LVHLTLSRNT-...............IGQ
ENSBTAP00000046486  ..PEGIVEIRLEQN.....SIKS.IP......A...GAFT...QYKK..LKRIDISKNQ-...............ISD
ENSBTAP00000001716  ..SRDIEVLNLSRN.....QLRS.IL......A...LPLG...FYTA..LRHLDLSANE-...............ISF
ENSBTAP00000015445  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000048314  ..PKSLLSLKMERN.....RLKA.VR......F...RDMK...HLEN..LSHLYLSENS-...............LSS
ENSBTAP00000054662  ..LTGLRKLNISFN.....EFTC.LD......D...--VY...HLYN..LEYLDASHNH-...............VIT
ENSBTAP00000016614  ..PRRVRTLMILHN.....QITG.VG......R...DDFA...TTYH..LEELNLSYNR-...............ITS
ENSBTAP00000006288  ..LGRLQELGFHNN.....NIRA.IP......E...KAFL...GNPL..LQTIHFYDNP-...............IQF
ENSBTAP00000035220  ..QENIIHLNLSYN.....HFTD.LH......N...Q-LT...QYTN..LRTLDISNNR-...............LES
ENSBTAP00000044349  ..FPHLQLLDVSGN.....ALTA.LG......P...E-LL...ALRG..LRTLLAKNNR-...............LGG
ENSBTAP00000018658  ..TPITTTLDLSYN.....LLFQ.LQ......H...SDFR...SLSK..LKVLILCHNR-...............IQE
ENSBTAP00000008412  ..------------.....----.--......R...RSFR...RLVN..LQFLDLSQNF-...............LEH
ENSBTAP00000029331  ..PAATRSLLLLNN.....RLSS.LP......G...GAFA...NLSG..LQRLDLSNNF-...............LDR
ENSBTAP00000043328  ..PRDAVELRFVLT.....KLRV.IP......K...GAFS...GFGD..LEKIEISQNDV...............LEV
ENSBTAP00000003445  ..PANVTTLSLSAN.....KITV.LR......R...GAFA...DVTQ..VTSLWLAHNE-...............VRT
ENSBTAP00000029056  ..------------.....----.--......-...----...----..----R------...............---
ENSBTAP00000001716  ..LTSLRSLNLSRN.....CLRA.FE......A...Q-PG...SLPC..LTLLDISHNA-...............LET
ENSBTAP00000037062  ..LSDITQADLSRN.....RFPE.VP......E...A-AC...QLVS..LEGLSLYHNC-...............LRC
ENSBTAP00000025497  ..FQELVKLYLSDN.....RLNS.LP......P...E-LG...QLQN..LQILALDFNN-...............FKA
ENSBTAP00000025116  ..LTDTTRADLSRN.....RLSE.IP......I...E-AC...HFVS..LENLNLYQNC-...............IRY
ENSBTAP00000041953  ..QTHLKEWHISNT.....LIQI.IP......K...Y-IE...LFQA..MRILDLPKNQ-...............ISR
ENSBTAP00000007913  ..PANVTTLSLSAN.....QLPS.LP......G...GAFR...EVPR..LQSLWLAHNE-...............IRS
ENSBTAP00000033684  ..PQDLLHMLLARN.....KIRI.LK......N...SMFS...KFKK..LKSLDLQQNE-...............ISK
ENSBTAP00000055758  ..LSRLQKLYVSGT.....GLRE.LP......E...E-IE...ELRE..LRILALDFNK-...............LER
ENSBTAP00000023771  ..PLDVRKLLVAGN.....RIQH.IP......E...DFFI...FYGD..LVYLDFRNNS-...............LRS
ENSBTAP00000000700  ..LQYLERLYMKRN.....SLTT.LP......E...NLAQ...KLPN..LVELYLHSNN-...............IVV
ENSBTAP00000043299  ..PPQTLTLHLQDN.....QIHQ.LP......T...SAFK...SVPH..LTTLNLYNNS-...............LSN
ENSBTAP00000042745  ..TSNLRTIDLSNN.....KIEN.LP......P...MIIG...KFTL..LKSLSLNNNK-...............LTA
ENSBTAP00000045371  ..PSNAKKLHVNGN.....SIKD.VD......I...SDFT...EFEG..LDLLHLGSNQ-...............ITA
ENSBTAP00000046486  ..PEYVTDLRLNDN.....EISV.LE......At..GIFK...KLPN..LRKINLSNNR-...............IKE
ENSBTAP00000056638  ..-----KLNLSHN.....QLRA.VP......P...E-LG...KLTR..LVVLNLCGNR-...............LKT
ENSBTAP00000013364  ..PYNPKKMYLTEN.....YIAL.VR......R...SDFL...EATG..LDLLHLGNNR-...............ISM
ENSBTAP00000029056  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000056022  ..SQDLTHLNLKQN.....FLRQ.NP......S...L---...----..-----------...............PTA
ENSBTAP00000003973  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000006219  ..------------.....----.--......-...--LF...TLPL..LHYLEVSGCGS...............LRE
ENSBTAP00000018722  ..PSYTALLDLSHN.....NLSR.LR......A...EWTPt..RLTH..LHSLLLSHNH-...............LNF
ENSBTAP00000003370  ..LPSLKELLFHSN.....SISV.IP......D...GAFD...GNPL..LKTIHLYDNP-...............LSF
ENSBTAP00000005510  ..PVDTRNLSLAHN.....RIAA.VP......P...GYLT...CYQE..LRVLSLRNNS-...............LVE
ENSBTAP00000023124  ..----SSLSLVNG.....TFSE.IK......D...RMFS...HLPS..LQLLLLNSNS-...............FTV
ENSBTAP00000003856  ..FVSLEILNLYHN.....CIRV.IP......E...A-II...NLQM..LTYLNLSRNQ-...............LSA
ENSBTAP00000002625  ..FRLIKRLDLSYN.....RIGL.LD......S...EWIPv..SLVK..LNTLIIRHNN-...............ITS
ENSBTAP00000052577  ..PLNAKKLYLSSN.....LIQK.IY......R...SD--...----..-----------...............---
ENSBTAP00000000604  ..RSSMIQLDISHG.....YIFS.LN......F...RIFE...TLQE..LKVLNLAYNK-...............INS
ENSBTAP00000035880  ..PPKTKVLDLSQN.....NISE.LH......L...SDIS...FLSG..LRVLRLSHNR-...............IQG
ENSBTAP00000056147  ..QYRIYQLFLNGN.....LLTR.LY......P...NEFV...NYSN..AVTLHLGNNG-...............LQE
ENSBTAP00000026157  ..------------.....----.L-......P...ASLS...SLAR..LAHLDLSFNS-...............LET
ENSBTAP00000020944  ..YVHLQKLDLSVN.....KIED.L-......-...SCVS...CMPY..LLELNASQNH-...............LKT
ENSBTAP00000049290  ..LSNVQELFLRDN.....KIHS.IR......K...SHFV...DYKN..LILLDLGNNN-...............IAT
ENSBTAP00000019433  ..PQMAPTVDDSSN.....FLRV.LL......Q...THMKk..EEWN..IKHLDLSNNL-...............ISK
ENSBTAP00000056147  ..PTSPKKLYLTGN.....YLQM.VY......K...NDLL...EYSS..LDLLHLGNNR-...............IAV
ENSBTAP00000002199  ..PLNTRRLYLNDN.....KIRF.LP......A...MNLG...LLSD..LVYLDCQKNR-...............IQE
ENSBTAP00000054101  ..PAAAADLDLSHN.....GLQR.LP......P...GWLA...PLSR..LRALHLNHNE-...............LEA
ENSBTAP00000008348  ..PNTTEVLEFSFN.....FLPT.IQ......N...TTFS...RLIN..LIFLDLTRCQ-...............INW
ENSBTAP00000009238  ..PVDTVKLRIERT.....VVRR.IP......A...EAFY...YLVE..LQYLWLTYNS-...............VAS
ENSBTAP00000006107  ..--------LSNN.....KISE.LK......N...GSFS...GLSL..LERLDLRNNL-...............ISS
ENSBTAP00000005757  ..PQNPRKLILAGN.....IIHT.LL......K...SDLV...EYFT..LEMLHLGNNR-...............IEV
ENSBTAP00000049290  ..TSQFYHLFLHGN.....SLTR.LF......P...NEFA...NFYN..AVSLHMENNG-...............LHE
ENSBTAP00000013364  ..---IYHLLLSGN.....LLSR.LY......P...NEFV...NYTG..ASILHLGSNV-...............IQD
ENSBTAP00000025189  ..--TLLSLSFVRT.....RITQ.LK......A...GSFL...RVPS..LHLLLFTSNS-...............FSV
ENSBTAP00000021183  ..------------.....----.--......-...--LS...TLSN..CEKLSLSTNC-...............IEK
ENSBTAP00000014533  ..-EHLRLLNFQHN.....SITQ.IQ......N...--IS...NLQR..LIFLDLYDNQ-...............IEE
ENSBTAP00000056496  ..---IVDLRLNEN.....RIRS.VQ......Y...AALS...RFGN..LTYLNLTKNE-...............IGY
ENSBTAP00000045371  ..WSNFYHLNFQNN.....FLNI.LY......P...NTFL...NFSH..AVSLQLGNNK-...............LQN
ENSBTAP00000014977  ..LTHLLWLKADGN.....QLRS.AR......-...--LN...ELPY..LQIASFAYNQ-...............ITD
ENSBTAP00000005757  ..-----HLSLLNN.....GLTV.LH......T...NDFS...GLTN..AISIHLGFNN-...............IAD
ENSBTAP00000056192  ..---VRVLLLNHN.....RVHA.LP......P...GAFV...DAGA..LLRLDLRENG-...............LRW
ENSBTAP00000009548  ..NSTVHDLRLNEN.....KLKA.VL......Y...SSLN...RFGN..LTDLNLTKNE-...............ISY
ENSBTAP00000052577  ..WSRPFKLYLQRN.....SMRK.LY......T...NSFL...HLNN..AVSINLGNNA-...............LQD
ENSBTAP00000011591  ..------------.....---R.I-......-...DNLW...QFES..LQKLQLDNNI-...............IEK
ENSBTAP00000012486  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000022047  ..---LSRLSLTYL.....PIKV.IP......S...QAFR...GLNE..VIKIEISQSDS...............LEK
ENSBTAP00000017907  ..CKRLVQLSVANN.....RLVR.MM......G...--VA...KLTQ..LRVLNLPHNS-...............IGY
ENSBTAP00000048314  ..PSTTKKLYISHS.....KIQH.LQ......L...SNFT...QMLA..LEDFLLLASG-...............TES
ENSBTAP00000006996  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000053866  ..------------.....----.--......-...--LE...KCTK..LEILNLSHNL-...............IGK
ENSBTAP00000010504  ..PKNTAYFYSRFN.....RIKK.IN......K...NDFA...SLND..LRRIDLTSNL-...............ISE
ENSBTAP00000007874  ..LTDVDELDLSRN.....LIKK.I-......-...----...----..-----------...............---
ENSBTAP00000010530  ..----KSLDLSNN.....EITY.VG......N...RDLQ...RCVN..LKTLRLGANE-...............IHT
ENSBTAP00000024223  ..RANVTSLSLISN.....RIHH.LH......D...SDFV...HLSN..LRVLNLKWNCPpaglspmhfpc....RMT
ENSBTAP00000006480  ..LKNLRKLDLSHN.....HIKK.LP......A...T-IG...DLIH..LQELNLNDNH-...............LES
ENSBTAP00000017067  ..------------.....----.--......-...----...----..---LDISKCE-...............LSE
ENSBTAP00000032951  ..SEEFKQVRIENS.....PVFE.LP......R...GFFI...NMHT..LEYLWLNFDN-...............VTV
ENSBTAP00000052860  ..PPSTQTLKFIET.....HLKT.IP......S...RAFS...NLPN..ISRIYLSIDAT...............LQQ
ENSBTAP00000004335  ..--------LHCN.....NISK.IT......S...--ID...HVWN..LQHLDLSSNQ-...............ISQ
ENSBTAP00000006011  ..-SEVISLTLVNA.....AFSE.IQ......D...GAFS...HLPL..LQFLLLNSNK-...............FTL
ENSBTAP00000016410  ..PSDVKELVLDNCrsnegKIEG.LT......D...E-FE...ELEF..LSTINVGLTS-...............VAN
ENSBTAP00000018286  ..PQTTAYLYARFN.....RISH.IR......A...GDFK...GLTK..LKRIDLSGNS-...............ISS
ENSBTAP00000018076  ..LDQFDAIDFSDN.....EIRK.LD......G...--FP...LLRR..LKTLLVNNNR-...............ICR
ENSBTAP00000045522  ..---LEELSLHQQ.....EIER.LE......H...-IDK...WCRD..LKILYLQNNL-...............IGK
ENSBTAP00000046486  ..PKDVTELYLEGN.....HLTA.VP......K...E-LS...SFRH..LTLIDLSNNS-...............IGM
ENSBTAP00000031247  ..------------.....----.--......-...----...----..---LRLERTA-...............IRR
ENSBTAP00000024223  ..PPSLDTLLLSYN.....HIVT.LA......P...EDLA...NLTA..LRVLDVGGNCRrcdharnpcrecpknFPK
ENSBTAP00000028486  ..------------.....----.--......E...GLTA...EFVN..LEFLSLINVG-...............LIS
ENSBTAP00000022049  ..---LSRLSLTYL.....PIKV.IP......S...QAFR...GLNE..VIKIEISQSDS...............LEK
ENSBTAP00000053639  ..SKNVTILDLSYN.....QITL.NI......Tdt.RVLQ...TYFL..LSELYLVENK-...............VTN
ENSBTAP00000011082  ..------------.....----.--......-...---G...GLVL..LTDLLLSQNL-...............LQR
ENSBTAP00000055544  ..------------.....----.--......-...----...----..LKGFFLLNCPD...............LTP
ENSBTAP00000056065  ..------------.....----.--......-...----...----..LKGFFLLNCPD...............LTP
ENSBTAP00000021280  ..AFQ---------.....----.--......-...----...----..-----------...............---
ENSBTAP00000000604  ..PNTTKSLLLSFN.....YIRT.VT......T...ASFP...FLEQ..LQLLELGTQFT...............PLT
ENSBTAP00000002392  ..------------.....----.--......-...--FH...TLAE..LQTVRLDREG-...............ITT
ENSBTAP00000026102  ..MPSLEVITLSVN.....SISS.LE......P...--VS...RCRQ..LSELYLRKNCI...............PSL
ENSBTAP00000053488  ..-------DLSEN.....TIQA.IP......R...KAFR...GATD..LKNLQLDKNQ-...............IGC
ENSBTAP00000054460  ..------------.....----.--......-...----...HLPN..LSQLKLNGSC-...............LGS
ENSBTAP00000015694  ..PKESAYLYARFN.....KIKK.LT......A...KDFA...DIPN..LRRLDFTGNL-...............IED
ENSBTAP00000007978  ..------LDLSLS.....DLNE.VP......V...KELA...ALPK..ATVLDLSCNK-...............LTT
ENSBTAP00000049967  ..PWNAMSLQILNT.....HITE.LN......E...SPFL...NISA..LIALRIEKNE-...............LAH
ENSBTAP00000055245  ..PKESAYLYARFN.....KIKK.LT......A...KDFA...DIPN..LRRLDFTGNL-...............IED
ENSBTAP00000044315  ..PPETVLLYLDSN.....QITS.IP......N...EIFK...DLHQ..LRVLNLSKNG-...............IEF
ENSBTAP00000017571  ..PTNLTHILLFQM.....GRGT.LQ......N...NSFS...DMTV..LQRLLLSDSH-...............VSA
ENSBTAP00000008412  ..-----FIDASNQ.....SLLT.IP......E...D-IL...ALRE..LEEVHLENNL-...............IAE
ENSBTAP00000022237  ..-----ELVLDNCl....CVNG.EI......E...GLND...TFKK..LEFLSMANVE-...............LSS
ENSBTAP00000023088  ..------------.....----.--......-...-S--...----..-----------...............---
ENSBTAP00000024242  ..CAHVSELDLSDN.....KLED.WHev....S...KIVS...NVPQ..LEFLNLSSNPLn..............LSV
ENSBTAP00000014881  ..CKNLSVLYLYDN.....RISQ.IT......N...--LN...YATN..LTHLYLQNNC-...............ISC
ENSBTAP00000002011  ..PLDTAHLDLSSN.....RLET.VN......E...SVLAgp.GYTT..LSGLDLSYNL-...............LTS
ENSBTAP00000044218  ..CKNLSVLYLYDN.....RISQ.IT......N...--LN...YATN..LTHLYLQNNC-...............ISC
ENSBTAP00000053049  ..PNDTRKLYLDAN.....RLVS.VP......A...GAFQ...HLPV..LEELDLSHNV-...............LAH
ENSBTAP00000053271  ..PSDLCSINVSGL.....KFSK.AK......E...KDFK...HFNS..VIYINASENL-...............---
ENSBTAP00000055995  ..------------.....----.--......-...----...KFVK..LEELVLSANQ-...............IKE
ENSBTAP00000005490  ..------------.....----.--......-...----...KFVK..LEELVLSANQ-...............IKE
ENSBTAP00000055569  ..------------.....----.--......-...----...KFVK..LEELVLSANQ-...............IKE
ENSBTAP00000023769  ..PADTVLLKLDAN.....KIAR.IP......N...GAFQ...HLHQ..LRELDLSQNA-...............IET
ENSBTAP00000054129  ..----TILNFQGN.....YISY.ID......E...NIWK...AYRW..AEKLILSENS-...............LTE
ENSBTAP00000023886  ..----QSLWLNNN.....VLTD.LRdfnhavS...QLLE...HPEN..LAWIDLSFND-...............LTS
ENSBTAP00000004849  ..----TILNFQGN.....YISY.ID......E...NIWK...AYRW..AEKLILSENS-...............LTE
ENSBTAP00000041497  ..------------.....----.--......-...----...----..-----------...............LGL
ENSBTAP00000003980  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000015158  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000002402  ..------------.....----.--......-...----...----..-----------...............IHS
ENSBTAP00000056550  ..------------.....----.--......-...----...----..-----------...............ITH
ENSBTAP00000027480  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000007444  nvTDQIHLITLANN.....ELKA.LT......S...KFMT...TFCQ..LRELRLEGNF-...............LHR
ENSBTAP00000025849  ..------------.....----.--......-...----...----..-----------...............LKS
ENSBTAP00000000533  ..-----TLDYSHC.....SLEQ.VP......K...EIFT...FEKT..LEELYLDANQ-...............IEE
ENSBTAP00000045403  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000045610  ..PPDVISLSFVRS.....GFTE.IS......E...GSFL...FTPS..LQLLLFTSNS-...............FDV
ENSBTAP00000014097  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000021517  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000053704  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000042391  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000002883  ..PSWIARLDLSHN.....RLSF.IK......A...SSLS...HLHS..LREVKLNNNE-...............LET
ENSBTAP00000019525  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000006728  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000030722  ..PAWTRSLNLSYN.....KLSE.ID......P...AGFE...DLPN..LQEVYLNNNE-...............LTA
ENSBTAP00000026919  ..------------.....----.--......P...EEIQ...YLSN..LQYFAVTNNN-...............IEM
ENSBTAP00000049498  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000026139  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000046486  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000026263  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000056597  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000046208  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000043818  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000030439  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000053958  ..------------.....----.--......-...--LT...RNYC..LAELYLNNNA-...............IFD
ENSBTAP00000022955  ..-------NFSGK.....I---.--......-...----...----..-----------...............LTQ
ENSBTAP00000030440  ..------------.....----.--......-...----...----..-----------...............---
ENSBTAP00000054502  ..PDDATTLYLQNN.....QINNaGI......P...QDLK...TKVN..VQVIYLYEND-...............---
ENSBTAP00000004298  ..PEDATTLYLQNN.....QINNaGI......P...SDLK...NLLK..VERIYLYHNS-...............---
ENSBTAP00000041674  ..AHTAIIIDLQAN.....PLQG.DL......V...NTFH...GFTQ..LQTLIL-----...............---


                         70             80                                                          
                          |              |                                                          
d1xwdc1               ...IEADVFSN...L.PK.LH..EIRIEKA................................................
ENSBTAP00000021162  ...FPRQ-LLQ...L.VA.LE..ELDVSS-................................................
ENSBTAP00000043657  ...LPPEVFAQ...L.SC.LE..KLWLQH-................................................
ENSBTAP00000055611  ...LSRGSFEG...L.ES.LV..KLRLDG-................................................
ENSBTAP00000033782  ...IPPS-ISN...M.VS.LH..VLILCY-................................................
ENSBTAP00000011238  ...IPPK-IFK...L.PH.LQ..FLELKR-................................................
ENSBTAP00000000533  ...VEEG-ISG...C.EN.LQ..DLLLSS-................................................
ENSBTAP00000004562  ...ISPGAFAP...L.VK.LE..RLYLSK-................................................
ENSBTAP00000049967  ...LPPGIFLH...L.PQ.LN..RLTLFG-................................................
ENSBTAP00000050839  ...LEPGAFHG...L.RS.LL..TLRLQG-................................................
ENSBTAP00000003370  ...IHPKALSG...L.KE.LK..VLTLQN-................................................
ENSBTAP00000053607  ...IERGAFQD...L.KE.LE..RLRLNR-................................................
ENSBTAP00000054397  ...IDAAAFSG...L.AL.LE..QLDLSDN................................................
ENSBTAP00000030722  ...LTDGAFWG...L.AR.MH..ALHLEY-................................................
ENSBTAP00000001560  ...ISANAFSG...L.KN.LL..RLHLNS-................................................
ENSBTAP00000010138  ...IPSV-VYR...L.DS.LT..TLYLRF-................................................
ENSBTAP00000023310  ...LPDS-LTQ...L.RR.LE..ELDLGN-................................................
ENSBTAP00000016755  ...IYPGTFRH...L.QA.LE..ELDLGDN................................................
ENSBTAP00000002883  ...LPPK-MFK...L.PQ.LQ..HLELNR-................................................
ENSBTAP00000043683  ...VEPGAFNN...L.FN.LR..TLGLRS-................................................
ENSBTAP00000010846  ...LPEE-ITN...L.RN.LK..GLYLQH-................................................
ENSBTAP00000021903  ...VEPGAFAN...L.PR.LR..VLRLRG-................................................
ENSBTAP00000000484  ...VDEDAFQG...I.RR.LK..ELILSS-................................................
ENSBTAP00000055691  ...VEPGAFNN...L.FN.LR..SLRLKG-................................................
ENSBTAP00000040907  ...IEVGAFNG...L.PS.LN..TLELFD-................................................
ENSBTAP00000017631  ...VGRSAFQH...L.PE.LR..TLTLNGA................................................
ENSBTAP00000018866  ...VKEDAFQG...L.YK.LK..ELILSS-................................................
ENSBTAP00000044462  ...IHEKAFSP...L.RK.LQ..KLYISK-................................................
ENSBTAP00000006288  ...IPGQAFSG...L.SS.LK..ILMLQN-................................................
ENSBTAP00000056438  ...IEVGAFNG...L.AS.LN..TLELFD-................................................
ENSBTAP00000047707  ...IEVGAFNG...L.AS.LN..TLELFD-................................................
ENSBTAP00000028386  ...LPRGLLSP...L.VN.LF..ILQLNN-................................................
ENSBTAP00000050251  ...VAEGAFRG...L.GR.LL..LLNLAS-................................................
ENSBTAP00000009633  ...IEIGAFNG...L.AN.LN..TLELFD-................................................
ENSBTAP00000005771  ...ISPGAFIG...L.HN.LL..RLHLNS-................................................
ENSBTAP00000034926  ...IHPKAFLT...T.KK.LR..RLYLSH-................................................
ENSBTAP00000016317  ...IDPNTFQG...F.VH.LE..ELDLGDN................................................
ENSBTAP00000021517  ...LPPQ-MRR...L.VH.LQ..TLVLNGNpllhaqlrqlpaltalqtlhlrntqrtqsnlptsleglshladvdlsc
ENSBTAP00000033782  ...FPSG-LES...L.KN.LE..ILNLAK-................................................
ENSBTAP00000053488  ...IEDGAFEG...A.AS.VS..ELHLTA-................................................
ENSBTAP00000022459  ...IDENAFNG...I.RR.LK..ELILSS-................................................
ENSBTAP00000044542  ...LEPQALLG...L.RG.LC..HLHLEH-................................................
ENSBTAP00000017571  ...LESGLLDS...L.RA.LT..ELQLHT-................................................
ENSBTAP00000055923  ...ITPGAFKG...L.PR.LA..ELSLAHNgdlrylhartftalgrlrrldltvcrlfsvperllaelpalrelaafd
ENSBTAP00000012294  ...LPDG-FTQ...L.LN.LT..QLYLND-................................................
ENSBTAP00000044542  ...LPEEAFAG...L.GQ.LE..VLALND-................................................
ENSBTAP00000017322  ...IPHS-IFS...L.HN.LQ..EIDLKD-................................................
ENSBTAP00000001045  ...IEN--ISS...L.HQ.LQ..MLELGS-................................................
ENSBTAP00000016614  .rgLPEEAFEH...L.TN.LN..YLYLANNkltlaprflpnalisvdfaanyltkiygltfgqkpnlrsvylhnnkla
ENSBTAP00000028517  .vgVEDGAFRE...A.LS.LK..LLFLSK-................................................
ENSBTAP00000027912  ...IPHA-IFS...L.SN.LQ..ELDLKS-................................................
ENSBTAP00000016858  ...IGNYSFYA...L.D-.--..-------................................................
ENSBTAP00000017631  ...IPKGAFAG...L.YS.LK..VLMLQN-................................................
ENSBTAP00000023709  ...VDQRVLEK...L.PS.LV..FLYMEK-................................................
ENSBTAP00000028690  ...--------...-.--.--..-------................................................
ENSBTAP00000055273  ...LPGGVFQP...L.AN.LS..NLDLTA-................................................
ENSBTAP00000003618  ...LFPGFFRV...S.AA.LC..TLVLKG-................................................
ENSBTAP00000053607  ...IEEGAFEG...A.SG.VN..EILLTS-................................................
ENSBTAP00000004298  .vsIEEGAFRD...S.NY.LR..LLFLSR-................................................
ENSBTAP00000019854  .dkVGKKVFSK...L.RH.LE..RLYLDH-................................................
ENSBTAP00000047764  .dkVGKKVFSK...L.RH.LE..RLYLDH-................................................
ENSBTAP00000011082  ...LPEG-FTQ...L.RS.LA..HLALND-................................................
ENSBTAP00000001193  ...IPHA-VFS...L.LS.LQ..ELDLKE-................................................
ENSBTAP00000020135  ...ISRKAFFG...L.HN.LQ..ILYLNH-................................................
ENSBTAP00000013620  ...VSVYAFRG...L.YS.LT..KLYLSH-................................................
ENSBTAP00000034140  ...PRDCDLRA...L.PQ.LL..SLHLEE-................................................
ENSBTAP00000007981  .egLPDEAFES...L.TQ.LQ..HIYVAH-................................................
ENSBTAP00000054502  .vsIEEDAFAD...S.KQ.LK..LLFLSR-................................................
ENSBTAP00000015726  .sgIGPKAFKF...L.KN.LM..RLNMDG-................................................
ENSBTAP00000053353  ...LSEDFLET...C.PK.VE..ILSAKM-................................................
ENSBTAP00000015704  .qkIDHGVFAK...L.PN.LL..QLHLQH-................................................
ENSBTAP00000049410  ...IGARAFGD...L.ES.LR..SLHLDG-................................................
ENSBTAP00000005636  ...IPHA-VFS...L.GA.LQ..ELDLRD-................................................
ENSBTAP00000011445  ...LEPELCQS...L.PW.LE..ILNLQH-................................................
ENSBTAP00000024223  ...YHGRSFTE...L.PQ.LE..ALDLSYNsqpfsmqgvghnlsfvaqlpslrylslahngihsrvsqklssaslral
ENSBTAP00000048641  ...VPME-LSY...C.AS.LE..KLELAVN................................................
ENSBTAP00000013790  ...--------...-.--.--..-------................................................
ENSBTAP00000006460  ...LQA--DAK...L.PR.LE..VLNLAH-................................................
ENSBTAP00000056481  ...VPAKTFSD...L.QA.LQ..VLKMSY-................................................
ENSBTAP00000004800  ...ITPHAFAD...L.RN.LR..ALHLNS-................................................
ENSBTAP00000050251  ...LEAGALAG...L.DS.LI..YLYLAD-................................................
ENSBTAP00000040019  ...IGG--LES...L.KN.LQ..QLIVDH-................................................
ENSBTAP00000029890  ...LYSTAFEE...L.HN.LE..VLDISSNshyfqsegithmlnftknlkvlrklmmnyndiatstsrtmeseslqil
ENSBTAP00000002279  .skIKGKVFSK...L.KQ.LK..KLHINY-................................................
ENSBTAP00000012650  ...IEGGAFDG...L.TQ.LR..HLNLAY-................................................
ENSBTAP00000019066  .ygIEKGALSQ...L.KK.LL..FLFLED-................................................
ENSBTAP00000015445  ...--------...-.--.--..-------................................................
ENSBTAP00000013790  ...--------...-.--.--..-------................................................
ENSBTAP00000053668  ...IGGRVLY-...-.SG.LS..LLILKQ-................................................
ENSBTAP00000056022  ...LPPSLLMK...A.DS.LR..FLNASA-................................................
ENSBTAP00000003973  ...--------...-.--.--..-------................................................
ENSBTAP00000053245  ...FPVL-LCE...I.PT.LT..ELNLSC-................................................
ENSBTAP00000000176  ...VAAGAFSD...L.RA.LR..ALHLDG-................................................
ENSBTAP00000008348  ...LGTRCLEK...L.EN.LQ..KLDLSH-................................................
ENSBTAP00000026919  ...IPQVITDL...L.PS.LQ..KLSLDN-................................................
ENSBTAP00000041110  ...IEG--ISK...L.TK.LT..HLSINN-................................................
ENSBTAP00000007883  ...VPEE-MKY...L.TS.LK..KLHLFR-................................................
ENSBTAP00000048971  ...IEANVFSN...L.PK.LH..EIRIEKA................................................
ENSBTAP00000054723  ...VDAGAFEH...L.PG.LR..QLDLSH-................................................
ENSBTAP00000016858  ...--------...-.--.--..-------................................................
ENSBTAP00000006543  ...LESGAFRT...Q.SR.LL..ELALTG-................................................
ENSBTAP00000007981  .arVHLRAFRR...L.RA.LR..SLDLAG-................................................
ENSBTAP00000000073  ...LGWG-PGA...P.AG.LH..SLDLSY-................................................
ENSBTAP00000011445  ...IQSGAFSW...L.GH.LE..VLDLGLNeigqeltgqewrgldniveiylsynkyleltt................
ENSBTAP00000053488  ...IAPDAFQG...L.RS.LN..SLVLYG-................................................
ENSBTAP00000055429  ...IPDGALRD...L.IS.LQ..VFKFSY-................................................
ENSBTAP00000029877  ...IPDGALRD...L.IS.LQ..VFKFSY-................................................
ENSBTAP00000023907  ...IQPFSFLD...L.ES.LR..SLHLDS-................................................
ENSBTAP00000053245  ...LPDTLFSK...A.LN.LR..YLNASA-................................................
ENSBTAP00000039209  ...LPTQ-ISS...L.QK.LK..HLNLGM-................................................
ENSBTAP00000054898  ...IPDGALRD...L.IS.LQ..VFKFSY-................................................
ENSBTAP00000010138  ...LPLD-FGT...W.TS.MV..ELNLAT-................................................
ENSBTAP00000002052  ...LPPG-FLH...L.SK.LQ..KLTASK-................................................
ENSBTAP00000055075  ...VAAGAFAD...L.RA.LR..ALHLDS-................................................
ENSBTAP00000046486  ...IAPDAFQG...L.KS.LT..SLVLYG-................................................
ENSBTAP00000001716  ...LQPGVFQA...L.PH.LE..HLNLAH-................................................
ENSBTAP00000015445  ...--------...-.--.--..-------................................................
ENSBTAP00000048314  ...IEG--AQL...L.AN.LT..TLEVSQ-................................................
ENSBTAP00000054662  ...LEG--FRG...L.MK.LK..HLDLSWNqlkksgdeinmlckhttslltldirhnpwqkpatlrlsvigrlktlth
ENSBTAP00000016614  .prVHRDAFRK...L.RL.LR..SLDLSG-................................................
ENSBTAP00000006288  ...VGRSAFQH...L.PG.LH..TLSLNGA................................................
ENSBTAP00000035220  ...LPAQ---L...P.RS.LW..NMSAAN-................................................
ENSBTAP00000044349  pgaFPKGLA-QsplC.RS.LQ..VLNLSG-................................................
ENSBTAP00000018658  ...LDIKTFEF...N.KE.LS..YLDVSN-................................................
ENSBTAP00000008412  ...CPLQ-ICS...L.KN.LE..VLALDD-................................................
ENSBTAP00000029331  ...LPRMAFGD...L.AN.LT..ELQLRN-................................................
ENSBTAP00000043328  ...IEANVFSN...L.PK.LH..EIRIEKA................................................
ENSBTAP00000003445  ...VEPGSLAV...L.SQ.LK..NLDLSH-................................................
ENSBTAP00000029056  ...--------...-.--.--..-------................................................
ENSBTAP00000001716  ...LELG-ARA...L.GS.LR..TLLLQD-................................................
ENSBTAP00000037062  ...LNPA-LGN...L.TA.LT..YLNLSR-................................................
ENSBTAP00000025497  ...LPQV-VCT...-.--.--..-------................................................
ENSBTAP00000025116  ...VPEA-ILN...L.QA.LT..FLNISR-................................................
ENSBTAP00000041953  ...LPAE-IGC...L.KN.LK..ELNVSF-................................................
ENSBTAP00000007913  ...VAAGALAS...L.SQ.LK..SLDLSH-................................................
ENSBTAP00000033684  ...IESEAFFG...L.NK.LT..TLLLQH-................................................
ENSBTAP00000055758  ...LPDG-LCR...L.PR.LT..RLYLGS-................................................
ENSBTAP00000023771  ...LEEGTFSG...S.AK.LA..FLDLSY-................................................
ENSBTAP00000000700  ...VPEA-IGS...L.VK.LQ..CLDLSD-................................................
ENSBTAP00000043299  ...LTPGVFHG...L.QH.LQ..VLNLTQ-................................................
ENSBTAP00000042745  ...LPDE-LCN...L.KK.LE..TLSLNN-................................................
ENSBTAP00000045371  ...IKGDVFRN...L.TN.LR..RLYLNG-................................................
ENSBTAP00000046486  ...VKEGAFDG...A.AS.VQ..ELVLTG-................................................
ENSBTAP00000056638  ...LPGE-VSL...L.QS.LK..VLFVHM-................................................
ENSBTAP00000013364  ...IQDRAFGD...L.TN.LR..RLYLNG-................................................
ENSBTAP00000029056  ...--------...-.--.--..-------................................................
ENSBTAP00000056022  ...RGLSELQR...F.TK.LK..SLNLSN-................................................
ENSBTAP00000003973  ...--------...-.--.--..-------................................................
ENSBTAP00000006219  ...PGPGLAQG...L.PQ.LH..SLVLRR-................................................
ENSBTAP00000018722  ...ISSEAFSP...V.PN.LR..YLDLSS-................................................
ENSBTAP00000003370  ...VGNSAFHN...L.SE.LH..SLVIRG-................................................
ENSBTAP00000005510  ...LPAGLFLH...A.KR.LA..HLDLSY-................................................
ENSBTAP00000023124  ...IRDDAFAG...L.FH.LE..YLFIEG-................................................
ENSBTAP00000003856  ...LPAC-LCG...L.P-.LK..VLIASN-................................................
ENSBTAP00000002625  ...ISTDSFST...T.PN.LK..CLDLSS-................................................
ENSBTAP00000052577  ...-----FWN...F.SS.LD..LLHLGN-................................................
ENSBTAP00000000604  ...ISRNAFYG...L.DN.LQ..VLNISY-................................................
ENSBTAP00000035880  ...LDISIFKF...N.HD.LE..YLDLSH-................................................
ENSBTAP00000056147  ...IRTGAFSG...L.KT.LK..RLHLNN-................................................
ENSBTAP00000026157  ...LPAC-VPQ...M.CG.LD..ALLLSR-................................................
ENSBTAP00000020944  ...FFN--FKP...P.KK.LK..KVDFSY-................................................
ENSBTAP00000049290  ...VENNTFKN...L.LD.LR..WLYMDS-................................................
ENSBTAP00000019433  ...ITLSSLEH...F.HA.LE..TLNLSN-................................................
ENSBTAP00000056147  ...IQEGAFTN...L.TS.LR..RLYLNG-................................................
ENSBTAP00000002199  ...VMDYTFVG...V.FR.LI..YLDLSF-................................................
ENSBTAP00000054101  ...LGRGVFTN...A.SG.LR..LLDLSS-................................................
ENSBTAP00000008348  ...VHEDTFQS...H.HQ.LN..TIVLTG-................................................
ENSBTAP00000009238  ...LDVSSFYN...L.KH.LH..ELRLDG-................................................
ENSBTAP00000006107  ...IDPGAFWG...L.SS.LK..RLDLTN-................................................
ENSBTAP00000005757  ...LEEGSFMN...L.TR.LQ..KLYLNG-................................................
ENSBTAP00000049290  ...IVPGAFLG...L.QL.VK..RLHINN-................................................
ENSBTAP00000013364  ...IETGAFHG...L.RG.LR..RLHLNN-................................................
ENSBTAP00000025189  ...IEDDAFAG...L.SH.LQ..YLFIED-................................................
ENSBTAP00000021183  ...IAN--LNG...L.KN.LR..ILSLGR-................................................
ENSBTAP00000014533  ...ISG--LST...L.RS.LR..VLLLGK-................................................
ENSBTAP00000056496  ...IEDGAFSG...Q.FN.LQ..VLQLGY-................................................
ENSBTAP00000045371  ...IEGGAFLG...L.SA.LK..QLHLNN-................................................
ENSBTAP00000014977  ...TE---GIS...H.PR.LA..SLDLKG-................................................
ENSBTAP00000005757  ...IETGAFNG...L.GL.LK..QLHINH-................................................
ENSBTAP00000056192  ...VHARAFWG...L.GA.LE..QLDLSA-................................................
ENSBTAP00000009548  ...IEDGAFLG...Q.SS.LQ..VLQLGY-................................................
ENSBTAP00000052577  ...IQTGAFNG...L.KI.LK..RLYLHE-................................................
ENSBTAP00000011591  ...IEG--LEN...L.TR.LV..WLDLSF-................................................
ENSBTAP00000012486  ...-------N...I.PE.LL..SLNLSN-................................................
ENSBTAP00000022047  ...IEANAFDN...L.LN.LS..EILIQNT................................................
ENSBTAP00000017907  ...VEG--LKE...L.VH.LE..WLNLAG-................................................
ENSBTAP00000048314  ...VENDTFKT...L.ST.LK..TLELWK-................................................
ENSBTAP00000006996  ...--------...-.--.--..---LNQR................................................
ENSBTAP00000053866  ...IEK--VDK...L.LK.LR..ELNLSY-................................................
ENSBTAP00000010504  ...IDEDAFRK...L.PQ.LR..ELVLRD-................................................
ENSBTAP00000007874  ...-PDA-ISK...F.QN.LR..WLDLHS-................................................
ENSBTAP00000010530  ...VEEDSFFH...L.RN.LE..YLDLSY-................................................
ENSBTAP00000024223  ...IEPNTFLA...V.PT.LE..ELNLSY-................................................
ENSBTAP00000006480  ...FSVALCQStl.Q.KS.LQ..SLDISK-................................................
ENSBTAP00000017067  ...IPFGAFAT...C.KV.LQkkVLIVHT-................................................
ENSBTAP00000032951  ...IHPGALEH...L.SE.LK..ELRLEG-................................................
ENSBTAP00000052860  ...LESHSFYN...L.SK.VT..HIEIRNT................................................
ENSBTAP00000004335  ...IEG--LNT...L.TK.LC..TLNLSC-................................................
ENSBTAP00000006011  ...IGDNAFTG...L.SH.LQ..YLFIEN-................................................
ENSBTAP00000016410  ...-----LPK...L.NK.LK..KLELSD-................................................
ENSBTAP00000018286  ...IDDKALRL...L.PA.LR..DLILPE-................................................
ENSBTAP00000018076  ...IGEGLDQA...L.PC.LT..ELILTN-................................................
ENSBTAP00000045522  ...IEN--VS-...-.--.--..-------................................................
ENSBTAP00000046486  ...LTNYTFSN...M.SH.LS..TLILSY-................................................
ENSBTAP00000031247  ...VPGDAFKT...L.GR.LE..QLWLPY-................................................
ENSBTAP00000024223  ...LHPDTFSH...L.SR.LE..GLVLKD-................................................
ENSBTAP00000028486  ...VSN--LPK...L.PK.LK..KLELSD-................................................
ENSBTAP00000022049  ...IEANAFDN...L.LN.LS..EILIQNT................................................
ENSBTAP00000053639  ...LFNNSFSN...L.SN.LE..ILNICR-................................................
ENSBTAP00000011082  ...LPDG-IGQ...L.KQ.LS..ILKVDQ-................................................
ENSBTAP00000055544  ...LAF-----...-.-Q.LI..YLNLSY-................................................
ENSBTAP00000056065  ...LAF-----...-.-Q.LI..YLNLSY-................................................
ENSBTAP00000021280  ...--------...-.--.LI..YLNLSY-................................................
ENSBTAP00000000604  ...IYREAFRN...L.PN.LR..ILDLGG-................................................
ENSBTAP00000002392  ...IRN--LEG...L.QN.LH..SLYLQG-................................................
ENSBTAP00000026102  ...AELIH---...-.--.--..-------................................................
ENSBTAP00000053488  ...IEEGAFRA...L.RG.LE..VLTLNN-................................................
ENSBTAP00000054460  ...LRDL-GTS...L.SH.LQ..VLSQTR-................................................
ENSBTAP00000015694  ...IEDGTFSK...L.SL.LE..ELTLAE-................................................
ENSBTAP00000007978  ...LPSD-FCG...L.TH.LV..KLDLSK-................................................
ENSBTAP00000049967  ...IAPGAFRS...L.GS.LR..YLSLAN-................................................
ENSBTAP00000055245  ...IEDGTFSK...L.SL.LE..ELTLAE-................................................
ENSBTAP00000044315  ...IDEHAFKG...VaET.LQ..TLDLSD-................................................
ENSBTAP00000017571  ...IAPGTFND...P.IK.LK..TLRLSR-................................................
ENSBTAP00000008412  ...IPKD-IQH...L.RK.IR..VLYLNK-................................................
ENSBTAP00000022237  ...LAR--LPS...L.NK.LR..KLELSD-................................................
ENSBTAP00000023088  ...--------...-.--.--..-------................................................
ENSBTAP00000024242  ...LERTCAGS...F.SG.VR..KLVLNNS................................................
ENSBTAP00000014881  ...IEN--LRS...L.KK.LE..KLYLGG-................................................
ENSBTAP00000002011  ...LSPTAFSR...L.RY.LE..SLDLSH-................................................
ENSBTAP00000044218  ...IEN--LRS...L.KK.LE..KLYLGG-................................................
ENSBTAP00000053049  ...LSGAAFQG...L.AGtLR..HLDLSA-................................................
ENSBTAP00000053271  ...LPLEAFHT...F.PV.LK..ELELAF-................................................
ENSBTAP00000055995  ...IDT--TNL...P.PT.LK..VLELYG-................................................
ENSBTAP00000005490  ...IDT--TNL...P.PT.LK..VLELYG-................................................
ENSBTAP00000055569  ...IDT--TNL...P.PT.LK..VLELYG-................................................
ENSBTAP00000023769  ...IGPAAFSG...L.AGgLR..LLDLSH-................................................
ENSBTAP00000054129  ...LHKDSFEG...L.LS.LQ..YLDLSC-................................................
ENSBTAP00000023886  ...IDPV-LTT...F.FN.LS..VLYLHG-................................................
ENSBTAP00000004849  ...LHKDSFEG...L.LS.LQ..YLDLSC-................................................
ENSBTAP00000041497  ...VGLGCLGD...C.LG.LE..WLDLSG-................................................
ENSBTAP00000003980  ...--------...-.EN.LT..ELYIENQ................................................
ENSBTAP00000015158  ...--------...-.--.--..-------................................................
ENSBTAP00000002402  ...IGDA-FRN...F.KS.LR..SLDLSR-................................................
ENSBTAP00000056550  ...LGNS-LMN...L.TS.LK..SLDLSR-................................................
ENSBTAP00000027480  ...--------...-.--.--..-------................................................
ENSBTAP00000007444  ...LPNE-VST...L.QH.LK..AIDLSR-................................................
ENSBTAP00000025849  ...MEN--LQS...C.IS.LR..VCIFSN-................................................
ENSBTAP00000000533  ...LPKQ-LFN...C.QS.LH..KLSLPD-................................................
ENSBTAP00000045403  ...--------...-.--.--..ELFLSQ-................................................
ENSBTAP00000045610  ...ISDDAFIG...L.PH.LE..YLFIEN-................................................
ENSBTAP00000014097  ...--------...-.--.IT..EIYIANQ................................................
ENSBTAP00000021517  ...--------...-.--.--..-------................................................
ENSBTAP00000053704  ...--------...-.--.IT..EIYIANQ................................................
ENSBTAP00000042391  ...--------...-.--.--..-------................................................
ENSBTAP00000002883  ...IPNL-GPV...T.AN.IT..LLSLAG-................................................
ENSBTAP00000019525  ...--------...-.--.--..-------................................................
ENSBTAP00000006728  ...--------...-.--.--..-------................................................
ENSBTAP00000030722  ...IPSL-GSA...S.SH.IV..SLFLQH-................................................
ENSBTAP00000026919  ...LPDG-LFQ...C.KK.LQ..CLLLGK-................................................
ENSBTAP00000049498  ...--------...-.--.--..-------................................................
ENSBTAP00000026139  ...--------...-.--.--..-------................................................
ENSBTAP00000046486  ...--------...-.--.--..-------................................................
ENSBTAP00000026263  ...--------...-.--.--..-------................................................
ENSBTAP00000056597  ...--------...-.--.--..-------................................................
ENSBTAP00000046208  ...--------...-.--.--..-------................................................
ENSBTAP00000043818  ...--------...-.--.--..-------................................................
ENSBTAP00000030439  ...--------...-.--.--..-------................................................
ENSBTAP00000053958  ...IEG--LHY...L.PS.LH..ILLLHH-................................................
ENSBTAP00000022955  ...LPQNQSLR...A.RS.VQ..LLDLSA-................................................
ENSBTAP00000030440  ...--------...-.--.--..-------................................................
ENSBTAP00000054502  ...--------...-.--.--..-------................................................
ENSBTAP00000004298  ...--------...-.--.--..-------................................................
ENSBTAP00000041674  ...--------...-.--.--..-------................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  nlfrrvpgalrglanlthahler.......................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  daglpdnmfngssnveililssnflrhvpkhlppalyklhlkn...................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  dfsg..........................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  efrgnhldilwrdgd...............................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ldgvliseeeataamkfisgtkitqfsllrhsstkeerprilsiwpsakiltqtsklgphshmsgnwylkitalnldg
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                      90                                 100                110                     
                       |                                   |                  |                     
d1xwdc1               NNLL...Y.IN..................P....EAFQN.......LPN..LQYLLISNT...GIKH......LP...
ENSBTAP00000021162  NRLR...G.LP..................E....D-ISA.......LRA..LKILWLSGA...ELGT......LP...
ENSBTAP00000043657  NAIG...H.LP..................G....SVFSA.......LPN..LTFLSLQGN...ALQT......LP...
ENSBTAP00000055611  NALG...A.LP..................D....AVFAP.......LGN..LLYLHLESN...RIRF......LG...
ENSBTAP00000033782  NKLE...T.FP..................T....E-VCT.......LDN..LRVLDLSEN...QIQT......IP...
ENSBTAP00000011238  NRIK...V.VE..................G....LTFQG.......LDS..LRSLKMQRN...GISK......LK...
ENSBTAP00000000533  NSLQ...Q.LP..................E....T-IGS.......LKN..VTTLKIDEN...QLMY......LP...
ENSBTAP00000004562  NQLK...E.LP..................E....KM---.......PKT..LQELRVHEN...EITK......VR...
ENSBTAP00000049967  NSLK...E.LS..................P....GIFGP.......MHN..LRELWLYDN...HITS......LP...
ENSBTAP00000050839  NRLR...I.MG..................P....GVFAG.......LSA..LTLLDLRLN...QIVL......FL...
ENSBTAP00000003370  NQLK...T.VP..................S....EAIRG.......LSS..LQSLRLDAN...HITS......VP...
ENSBTAP00000053607  NHLQ...L.FP..................E....LLFLG.......TSK..LYRLDLSEN...QIQA......IPrka
ENSBTAP00000054397  AQLR...A.VD..................P....ATFRG.......LGR..LHTLHLDRC...GLRE......LG...
ENSBTAP00000030722  NSLA...E.VN..................S....GSLYG.......LTA..LHQLHLGNN...SISR......IH...
ENSBTAP00000001560  NKLK...V.ID..................S....RWFDS.......TPN..LEILMIGEN...PVIG......IL...
ENSBTAP00000010138  NRIT...T.VE..................K....D-IKN.......LSK..LSMLSIREN...KIKQ......LP...
ENSBTAP00000023310  NEIY...N.LP..................E....S-IGA.......LLH..LKDLWLDGN...QLSE......LP...
ENSBTAP00000016755  RHLR...S.LE..................P....DTFQG.......LER..LQSLHLYRC...QLSS......LP...
ENSBTAP00000002883  NKIK...N.ID..................G....LTFQG.......LGA..LKSLKMQRN...GVTR......LM...
ENSBTAP00000043683  NRLK...L.IP..................L....GVFTG.......LSN..LTKLDISEN...KIVI......LL...
ENSBTAP00000010846  NELT...C.IP..................E....G-FEQ.......LSN..LEDLDLSNN...RLTT......VP...
ENSBTAP00000021903  NLLK...L.IP..................P....GVFTR.......LDN..LTLLDLSEN...KLVI......LL...
ENSBTAP00000000484  NKIT...Y.LH..................N....KTFHP.......VPN..LRSLDLSYN...KLQS......LQ...
ENSBTAP00000055691  NRLK...L.VP..................L....GVFTG.......LSN..LTKLDISEN...KIVI......LL...
ENSBTAP00000040907  NRLT...T.VP..................T....QAFEY.......LSK..LRELWLRNN...PIES......IP...
ENSBTAP00000017631  SQIT...E.FP..................D....--LTG.......TAS..LESLTLTGA...QISS......LP...
ENSBTAP00000018866  NKIF...Y.LP..................N....TTFTQ.......LIN..LQNLDLSFN...QLSS......LH...
ENSBTAP00000044462  NHLV...E.IP..................P....NL---.......PSS..LVELRIHDN...RIRK......VP...
ENSBTAP00000006288  NRLG...G.IP..................A....EALWE.......LPG..LQSLRLDAN...LISL......VP...
ENSBTAP00000056438  NWLT...V.IP..................S....GAFEY.......LSK..LRELWLRNN...PIES......IP...
ENSBTAP00000047707  NWLT...V.IP..................S....GAFEY.......LSK..LRELWLRNN...PIES......IP...
ENSBTAP00000028386  NKIR...E.LR..................S....GAFQG.......AKD..LRWLYLSEN...SLSS......LQ...
ENSBTAP00000050251  NRLR...A.LP..................Q....EALDG.......LGS..LQRLELAGN...LLEE......LR...
ENSBTAP00000009633  NRLT...T.IP..................N....GAFVY.......LSK..LKELWLRNN...PIES......IP...
ENSBTAP00000005771  NRLQ...M.IN..................S....KWFEA.......LPN..LEILMIGEN...PIIR......IK...
ENSBTAP00000034926  NQLS...E.IP..................L....N---L.......PKS..LAELRIHDN...KVKK......IQ...
ENSBTAP00000016317  RQLR...T.LA..................P....ETFQG.......LVK..LHALYLYKC...GLSA......LP...
ENSBTAP00000021517  NDLT...R.VP..................E....C-LYA.......LPG..LRRLNLSSN...QIAE......LS...
ENSBTAP00000033782  NKLR...H.IP..................D....A-LSS.......LKN..LRALNLEYN...RLTI......FP...
ENSBTAP00000053488  NQLE...S.IR..................S....GMFRG.......LEG..LRTLMLRNN...RISC......IH...
ENSBTAP00000022459  NRIS...Y.FL..................N....NTFRP.......VTN..LRNLDLSYN...QLHS......LG...
ENSBTAP00000044542  NRLH...A.LA..................A....HTFLH.......TPG..LASLGLSNN...LLSR......LD...
ENSBTAP00000017571  NHLR...S.IV..................P....GAFDR.......LRS..LSSLTLSEN...RLEF......LP...
ENSBTAP00000055923  SRIE...A.VA..................S....SSLLG.......LRR..LRSLSLQGN...RVRA......VH...
ENSBTAP00000012294  AFLE...F.LP..................A....N-FGR.......LAK..LRILELREN...HLKT......LP...
ENSBTAP00000044542  NQLQ...E.LR..................P....GGFLG.......LRN..LAVLNLSSN...CLRD......LPera
ENSBTAP00000017322  NNLK...T.IE..................Ei...ISFQH.......LHR..LTCLKLWYN...HIAY......IP...
ENSBTAP00000001045  NRIR...A.IE..................N....--IDT.......LTN..LESLFLGKN...KITK......LQ...
ENSBTAP00000016614  NKLE...K.IP..................P....GAFSE.......LSN..LRELYLQNN...HLTDeg....LD...
ENSBTAP00000028517  NHLS...S.VP..................V....GL---.......PVD..LQELRVDEN...RIAV......IS...
ENSBTAP00000027912  NNIR...T.IE..................Ei...ISFQH.......LKR..LTCLKLWHN...KIVT......IP...
ENSBTAP00000016858  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000017631  NHLR...Q.VP..................T....EALQN.......LRS..LQSLRLDAN...RISS......VP...
ENSBTAP00000023709  NQLE...E.VP..................A....AL---.......PRN..LEQLRLSQN...QISR......IP...
ENSBTAP00000028690  ----...-.--..................-....-----.......--A..LVSLSFLKN...LRQI......LG...
ENSBTAP00000055273  NRLR...E.IT..................N....ETFRG.......LRR..LERLYLGKN...RIRH......IQ...
ENSBTAP00000003618  NQLK...F.LE..................A....SWLHG.......LKA..LRHLDLSEN...QLHS......LP...
ENSBTAP00000053607  NRLE...N.VQ..................H....KMFKG.......LES..LKTLMLRSN...RISC......VG...
ENSBTAP00000004298  NHLS...T.IP..................W....GL---.......PRT..IEELRLDDN...RIST......IS...
ENSBTAP00000019854  NNLT...R.IP..................S....PL---.......PRS..LRELHLDHN...QISR......VP...
ENSBTAP00000047764  NNLT...R.IP..................S....PL---.......PRS..LRELHLDHN...QISR......VP...
ENSBTAP00000011082  VSLQ...A.LP..................G....D-VGN.......LAN..LVTLELREN...LLKS......LP...
ENSBTAP00000001193  NNLK...S.IE..................Ei...VSFQH.......LRK..LTVLKLWHN...SITY......IP...
ENSBTAP00000020135  NCIT...T.LR..................P....GVFKD.......LHQ..LTWLILDDN...PISR......IS...
ENSBTAP00000013620  NRIT...L.LK..................P....GVFED.......LHR..LEWLIIEDN...HLNR......IS...
ENSBTAP00000034140  NQLT...R.LE..................D....HSFAG.......LAS..LQELYLNHN...QLYR......IA...
ENSBTAP00000007981  NKLS...V.AP..................Q....FL---.......PRS..LRVADLAAN...EVTE......IF...
ENSBTAP00000054502  NHLS...S.IP..................S....GL---.......PRT..LEELRLDDN...RIST......IP...
ENSBTAP00000015726  NNLV...T.IP..................S....EL---.......PST..LEELKINEN...KLQV......ID...
ENSBTAP00000053353  NFLA...T.MP..................F....L----.......PSS..ITSLKLSQN...RFTC......VP...
ENSBTAP00000015704  NNLE...D.FP..................-....--FPL.......PKS..LERIFLGYN...EISR......LQ...
ENSBTAP00000049410  NRLA...E.LG..................A....GSLRG.......PAN..LQHLILSGN...QLGR......IA...
ENSBTAP00000005636  NHLR...S.IE..................Ei...LSFQH.......CRK..LLTLRLWHN...QIAY......VP...
ENSBTAP00000011445  NEIS...Q.LS..................D....KTFIF.......CMN..LTELHLMSN...SIQK......IK...
ENSBTAP00000024223  NSLS...Q.MWaegdly............L....CFFKG.......LRN..LVQLDLSEN...HLHT......LL...
ENSBTAP00000048641  RDIS...D.LP..................Q....E-LSN.......LLK..LTHLDLSMN...LFTT......IP...
ENSBTAP00000013790  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000006460  NKLR...S.LP..................K....L-GRA.......LPV..LSILDVSFN...ELTS......LP...
ENSBTAP00000056481  NKVR...K.LQ..................K....DTFYG.......LRS..LTRLHMDHN...NIEF......IN...
ENSBTAP00000004800  NRLT...K.IT..................N....DMFSG.......LSN..LHHLILNNN...QLTL......IS...
ENSBTAP00000050251  NRLS...G.LS..................A....AALEG.......APR..LGYLYLERN...RFVR......MP...
ENSBTAP00000040019  NQLI...S.TT..................G....--LCD.......TPT..LMYLDCSHN...HLTE......VE...
ENSBTAP00000029890  NRYL...K.F-..................-....--FKN.......LLN..LEELDISEN...SLSF......LP...
ENSBTAP00000002279  NNLT...EsVG..................P....L----.......PKS..LVDLQLTNN...KISK......LG...
ENSBTAP00000012650  NNLP...C.LV..................D....F---S.......LTQ..LRSLNVSYN...VLEW......FLasg
ENSBTAP00000019066  NELE...E.VP..................S....PL---.......PRS..LEQLQLARN...KVSR......IP...
ENSBTAP00000015445  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000013790  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000053668  QGIT...S.LQ..................F....-----.......-QS..LKEISAGNI...YITD......NS...
ENSBTAP00000056022  NKLE...T.LP..................P....ATLSE.......ETNsiLQELYLTNN...NLTD......KC...
ENSBTAP00000003973  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000053245  NGFH...D.LP..................S....Q-IGS.......LLN..LQTLCLDGN...FLTA......LP...
ENSBTAP00000000176  NRLT...S.LG..................E....GQLRG.......LVN..LRHLILSNN...QLAA......LA...
ENSBTAP00000008348  SDIE...A.SD..................Ccn..LQLKN.......LRH..LQYLNLSYN...EPLG......LE...
ENSBTAP00000026919  EGSK...L.VV..................L....NNLKK.......MVN..LKSLELISC...DLER......IP...
ENSBTAP00000041110  NLLT...G.LE..................K....HIFDN.......MLH..LHSLSLENN...RITS......LS...
ENSBTAP00000007883  NKIH...R.FA..................S....GVCDG.......LQS..LILLNLNNN...QLTW......IP...
ENSBTAP00000048971  NNLL...Y.ID..................A....DAFQN.......LPN..LRYLLISNT...GIKH......LP...
ENSBTAP00000054723  NPLA...D.LS..................P....FAFSGsnasvatPSP..LAELILNRL...ELPA......AE...
ENSBTAP00000016858  ----...-.--..................-....-----.......--H..LQILLMFKT...RPED......FR...
ENSBTAP00000006543  NRLR...G.LR..................V....GAFAG.......LAQ..LRVLYLAGN...QLVQ......LL...
ENSBTAP00000007981  NQLT...Q.LP..................S....GL---.......PAG..LHTLRLQRN...QLRT......LE...
ENSBTAP00000000073  NLLA...T.LP..................P....CTGPA.......LPG..LRALALAGN...PLRT......LQ...
ENSBTAP00000011445  NSFT...S.VPslqrlmlrrvalknvdcsP....SPFRP.......LPN..LVILDLSNN...NIAN......IN...
ENSBTAP00000053488  NKIT...D.LP..................Q....GVFGG.......LFT..LQLLLLNAN...KINC......IR...
ENSBTAP00000055429  NKLR...V.IT..................G....ETLQG.......LWN..LVRLHMDHN...QIEF......IH...
ENSBTAP00000029877  NKLR...V.IT..................G....ETLQG.......LWN..LVRLHMDHN...QIEF......IH...
ENSBTAP00000023907  NRLP...S.LG..................E....DTLRG.......LVN..LQHLIVNNN...QLGG......IA...
ENSBTAP00000053245  NSLE...S.LP..................S....ACAGEes.....LSA..LQLLYLTNN...LLTD......QC...
ENSBTAP00000039209  NRLN...T.LP..................R....G-FGS.......LPA..LEVLDLTYN...NLNEn.....SL...
ENSBTAP00000054898  NKLR...V.IT..................G....ETLQG.......LWN..LVRLHMDHN...QIEF......IH...
ENSBTAP00000010138  NQLT...K.IP..................E....D-VSG.......LVS..LEVLILSNN...LLKK......LP...
ENSBTAP00000002052  NYLE...K.LF..................EeesaTNWIG.......LRK..LQELDVSDN...KLTE......LP...
ENSBTAP00000055075  NRLA...E.VR..................G....DQLRG.......LGN..LRHLILGNN...QIRR......VE...
ENSBTAP00000046486  NKIT...E.IP..................K....GLFDG.......LVS..LQLLLLNAN...KINC......LR...
ENSBTAP00000001716  NHLAvgtA.LN..................T....GGLGP.......LLH..LTSLDLSGN...SLYSg.....LV...
ENSBTAP00000015445  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000048314  NQLQ...T.LP..................-....--LRL.......PAR..LQKLDISNN...LIRK......VT...
ENSBTAP00000054662  QHLF...E.IT..................N....--LEK.......LEN..LKWASFSNN...NLTK......ME...
ENSBTAP00000016614  NRLH...T.LP..................P....GL---.......PRN..VHVLKIKRN...ELVA......LA...
ENSBTAP00000006288  TDIQ...E.FP..................D....--LRG.......TTS..LESLTLTRA...GLQR......LP...
ENSBTAP00000035220  NNIK...L.LE..................K....SDTAY.......QWN..LKYLDVSKN...MLEK......VV...
ENSBTAP00000044349  NCFQ...E.VP..................T....S-LLE.......LRA..LQTLSLGGN...QLQS......IP...
ENSBTAP00000018658  NRLK...S.VT..................W....F---S.......LAG..LRHLDLSFN...DFDT......LPisv
ENSBTAP00000008412  NKIC...Q.LP..................S....D-FGS.......LSK..LKILGLTGN...QFSS......FP...
ENSBTAP00000029331  NSLR...A.LD..................A....TLLRP.......LPR..LRHLDLSLN...GLSR......LP...
ENSBTAP00000043328  NNLL...Y.ID..................A....DAFQN.......LPN..LRYLLISNT...GIKH......LP...
ENSBTAP00000003445  NLIS...S.FP..................W....SDLRN.......LSA..LQLLKMNHN...RLGS......LP...
ENSBTAP00000029056  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000001716  NALR...D.LP..................L....YTFTS.......LAS..LQRLNLQGN...RLSP......CGgpa
ENSBTAP00000037062  NQLS...S.LP..................P....Y-ICQ.......LP-..LRVLIVSNN...KLGA......LP...
ENSBTAP00000025497  ----...-.--..................-....-----.......LKQ..LCILYLGNN...KLCD......LP...
ENSBTAP00000025116  NQLS...T.LP..................V....H-LCE.......LP-..LKVLIASNN...KLVS......LP...
ENSBTAP00000041953  NHLK...S.IP..................P....E-LGD.......CEN..LEKLDCSGNl..ELTE......LP...
ENSBTAP00000007913  NLIS...D.FA..................W....SDLHS.......LSA..LQLLKMDSN...ELTF......IP...
ENSBTAP00000033684  NQIK...V.LT..................E....EVFIY.......TPL..LSYLRLYDN...PWHC......TCeme
ENSBTAP00000055758  NRLL...A.LP..................A....D-FAQ.......LQS..LRCLWIEGN...FLRR......FP...
ENSBTAP00000023771  NNLT...Q.LG..................A....GAFRS.......AGR..LVKLSLANN...NLAG......VH...
ENSBTAP00000000700  NALE...I.VC..................P....E-IGR.......LRA..LRHLRLANN...QLQF......LP...
ENSBTAP00000043299  NSLH...S.LE..................S....RLFHS.......LPQ..LRELDLSSN...NISH......LP...
ENSBTAP00000042745  NQLR...E.LP..................S....T-FGQ.......LSA..LKTLSLSGN...QLRA......LP...
ENSBTAP00000045371  NQIE...R.LY..................P....EMFSG.......LHN..LQYLYLEYN...LIKE......IL...
ENSBTAP00000046486  NQLE...T.AH..................G....RAFRG.......LSG..LKTLMLRSN...LISC......VS...
ENSBTAP00000056638  NGLT...E.LP..................A....E-LGA.......CRS..LEVLSASHN...CLSQ......LP...
ENSBTAP00000013364  NRIE...R.LS..................P....ELFYG.......LQS..LQYLFLQYN...LIRE......IQ...
ENSBTAP00000029056  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000056022  NHLG...D.FP..................L....A-VCN.......IPT..LAELNMSCN...ALRA......VP...
ENSBTAP00000003973  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000006219  NALG...P.GL..................S....PELGP.......LPA..LRVLDLSGN...ALEA......LPpgq
ENSBTAP00000018722  NQLR...T.LD..................E....FLFSE.......LQV..LEVLLLYNN...HIMA......VD...
ENSBTAP00000003370  ASMV...Q.RF..................P....N-LTG.......TVR..LESLTLTGT...KISS......IS...
ENSBTAP00000005510  NNLS...H.VP..................A....GMFQA.......AHS..LMRIDLSHNp..GLRR......VH...
ENSBTAP00000023124  NKIE...T.IS..................R....NAFRG.......LRD..LTHLSLANN...HIKA......LP...
ENSBTAP00000003856  NKLG...S.LP..................E....E-IGQ.......LKQ..LMELDVSCN...EITA......LP...
ENSBTAP00000002625  NKLK...T.VK..................S....AVFQE.......LKV..LEVLLLYNN...HISY......LD...
ENSBTAP00000052577  NRIS...Y.VQ..................D....GAFIN.......LPN..LKSLFLNGN...DIEK......LT...
ENSBTAP00000000604  NLLG...E.LY..................N....YDFDG.......LPK..VAYIDLQKN...HIGI......IQ...
ENSBTAP00000035880  NQLQ...K.IS..................C....HPI--.......TTT..LKHLDLSFN...DFDA......LP...
ENSBTAP00000056147  NKLE...V.LR..................E....DTFLG.......LES..LEYLQADYN...YISA......IE...
ENSBTAP00000026157  NCLS...E.LP..................A....A-LGA.......LPA..LTFLAVTHN...RLRT......LP...
ENSBTAP00000020944  NQIS...E.MC..................S....--LSA.......YES..LTKLILDSN...EITE......IS...
ENSBTAP00000049290  NYLD...T.LS..................R....EKFAG.......LQN..LEYLNVEYN...AIQL......IL...
ENSBTAP00000019433  NAIH...S.VL..................L....D----.......LPS..FKS-----S...WVKR......HR...
ENSBTAP00000056147  NYLE...V.LF..................P....AMFDG.......LQS..LQYLYLEYN...VIKE......IK...
ENSBTAP00000002199  NNLT...F.IS..................P....YSFSM.......LSN..LLQLNISNNp..HLLS......LN...
ENSBTAP00000054101  NALR...A.LG..................R....HDLDG.......LGA..LETLLLFNN...HLAH......LD...
ENSBTAP00000008348  NPLI...F.MA..................E....TSLTG.......PKF..LKHLFLTQT...GISN......LE...
ENSBTAP00000009238  NSLT...A.FP..................W....TSLRD.......MPR..LRTLDLHNN...RITS......VP...
ENSBTAP00000006107  NRIG...C.LN..................A....DIFRG.......LTN..LVRLNLSGN...LFSS......LS...
ENSBTAP00000005757  NHLT...K.LS..................G....GMFLG.......LHN..LEYLYLEYN...GVKE......IL...
ENSBTAP00000049290  NKIK...S.FR..................K....QTFLG.......LDD..LEYLQADFN...LLRD......ID...
ENSBTAP00000013364  NKLE...L.LR..................D....DTFLG.......LES..LEYLQVDYN...YISV......IE...
ENSBTAP00000025189  NEIG...S.IS..................K....NALRG.......LRS..LTHLSLANN...HLET......LP...
ENSBTAP00000021183  NNIK...N.LN..................G....L----.......---..---------...----......--...
ENSBTAP00000014533  NRIK...K.IS..................N....--LEN.......LKS..LDVLDLHGN...QITK......IE...
ENSBTAP00000056496  NRLR...N.LT..................E....GVLRG.......LGK..LEYLYLQAN...LIEA......VA...
ENSBTAP00000045371  NELK...I.LR..................A....DTFLG.......IEN..LEYLQADYN...LIKY......IE...
ENSBTAP00000014977  NRIH...M.VT..................G....LDPQK.......LIS..LHTLELRGN...QLNS......TL...
ENSBTAP00000005757  NSLE...I.LK..................E....DTFHG.......LEN..LEFLQADNN...FITV......IE...
ENSBTAP00000056192  NQLE...A.LL..................P....GTFAP.......LRA..LRALSLAEN...RLAR......LE...
ENSBTAP00000009548  NKLS...N.LT..................E....GMLRG.......MGR..LQFLFVQHN...LIEV......VT...
ENSBTAP00000052577  NKLD...I.FR..................N....DTFLG.......LES..LEYLQADYN...VIKR......IE...
ENSBTAP00000011591  NNIE...A.IE..................G....--LDT.......LVN..LEDLSLFNN...RISK......ID...
ENSBTAP00000012486  NKLY...R.LD..................Dls..SIVQK.......APN..LKILNLSGN...ELKS......ER...
ENSBTAP00000022047  KNLV...H.IE..................A....GAFTN.......LPR..LKYLSICNT...GIHK......LP...
ENSBTAP00000017907  NNLK...A.ME..................Q....--INT.......CTS..LQHLDLSDN...NIPQ......IG...
ENSBTAP00000048314  NKLR...R.VP..................R....AL---.......PAS..LEVLKLNDN...SIYV......LH...
ENSBTAP00000006996  NCMA...A.AL..................Q....IIKKN.......FPE..LLSLNLSCN...KLYH......LD...
ENSBTAP00000053866  NKIC...K.IE..................G....--IEN.......LHN..LQKLNLAGN...EIEH......IP...
ENSBTAP00000010504  NKIR...Q.LP..................E....L----.......PTT..LRFIDISNNrl.GRKG......IK...
ENSBTAP00000007874  NYID...K.LP..................E....T-IGQ.......MTS..LLYLNVSNN...RLTTng....LP...
ENSBTAP00000010530  NRLS...N.LS..................S....SWFRS.......LYV..LKFLNLLGN...LYKT......LG...
ENSBTAP00000024223  NGIT...T.VP..................A....L----.......PSS..LVSLSLSHT...SILV......LG...
ENSBTAP00000006480  NKIK...A.LP..................V....Q-FCQ.......LRE..LTYLKLDDN...ELIR......LP...
ENSBTAP00000017067  NVLT...S.LL..................Pks..CSLLS.......LAT..IKVLDLHDN...QLTA......LP...
ENSBTAP00000032951  NKLR...S.VP..................W....TAFRA.......TPL..LRILDLKHN...RIDA......LP...
ENSBTAP00000052860  RSLT...Y.ID..................S....GALKE.......LPL..LKFLGIFNT...GLRV......FP...
ENSBTAP00000004335  NLIT...R.IE..................G....--LEA.......LSN..LTRLNLSYN...HIND......LS...
ENSBTAP00000006011  NDIW...A.LS..................K....FTFRG.......LKS..LTHLSLANN...NLQT......LP...
ENSBTAP00000016410  NRIS...G.GL..................E....VLAEK.......CPN..LTHLNLSGN...KIKD......LS...
ENSBTAP00000018286  NKLV...A.LP..................T....L----.......PTS..IEVLDVRMN...RLQSsg....IQ...
ENSBTAP00000018076  NSLV...E.LG..................Dl...DPLAS.......LKS..LTYLSILRN...PVTNkkh...YR...
ENSBTAP00000045522  ----...-.--..................-....----K.......LKK..LEYLNLALN...NIEK......IE...
ENSBTAP00000046486  NRLR...C.IP..................V....HSFNG.......LRS..LRVLTLHGN...DISS......VP...
ENSBTAP00000031247  NALC...E.LS..................A....LMLRG.......LRR..LRELRMPGN...RLAA......FP...
ENSBTAP00000024223  SSLY...K.LE..................K....DWFRG.......LGR..LQVLDLSEN...FLYD......YI...
ENSBTAP00000028486  NRIC...G.GL..................D....MLAEK.......LPN..LTHLNLSGN...KLKD......IS...
ENSBTAP00000022049  KNLV...H.IE..................A....GAFTN.......LPR..LKYLSICNT...GIHK......LP...
ENSBTAP00000053639  NSIH...T.IQ..................Q....SAFTG.......LHK..LKKLYLCQN...KIVQ......LN...
ENSBTAP00000011082  NRLC...E.VT..................E....A-IGD.......CEN..LSELILTEN...LLTA......LP...
ENSBTAP00000055544  NNIC...Y.FP..................T....E-IYC.......LKH..LQILNLRNN...PIKE......IP...
ENSBTAP00000056065  NNIC...Y.FP..................T....E-IYC.......LKH..LQILNLRNN...PIKE......IP...
ENSBTAP00000021280  NNIC...Y.FP..................T....E-IYC.......LKH..LQILNLRNN...PIKE......IP...
ENSBTAP00000000604  SQIN...F.LH..................P....DAFQG.......LPH..LTKLRLFSC...GLSDav....LK...
ENSBTAP00000002392  NKIQ...R.IE..................N....--LAC.......VPS..LRFLSLAGN...QIRQ......VE...
ENSBTAP00000026102  ----...-.--..................-....--LKG.......LPR..LRVLWLAEN...PCCG......TC...
ENSBTAP00000053488  NNIT...T.IP..................V....SSFNH.......MPK..LRTFRLHSN...HLFC......--...
ENSBTAP00000054460  CSLT...D.LE..................S....--ISS.......FPA..LKELYLSYN...NIWD......LS...
ENSBTAP00000015694  NQLL...K.LP..................V....L----.......PPK..LTLFNAKYN...KIKSrg....IK...
ENSBTAP00000007978  NKLR...Q.LP..................A....D-FGR.......LVN..LQHLDLLNN...RLVT......LP...
ENSBTAP00000049967  NKLQ...I.LP..................V....GLFQG.......LDN..LESLLLSSN...QLVQ......IQ...
ENSBTAP00000055245  NQLL...K.LP..................V....L----.......PPK..LTLFNAKYN...KIKSrg....IK...
ENSBTAP00000044315  NRIQ...S.VH..................K....NAFNN.......LK-..---------...----......--...
ENSBTAP00000017571  NKIT...H.LP..................S....ALLDN.......LVL..LEQLFLDGN...ELKS......LD...
ENSBTAP00000008412  NKLK...N.LC..................P....E-MGR.......LSN..LEGLDLSDN...PLEA......SS...
ENSBTAP00000022237  NIIS...G.GL..................E....VLAEK.......CPN..LTYLNLSGN...KIKD......LS...
ENSBTAP00000023088  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000024242  KASW...E.TV..................H....TILQE.......LPD..LEELFLCLN...DYET......VS...
ENSBTAP00000014881  NYIA...V.IE..................G....--LEG.......LEG..LRELHVESQ...RLPLgeklvfDP...
ENSBTAP00000002011  NGLA...A.LP..................T....GSFTS.......-SP..LSDVNLSHN...RLRE......VS...
ENSBTAP00000044218  NYIA...V.IE..................G....--LEG.......LEG..LRELHVESQ...RLPLgeklvfDP...
ENSBTAP00000053049  NQLA...S.VP..................V....EAFMG.......LK-..---------...----......--...
ENSBTAP00000053271  NGIK...T.VY..................V....K-YGD.......FKS..LEFLDLSFN...SLTA......EA...
ENSBTAP00000055995  NKIA...S.ME..................C....LCRHP.......PPR..LQHLGLGHN...KLLG......PL...
ENSBTAP00000005490  NKIA...S.ME..................C....LCRHP.......PPR..LQHLGLGHN...KLLG......PL...
ENSBTAP00000055569  NKIA...S.ME..................C....LCRHP.......PPR..LQHLGLGHN...KLLG......PL...
ENSBTAP00000023769  NRLR...R.IP..................K....DALGK.......LS-..-AKIRLAHN...P---......--...
ENSBTAP00000054129  NKIQ...S.IE..................R....RSFEP.......LPF..LQFINLGCN...LLTE......LS...
ENSBTAP00000023886  NSIQ...R.LG..................Ev...NKLAA.......LPR..LRSLTLHGN...PIEEekg...YR...
ENSBTAP00000004849  NKIQ...S.IE..................R....RSFEP.......LPF..LQFINLGCN...LLTE......LS...
ENSBTAP00000041497  NALT...Q.LG..................P....--LAS.......LRQ..LAVLNVADN...RLTG......LE...
ENSBTAP00000003980  QHLQ...Q.LK..................R....SDLRG.......LGE..LRKLTIVKS...GLRS......VA...
ENSBTAP00000015158  ----...-.--..................-....-----.......--E..LQSLSIPGTyqeKITH......LG...
ENSBTAP00000002402  NLIT...S.LK..................G....-----.......---..---------...----......--...
ENSBTAP00000056550  NSLV...S.LE..................G....--IEC.......LTA..LESLNLYYN...RISS......LA...
ENSBTAP00000027480  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000007444  NQFH...D.FP..................E....Q-LTT.......LPA..LENINLEEN...EIVD......VP...
ENSBTAP00000025849  NFIT...D.IR..................P....--LQS.......CMK..LIKLDLHGN...QVLL......LL...
ENSBTAP00000000533  NDLT...A.LP..................A....S-IAN.......LIN..LRELDVSKN...GIQE......FP...
ENSBTAP00000045403  KELT...E.VI..................D....--LSR.......FKK..LKYLWLHHN...KLRK......VI...
ENSBTAP00000045610  NNIK...S.IS..................R....HTFRG.......LKS..LIHLI----...----......--...
ENSBTAP00000014097  KRLE...I.IN..................E....DDLEA.......YVG..LKNLTIVDS...GLKS......VA...
ENSBTAP00000021517  ----...-.--..................-....--VKA.......MTS..LRWLKLNRT...GLCY......LP...
ENSBTAP00000053704  KRLE...I.IN..................E....DDLEA.......YVG..LKNLTIVDS...GLKS......VA...
ENSBTAP00000042391  ----...-.--..................N....RILRR.......LIR..VETLWLVDN...SLVD......LS...
ENSBTAP00000002883  NKIV...E.IL..................P....EHLRQ.......FQS..LETLDLSGN...NISE......--...
ENSBTAP00000019525  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000006728  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000030722  NRIR...S.--..................-....-----.......---..---------...----......--...
ENSBTAP00000026919  NSLM...S.LS..................P....H-VGE.......LSN..LTHLELIGN...YLET......LP...
ENSBTAP00000049498  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000026139  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000046486  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000026263  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000056597  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000046208  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000043818  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000030439  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000053958  NELI...N.LD..................Atv..KELKG.......MLN..L--------...----......--...
ENSBTAP00000022955  NGLQ...R.LP..................W....SFFRD.......LEQ..LQLLIVTNN...SL--......--...
ENSBTAP00000030440  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000054502  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000004298  ----...-.--..................-....-----.......---..---------...----......--...
ENSBTAP00000041674  ----...-.--..................-....-----.......---..---------...----......--...


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  frgavdiknlqldynhisciedgafralrdlevltlnnnnitrlsvasfnhmpklrtfrlhsnnlycdchlawlsdwl
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  fqglaklhslhleggclarlg.........................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  geaafeletldlshnqllffpllpqcsklhtlllrdnnmgfyrdlyntsspqemvaqfllvdgnvtnittvnlwe...
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  etgnmshletlglsgakiqksdfqkiahlqlntvllglrtlshyeegslpilnttrlhivlpvntnfwvllhdgikts
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  epgpsg........................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  tlismlqiprnrnlgnyakcespqelknkklrqikseqlcneeeseqleprpqlsgkppviktev.............
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  glg...........................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  rqrprvglytqcmgpshlrghnvaevqkrefvcsggtsgkepacqcsvlhcpaactcsnnivdcrgkglteiptnlpe
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  kilevinidlqksqftsyesqqipilenaktsilllnkvdlswddlflifqlvwhtsveyfqiqhvtfggkvyldhns
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  titeirleqnsikvip..............................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  fdysntvmrtiklehvhfrifnipqesiyllftkmdienltisdaqmphmlfpmyptrfqylnfanniltddvfkksi
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                        120               130                                       
                                          |                 |                                       
d1xwdc1               ....................D..VH...KIH.SL..QKV..LLDIQDN..............................
ENSBTAP00000021162  ....................S..G-...FCE.LA..SLE..SLMLDNN..............................
ENSBTAP00000043657  ....................A..GL...FTQ.SP..GLV..SLSLSHN..............................
ENSBTAP00000055611  ....................K..NA...FAQ.LG..KLR..FLNLSANelqpslrhaatfaplrslstlilsanslqh
ENSBTAP00000033782  ....................S..E-...ICN.LK..GIQ..KLNISNNqfiyfpvelchlqsleelnisqing.....
ENSBTAP00000011238  ....................D..GA...FFG.LD..NME..ELELEHN..............................
ENSBTAP00000000533  ....................D..S-...IGG.LV..SIE..ELDCSFN..............................
ENSBTAP00000004562  ....................K..SV...FNG.LN..QMI..VVELGTN..............................
ENSBTAP00000049967  ....................D..NV...FSS.LS..QLQ..VLILSRN..............................
ENSBTAP00000050839  ....................D..GA...FRE.LG..SLQ..QLEVGDNhlvfvapgafaglaklstltlercnlstvp
ENSBTAP00000003370  ....................E..DS...FEG.LT..QLR..HLWLDDN..............................
ENSBTAP00000053607  ....................P..GA...FSP.YK..KLR..RIDLSNN..............................
ENSBTAP00000054397  ....................P..GL...FRG.LA..ALQ..YLYLQDN..............................
ENSBTAP00000030722  ....................R..DG...WSF.CQ..KLH..ELILSFN..............................
ENSBTAP00000001560  ....................D..MN...FKP.LS..NLR..SLVLAGM..............................
ENSBTAP00000010138  ....................A..E-...IGE.LC..NLI..TLDVAHN..............................
ENSBTAP00000023310  ....................Q..E-...IGN.LK..NLL..CLDVSEN..............................
ENSBTAP00000016755  ....................G..TI...FRG.LV..SLQ..YLYLQEN..............................
ENSBTAP00000002883  ....................D..GA...FWG.LS..NME..ILQLDHN..............................
ENSBTAP00000043683  ....................D..YM...FQD.LY..NLK..SLEVGDN..............................
ENSBTAP00000010846  ....................A..S-...FSF.LS..SLM..RLNLSSN..............................
ENSBTAP00000021903  ....................D..YT...FQD.LR..SLR..RLEVGDNdlvfisrrafagllaleeltlercnltals
ENSBTAP00000000484  ....................S..EQ...FKG.LR..KLI..ILHLRSN..............................
ENSBTAP00000055691  ....................D..YM...FQD.LH..NLK..SLEVGDNdlvyishrafsgllsleqltlekcnltavp
ENSBTAP00000040907  ....................S..YA...FNR.VP..SLR..RLDLGEL..............................
ENSBTAP00000017631  ....................Q..TV...CDQ.LP..NLQ..VLDLSYN..............................
ENSBTAP00000018866  ....................P..EL...FYG.LR..KLQ..TLHLRSN..............................
ENSBTAP00000044462  ....................K..GV...FSG.LR..NMN..CIEMGGNplensgfepgafdglklnylrise......
ENSBTAP00000006288  ....................D..RS...FEG.LT..SLR..HLWLDDN..............................
ENSBTAP00000056438  ....................S..YA...FNR.VP..SLM..RLDLGEL..............................
ENSBTAP00000047707  ....................S..YA...FNR.VP..SLM..RLDLGEL..............................
ENSBTAP00000028386  ....................P..GA...LDD.VE..NLA..KFYLDRN..............................
ENSBTAP00000050251  ....................P..GT...FGA.LG..AVT..TLNLAHN..............................
ENSBTAP00000009633  ....................S..YA...FNR.IP..SLR..RLDLGEL..............................
ENSBTAP00000005771  ....................D..MN...FKP.LI..NLR..SLVIAGI..............................
ENSBTAP00000034926  ....................K..AT...FKG.MN..ALH..VLEMSANpldnngiepgafegvtvfhiriae......
ENSBTAP00000016317  ....................A..GI...FGG.LH..SLQ..YLYLQDN..............................
ENSBTAP00000021517  ....................L..C-...IDQ.WV..HLE..TLNLSRN..............................
ENSBTAP00000033782  ....................K..A-...LCF.LP..KLI..SLNLTGN..............................
ENSBTAP00000053488  ....................N..DS...FTG.LR..NVR..LLSLYDN..............................
ENSBTAP00000022459  ....................S..EQ...FRG.LR..KLL..SLHLRSN..............................
ENSBTAP00000044542  ....................E..GL...FRG.LA..HLW..DLNLGWN..............................
ENSBTAP00000017571  ....................S..AL...FLH.SH..NLT..FLTLSENpleelpkvlfgeigglrelrlkstqlrtlp
ENSBTAP00000055923  ....................G..GA...FRD.CS..ALE..HLLLNDN..............................
ENSBTAP00000012294  ....................K..S-...MHK.LA..QLE..RLDLGNN..............................
ENSBTAP00000044542  ....................P..LA...FAG.LS..GLR..RLFLKGN..............................
ENSBTAP00000017322  ....................I..Q-...IGN.LT..NLE..RLYLNRN..............................
ENSBTAP00000001045  ....................N..--...LDA.LT..NLT..VLSMQSN..............................
ENSBTAP00000016614  ....................N..ET...FWK.LS..SLE..YLDLSSN..............................
ENSBTAP00000028517  ....................D..MA...FQN.LT..SLE..RLIVDGN..............................
ENSBTAP00000027912  ....................P..S-...ITH.VK..NLE..SLYFSNN..............................
ENSBTAP00000016858  ....................-..--...---.--..---..-------..............................
ENSBTAP00000017631  ....................P..SC...FSG.LH..SLR..HLWLDDN..............................
ENSBTAP00000023709  ....................P..GV...FSK.LE..NLL..LLDLQHNklsdgvfkpdtfqglknlmqlnlahntlrk
ENSBTAP00000028690  ....................E..EQ...LEG.NY..SFY..VLD----..............................
ENSBTAP00000055273  ....................P..GA...FDV.FD..RLL..ELKLQDNelralpplrlprlllldlshnglsalepgv
ENSBTAP00000003618  ....................P..GL...LEN.FT..DLL..TLDLSNN..............................
ENSBTAP00000053607  ....................N..DS...FIG.LS..SVR..LLSLYDN..............................
ENSBTAP00000004298  ....................S..PS...LQG.LT..SLK..RLVLDGN..............................
ENSBTAP00000019854  ....................N..NA...LEG.LE..NLT..ALYLHHN..............................
ENSBTAP00000047764  ....................N..NA...LEG.LE..NLT..ALYLHHN..............................
ENSBTAP00000011082  ....................A..S-...LSF.LV..KLE..QLDLGGN..............................
ENSBTAP00000001193  ....................E..H-...IKK.LT..SLE..RLSFSHN..............................
ENSBTAP00000020135  ....................Q..RL...FTG.LN..SLF..FLSMVNN..............................
ENSBTAP00000013620  ....................P..LT...FYG.LN..SLI..LLVLMNN..............................
ENSBTAP00000034140  ....................P..RA...FAG.LS..NLL..RLHLNSN..............................
ENSBTAP00000007981  ....................P..LT...FGE.KP..ALR..SVYLHNN..............................
ENSBTAP00000054502  ....................L..HA...FKG.LS..SLR..RLVLDGN..............................
ENSBTAP00000015726  ....................E..ES...LSD.LN..QLV..TLELEGNnlsetnvnslafkplkslsylrlgrnkfri
ENSBTAP00000053353  ....................E..A-...ILH.LP..HLR..SLDMSSN..............................
ENSBTAP00000015704  ....................T..NA...VNG.LV..NLT..MLDLCFNkiddsvlqekvlakmeklmqlnlcn.....
ENSBTAP00000049410  ....................P..GA...FDD.FLg.SLE..DLDLSYN..............................
ENSBTAP00000005636  ....................E..H-...VRK.LR..GLE..QLYLSHN..............................
ENSBTAP00000011445  ....................N..DP...FKN.LK..NLI..KLDLSHN..............................
ENSBTAP00000024223  ....................P..RH...LDN.LPk.SLR..QLRLRDN..............................
ENSBTAP00000048641  ....................P..A-...VLN.MP..ALE..WLDMGSN..............................
ENSBTAP00000013790  ....................-..--...---.--..---..-----S-..............................
ENSBTAP00000006460  ....................S..DT...LHG.LS..RLQ..ELYLRGN..............................
ENSBTAP00000056481  ....................P..EV...FYG.LT..SLR..LVHLEGN..............................
ENSBTAP00000004800  ....................S..TA...FDD.VF..ALE..ELDLSYN..............................
ENSBTAP00000050251  ....................G..AA...LLA.LP..SLF..SLHLQDNaldhlaqlhldr..................
ENSBTAP00000040019  ....................G..--...IEQ.CG..LLQ..ILKLQGN..............................
ENSBTAP00000029890  ....................L..GV...FDS.MPp.NLK..TLSLAKN..............................
ENSBTAP00000002279  ....................S..--...FDG.LV..NLT..FIHLQHN..............................
ENSBTAP00000012650  ....................E..FA...SSD.LS..SLR..FLDMSQN..............................
ENSBTAP00000019066  ....................Q..GT...FSN.LE..NLT..LLDLQHNklldnafqrdtfkglknlmqlnmaknalrn
ENSBTAP00000015445  ....................-..--...---.--..---..-------..............................
ENSBTAP00000013790  ....................-..--...---.--..---..-------..............................
ENSBTAP00000053668  ....................N..LC...YYH.TI..NWT..TLFSTAN..............................
ENSBTAP00000056022  ....................V..SL...LTG.HP..HLK..VLHMAYN..............................
ENSBTAP00000003973  ....................-..--...---.--..---..TLYVLDN..............................
ENSBTAP00000053245  ....................E..E-...LGN.LQ..QLS..SLGISFN..............................
ENSBTAP00000000176  ....................A..GA...LDD.CAe.TLE..DLDLSYN..............................
ENSBTAP00000008348  ....................D..QA...FKE.CP..QLE..LLDVAFT..............................
ENSBTAP00000026919  ....................H..S-...IFS.LN..NLH..ELDLREN..............................
ENSBTAP00000041110  ....................G..--...LQK.AF..TLI..ELYVSNNyialnqeiynlkglcnlvildmygniivwn
ENSBTAP00000007883  ....................Q..E-...ISR.LK..NLR..CLSINHN..............................
ENSBTAP00000048971  ....................A..--...VHK.IQ..SLQkvLLDIQDN..............................
ENSBTAP00000054723  ....................-..--...---.--..---..-------..............................
ENSBTAP00000016858  ....................D..LS...FPK.LI..MITd.YLLLFRV..............................
ENSBTAP00000006543  ....................D..FT...FLH.LQ..RLQ..ELHLQEN..............................
ENSBTAP00000007981  ....................P..EP...LAG.LH..QLQ..ELSLAHN..............................
ENSBTAP00000000073  ....................P..GA...FAC.FP..ELR..LLNLSYTklgrgdhediadatfagvggaplaalqvld
ENSBTAP00000011445  ....................D..EL...LKG.LE..KLE..ILDLQHN..............................
ENSBTAP00000053488  ....................L..DA...FQD.LQ..NLS..LLSLYDN..............................
ENSBTAP00000055429  ....................P..EA...FRG.LT..SLR..LLHLEGN..............................
ENSBTAP00000029877  ....................P..EA...FRG.LT..SLR..LLHLEGN..............................
ENSBTAP00000023907  ....................E..EA...FED.FLl.TLE..DLDLSYN..............................
ENSBTAP00000053245  ....................V..PV...LVG.HP..HLR..ILHLANN..............................
ENSBTAP00000039209  ....................P..GN...FFY.LT..TLR..ALYLSDN..............................
ENSBTAP00000054898  ....................P..EA...FRG.LT..SLR..LLHLEGN..............................
ENSBTAP00000010138  ....................H..G-...LGN.LR..KLR..ELDLEEN..............................
ENSBTAP00000002052  ....................A..LF...LHS.FK..SLS..CLNVSRN..............................
ENSBTAP00000055075  ....................S..AA...FDAfLS..TVE..DLDLSYN..............................
ENSBTAP00000046486  ....................V..NT...FQD.LQ..SLS..LLSLYDN..............................
ENSBTAP00000001716  ....................E..QL...LGE.AP..ALR..TLSLAEN..............................
ENSBTAP00000015445  ....................-..--...---.--..---..-------..............................
ENSBTAP00000048314  ....................A..QD...FRD.LR..DLK..HLFLDNN..............................
ENSBTAP00000054662  ....................G..--...LES.CV..NLE..ELTLDGN..............................
ENSBTAP00000016614  ....................R..GA...LAG.MA..QLR..ELYLTGN..............................
ENSBTAP00000006288  ....................P..GM...CQQ.LP..RLR..VLELSHN..............................
ENSBTAP00000035220  ....................L..I-...KNT.LR..SLE..VLNLSSN..............................
ENSBTAP00000044349  ....................A..E-...IEN.LR..SLE..CLYLGGN..............................
ENSBTAP00000018658  qlphlktlilkdnkletlslV..SH...FAS.NT..SLR..HLDLSENllqhendenclwpetlvtmn..........
ENSBTAP00000008412  ....................K..E-...ILS.LA..SLE..KLYIGQDeg............................
ENSBTAP00000029331  ....................P..GL...FDG.LP..ALR..SLSLRAN..............................
ENSBTAP00000043328  ....................A..--...VHK.IQ..SLQkvLLDIQDN..............................
ENSBTAP00000003445  ....................R..DA...LGA.LP..DLR..SLRINNN..............................
ENSBTAP00000029056  ....................-..--...---.--..---..-------..............................
ENSBTAP00000001716  ....................C..VA...FSG.IS..SLR..VLNLADN..............................
ENSBTAP00000037062  ....................P..D-...ISA.LG..SLR..QLDVSSN..............................
ENSBTAP00000025497  ....................R..E-...LSL.LQ..NLR..TLWVEAN..............................
ENSBTAP00000025116  ....................E..E-...IGH.LR..HLT..ELDVSCN..............................
ENSBTAP00000041953  ....................F..E-...LSN.LK..QVS..FVDISAN..............................
ENSBTAP00000007913  ....................R..DA...FRS.LR..ALR..SLQLNHN..............................
ENSBTAP00000033684  ....................D..--...---.--..---..------Stlchnyvfpiqtldcrr.............
ENSBTAP00000055758  ....................R..P-...LLR.LV..ALQ..SLQMGDN..............................
ENSBTAP00000023771  ....................E..AA...FET.LE..SLQ..VLELNDN..............................
ENSBTAP00000000700  ....................P..E-...VGD.LK..ELQ..TLDISTN..............................
ENSBTAP00000043299  ....................A..SL...GES.WE..NLT..VLAIQQN..............................
ENSBTAP00000042745  ....................P..Q-...LCS.LR..HLD..VVDLSKN..............................
ENSBTAP00000045371  ....................A..GT...FDS.MP..NLQ..LLYLNNN..............................
ENSBTAP00000046486  ....................N..DT...FAG.LS..SVR..LLSLYDN..............................
ENSBTAP00000056638  ....................T..S-...LAD.LS..RLR..KLNLSHN..............................
ENSBTAP00000013364  ....................P..GT...FDP.VP..NLQ..LLFLNNN..............................
ENSBTAP00000029056  ....................-..--...---.--..---..-------..............................
ENSBTAP00000056022  ....................A..A-...VGA.MH..NLQ..TFLLDGN..............................
ENSBTAP00000003973  ....................-..--...---.--..---..-------..............................
ENSBTAP00000006219  ....................P..AE...PPG.LP..QLQ..SLNLSGN..............................
ENSBTAP00000018722  ....................R..CA...FDD.MT..QLQ..KLYLSQN..............................
ENSBTAP00000003370  ....................N..NL...CQE.QK..RLR..TLDLSYN..............................
ENSBTAP00000005510  ....................P..LA...FQG.LA..QLR..DLDLSFG..............................
ENSBTAP00000023124  ....................R..DV...FSD.LD..SLI..ELDLRGN..............................
ENSBTAP00000003856  ....................Q..Q-...IGQ.LK..SLR..ELNVRRN..............................
ENSBTAP00000002625  ....................P..SA...FGG.LS..QLQ..KLYLSGN..............................
ENSBTAP00000052577  ....................P..GM...FRG.LQ..SLH..YLYFEFN..............................
ENSBTAP00000000604  ....................D..KT...FKF.LG..KLN..TLDLRDNalktiyflpsipniflsgnklmtlpniplt
ENSBTAP00000035880  ....................Ic.KE...FGN.LT..QLN..FLGLSATklqqldllpiahlhlscilldledymkenk
ENSBTAP00000056147  ....................A..GA...FSK.LN..KLK..VLILNDN..............................
ENSBTAP00000026157  ....................P..A-...LGA.LS..SLQ..RLDLSGN..............................
ENSBTAP00000020944  ....................G..--...LEL.CS..SLT..YLSLANN..............................
ENSBTAP00000049290  ....................P..GT...FNA.MP..KLR..ILILNNN..............................
ENSBTAP00000019433  ....................G..SL...RNR.LP..FLK..LLTLQRN..............................
ENSBTAP00000056147  ....................P..LT...FDA.LI..NLQ..LLFLNNN..............................
ENSBTAP00000002199  ....................K..YT...FAN.TS..SLR..YLDLRNT..............................
ENSBTAP00000054101  ....................E..RA...FHR.LG..TLS..RLYLGCN..............................
ENSBTAP00000008348  ....................F..IP...VHN.LE..NLE..SLHLGSN..............................
ENSBTAP00000009238  ....................K..EA...VRY.LK..NLT..YLDLSSN..............................
ENSBTAP00000006107  ....................Q..GT...FDY.LG..SLR..SLEFQTE..............................
ENSBTAP00000005757  ....................P..GT...FNP.MP..KLK..VLYLNNN..............................
ENSBTAP00000049290  ....................P..GA...FQD.LN..KLE..VLILNDN..............................
ENSBTAP00000013364  ....................P..NA...FGK.LH..LLQ..VLILNDN..............................
ENSBTAP00000025189  ....................R..FL...FRG.LE..TLT..HVDLRGN..............................
ENSBTAP00000021183  ....................-..--...---.--..---..-------..............................
ENSBTAP00000014533  ....................N..--...VNH.LC..DLR..VLNLARN..............................
ENSBTAP00000056496  ....................P..GA...FWE.CP..NIV..NVDLSMN..............................
ENSBTAP00000045371  ....................R..GA...FNK.LH..KLK..VLILNDN..............................
ENSBTAP00000014977  ....................-..--...GIN.LP..KLK..NLFLAQN..............................
ENSBTAP00000005757  ....................P..SA...FSK.LN..RLK..VLILNDN..............................
ENSBTAP00000056192  ....................P..AV...LGA.LP..LLR..ALSLQDN..............................
ENSBTAP00000009548  ....................P..AA...FSE.CP..SLI..SIDLSSN..............................
ENSBTAP00000052577  ....................S..GA...FRN.LS..KLR..VLILNDN..............................
ENSBTAP00000011591  ....................S..--...LDA.LV..KLQ..VLSLGNN..............................
ENSBTAP00000012486  ....................E..LD...KIK.GL..KLE..ELWLDGN..............................
ENSBTAP00000022047  ....................D..VTk..IFS.SE..FNF..ILEICDN..............................
ENSBTAP00000017907  ....................D..--...LSK.LV..SLK..TLLLHGN..............................
ENSBTAP00000048314  ....................G..SD...FEG.LK..KLK..ILELKNN..............................
ENSBTAP00000006996  ....................GlsDI...VHM.VP..T--..-------..............................
ENSBTAP00000053866  ....................A..WL...GKK.LK..CLR..VLNLKAN..............................
ENSBTAP00000010504  ....................Q..EA...FKD.MY..DLH..HLYLTDN..............................
ENSBTAP00000007874  ....................V..E-...LNQ.LK..NIR..TVNLGLN..............................
ENSBTAP00000010530  ....................Et.SL...FSH.LP..NLR..TLKVGNS..............................
ENSBTAP00000024223  ....................P..TH...FTG.LH..ALR..FLYMDGN..............................
ENSBTAP00000006480  ....................F..K-...MGQ.LR..NLR..FLSAARN..............................
ENSBTAP00000017067  ....................D..D-...IGQ.LT..ALQ..VLNMERN..............................
ENSBTAP00000032951  ....................E..LA...LQF.LV..NLT..YLDLSSN..............................
ENSBTAP00000052860  ....................D..LTk..IYS.TD..VFF..ILEITDN..............................
ENSBTAP00000004335  ....................G..--...---.--..---..-------..............................
ENSBTAP00000006011  ....................R..DI...FRP.LD..ILS..DLDLRGN..............................
ENSBTAP00000016410  ....................Ti.EP...LKK.LE..NLK..SLDLFNC..............................
ENSBTAP00000018286  ....................P..EA...FRA.LE..KLQ..FLYLADN..............................
ENSBTAP00000018076  ....................L..YV...IYK.VP..QVR..VLDFQ--..............................
ENSBTAP00000045522  ....................N..--...LEG.CE..GLT..KLDLTVN..............................
ENSBTAP00000046486  ....................E..GS...FND.LT..SLS..HLLLHT-..............................
ENSBTAP00000031247  ....................W..AA...LRD.AP..QLR..LLDLQAN..............................
ENSBTAP00000024223  ....................TktTI...FND.LT..QLR..RLNLSFN..............................
ENSBTAP00000028486  ....................Tl.EP...LKK.LE..CLK..SLDLFNC..............................
ENSBTAP00000022049  ....................D..VTk..IFS.SE..FNF..ILEICDN..............................
ENSBTAP00000053639  ....................P..KT...FLP.LK..NLI..LLNLHGN..............................
ENSBTAP00000011082  ....................H..S-...LGK.LT..KLT..NLNVDRN..............................
ENSBTAP00000055544  ....................S..T-...IQQ.LK..LLK..SLNVAFN..............................
ENSBTAP00000056065  ....................S..T-...IQQ.LK..LLK..SLNVAFN..............................
ENSBTAP00000021280  ....................S..T-...IQQ.LK..LLK..SLNVAFN..............................
ENSBTAP00000000604  ....................D..GY...FRN.LA..SLT..HLDLSKN..............................
ENSBTAP00000002392  ....................N..--...LRD.LP..HLQ..FLDLSEN..............................
ENSBTAP00000026102  ....................P..H-...LYR.MT..VLR..TL-----..............................
ENSBTAP00000053488  ....................-..--...---.--..---..-------..............................
ENSBTAP00000054460  ....................P..--...LCL.LE..QLE..VLDLEGN..............................
ENSBTAP00000015694  ....................A..NT...FKK.LH..NLS..FLYLDHN..............................
ENSBTAP00000007978  ....................V..S-...FAQ.LK..SLK..WLDLKDN..............................
ENSBTAP00000049967  ....................P..AH...FTH.FS..NLK..ELQLHGN..............................
ENSBTAP00000055245  ....................A..NT...FKK.LH..NLS..FLYLDHN..............................
ENSBTAP00000044315  ....................-..--...---.--..---..-------..............................
ENSBTAP00000017571  ....................Q..NL...FQK.LV..HLQ..ELFLNQN..............................
ENSBTAP00000008412  ....................L..PV...LSG.IR..QLR..ELRLYRT..............................
ENSBTAP00000022237  ....................Tv.EA...LQN.LK..NLK..SLDLFNC..............................
ENSBTAP00000023088  ....................-..--...LWS.LT..HLT..ALYLSDN..............................
ENSBTAP00000024242  ....................C..P-...SIC.CH..SLK..LLHITDN..............................
ENSBTAP00000014881  ....................R..TL...HSL.AK..SLS..ILNISNN..............................
ENSBTAP00000002011  ....................V..SA...FAT.HSqgRAL..HVDLSHN..............................
ENSBTAP00000044218  ....................R..TL...HSL.AK..SLS..ILNISNN..............................
ENSBTAP00000053049  ....................-..--...---.--..---..-------..............................
ENSBTAP00000053271  ....................I..CD...LGI.LP..HLR..VLLLTGN..............................
ENSBTAP00000055995  ....................E..--...---.--..---..-------..............................
ENSBTAP00000005490  ....................E..--...---.--..---..-------..............................
ENSBTAP00000055569  ....................E..--...---.--..---..-------..............................
ENSBTAP00000023769  ....................-..--...---.--..---..-------..............................
ENSBTAP00000054129  ....................F..GTfqaWHG.MQ..FLH..KLILNRN..............................
ENSBTAP00000023886  ....................Q..YV...LCT.LP..HIT..TFDFSG-..............................
ENSBTAP00000004849  ....................F..GTfqaWHG.MQ..FLH..KLILNRN..............................
ENSBTAP00000041497  ....................P..--...LAA.CE..NLQ..CLNAAGN..............................
ENSBTAP00000003980  ....................P..NA...FHY.TP..RLG..RLNLSFN..............................
ENSBTAP00000015158  ....................N..S-...LMN.LT..SLK..SLDLSRN..............................
ENSBTAP00000002402  ....................-..--...IQY.LC..SLQ..DLNLYYN..............................
ENSBTAP00000056550  ....................Ev.FR...LHS.LA..GLL..DVDLRLN..............................
ENSBTAP00000027480  ....................-..--...---.--..---..-------..............................
ENSBTAP00000007444  ....................V..EK...LAA.MP..ALH..LINLRFN..............................
ENSBTAP00000025849  ....................L..--...---.--..---..-------..............................
ENSBTAP00000000533  ....................E..N-...IKN.CK..VLT..VVEASVN..............................
ENSBTAP00000045403  ....................F..--...LTS.NH..FLL..EIYINHN..............................
ENSBTAP00000045610  ....................-..--...---.--..---..-------..............................
ENSBTAP00000014097  ....................H..KA...FLK.NS..NLQ..HINFTRN..............................
ENSBTAP00000021517  ....................E..E-...LAS.LQ..KLE..HLSVSHN..............................
ENSBTAP00000053704  ....................H..KA...FLK.NS..NLQ..HINFTRN..............................
ENSBTAP00000042391  ....................A..--...-LR.LP..SCR..VLNMNKN..............................
ENSBTAP00000002883  ....................-..--...---.--..---..-------..............................
ENSBTAP00000019525  ....................-..--...---.--..---..-------..............................
ENSBTAP00000006728  ....................-..--...---.--..---..-------..............................
ENSBTAP00000030722  ....................-..--...---.--..---..-------..............................
ENSBTAP00000026919  ....................P..E-...LEG.CQ..SLKrsCLIVEEN..............................
ENSBTAP00000049498  ....................-..--...---.--..---..-------..............................
ENSBTAP00000026139  ....................-..--...---.--..---..-------..............................
ENSBTAP00000046486  ....................-..--...---.--..---..-------..............................
ENSBTAP00000026263  ....................-..--...---.--..---..-------..............................
ENSBTAP00000056597  ....................-..--...---.--..---..-------..............................
ENSBTAP00000046208  ....................-..--...---.--..MLS..SLYLSNK..............................
ENSBTAP00000043818  ....................-..--...---.--..-LS..SLYLSNK..............................
ENSBTAP00000030439  ....................-..--...---.--..---..-------..............................
ENSBTAP00000053958  ....................-..--...---.--..---..-------..............................
ENSBTAP00000022955  ....................-..--...---.--..---..-------..............................
ENSBTAP00000030440  ....................-..--...---.--..MLS..SLYLSNK..............................
ENSBTAP00000054502  ....................-..--...---.--..---..-------..............................
ENSBTAP00000004298  ....................-..--...---.--..---..-------..............................
ENSBTAP00000041674  ....................-..--...---.--..---..-------..............................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  lgprvfqhlsrlgllslrg...........................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  gpalarlpalgalklreldigrlpagalrglgqlreleihhwpalealepgslgglnlsslaith.............
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  geslghlrglgalrlrhlaiaaledqnfqrlpgllhleidnwplleevaagslrglnltslsvth.............
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  tealshlrslislhlkhlninnmpvyafkrlfhlkhleidywplldmmpanslyglnltslsitn.............
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  aaafrnltglrvlevsls............................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  mppkvpsaihqlylds..............................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ldtanvetlrlag.................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ipqglpasieelylennqieeiteisfnhtrkinviglrynkieenriaplawinqenlesidlsynklyhvpsylpk
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  mpprlpantmqlfldn..............................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  qenyrlfvifhlpelkaldgisieppetecakdlfggrltsdmiaerqghpnftqmqelnwtsssirtvdlipvdqfr
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  lsg...........................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  anfiqlsenrlenlndlyfllqvphlqililnqnrfsfchqnhapsenssleklflgenmlqla..............
ENSBTAP00000035880  keslqilntkklhlvfhpnsffsvqvdisanslgclqltniklndyncqvllkflsgltggptllnftlnhmettwkc
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  slvhlvlig.....................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  nvcnvnlqnnnltsfsgliylpnvkvlclnynhiesiiprlkpqthltsrqllyqkvpssgygqqgtskmnrdt....
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  lvkvfqflwpkpieylniynltivesideevftyykttlkalkiehitnkvfifsqtalytvfsemnilmltisdtrf
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ihmlcpqepstfkflnftqnsftdsvfqncdtlarletlilqknelkdlfktslmtkdmlsletldvswnsleydrsn
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                   140                    150                                       
                                     |                      |                                       
d1xwdc1               .............INI..HT..I........ER.NSFVG.LSFE..................................
ENSBTAP00000021162  .............-GL..RA..L........PA.Q-FSR.LQR-..................................
ENSBTAP00000043657  .............-QL..ET..V........PE.AAFAN.LTS-..................................
ENSBTAP00000055611  .............NQL..AH..L........AP.EAFWG.LEA-..................................
ENSBTAP00000033782  .............KKL..TR..L........PE.E-LSN.MTK-..................................
ENSBTAP00000011238  .............-NL..TE..V........NK.GWLYG.LRM-..................................
ENSBTAP00000000533  .............-EL..EA..L........PS.S-IGQ.LTN-..................................
ENSBTAP00000004562  .............-PL..KSsgI........EN.GAFQG.MKK-..................................
ENSBTAP00000049967  .............-QI..SY..I........SP.DAFNG.LVE-..................................
ENSBTAP00000050839  .............CNL..SS..V........PF.QALHH.LSF-..................................
ENSBTAP00000003370  .............-SL..TE..V........PV.HPLSN.LPT-..................................
ENSBTAP00000053607  .............-QI..SE..L........AP.DAFQG.LRS-..................................
ENSBTAP00000054397  .............-GL..QA..L........PD.DAFSD.LGN-..................................
ENSBTAP00000030722  .............-NL..TR..L........DE.ESLAD.LSS-..................................
ENSBTAP00000001560  .............-YL..TD..I........PG.NALVG.LDS-..................................
ENSBTAP00000010138  .............-QL..EH..L........PK.E-IGN.CTQ-..................................
ENSBTAP00000023310  .............-RL..ER..L........PE.E-ISG.LTS-..................................
ENSBTAP00000016755  .............-SL..VH..L........QD.DLFAD.LAN-..................................
ENSBTAP00000002883  .............-NL..TE..I........TK.GWLYG.LLM-..................................
ENSBTAP00000043683  .............-DL..VY..I........SH.RAFSG.LNS-..................................
ENSBTAP00000010846  .............-QL..KS..L........PA.E-LSG.MKR-..................................
ENSBTAP00000021903  .............TNI..TA..V........PS.AALRH.QAH-..................................
ENSBTAP00000000484  .............-SL..KT..V........PI.RVFQD.CRN-..................................
ENSBTAP00000055691  .............TNL..ST..I........PF.LAFKH.LVY-..................................
ENSBTAP00000040907  .............KRL..EY..I........SE.AAFEG.LVNLrylnlgmcnlkdipnltalvr.............
ENSBTAP00000017631  .............-LL..ED..L........PS.--FSV.CQK-..................................
ENSBTAP00000018866  .............-SL..RT..I........PV.RLFWD.CRS-..................................
ENSBTAP00000044462  .............AKL..TG..I........PK.D----.LPET..................................
ENSBTAP00000006288  .............-AL..TE..I........PV.RALSH.LRA-..................................
ENSBTAP00000056438  .............KKL..EY..I........SE.GAFEG.LFNLkylnlgmcnikdmpnltplvg.............
ENSBTAP00000047707  .............KKL..EY..I........SE.GAFEG.LFNLkylnlgmcnikdmpnltplvg.............
ENSBTAP00000028386  .............-QL..SS..Y........PS.AALSK.LRV-..................................
ENSBTAP00000050251  .............-AL..VY..L........PA.MAFQG.LVR-..................................
ENSBTAP00000009633  .............KRL..SY..I........SE.GAFEG.LSN-..................................
ENSBTAP00000005771  .............-NL..TE..I........PD.NALVG.LEN-..................................
ENSBTAP00000034926  .............AKL..TS..I........PK.E----.LPST..................................
ENSBTAP00000016317  .............-HI..EY..L........QD.DIFVD.LVN-..................................
ENSBTAP00000021517  .............-QL..TS..L........PS.A-ICK.LTK-..................................
ENSBTAP00000033782  .............-LI..NS..L........PK.E-IKE.LKN-..................................
ENSBTAP00000053488  .............-QI..AT..I........SP.GAFDT.LQALstlnllanpfncncqlawlgdwlrkrkivtgnpr
ENSBTAP00000022459  .............-SL..RT..I........PV.RIFQD.CRN-..................................
ENSBTAP00000044542  .............-SL..TV..L........PD.TAFQG.LAG-..................................
ENSBTAP00000017571  .............PRL..SA..L........PE.DAFRG.LGE-..................................
ENSBTAP00000055923  .............-LL..AA..L........PA.DAFLG.LRR-..................................
ENSBTAP00000012294  .............-EF..SE..L........PE.V-LDQ.IQN-..................................
ENSBTAP00000044542  .............-SI..AD..V........DE.RSLGG.LAE-..................................
ENSBTAP00000017322  .............-KI..EK..I........PT.Q-LFY.CRK-..................................
ENSBTAP00000001045  .............-RL..TK..I........EG.--LQS.LVN-..................................
ENSBTAP00000016614  .............-NL..SR..V........PA.G----.LPRS..................................
ENSBTAP00000028517  .............-LL..TNkgI........AE.GTFGH.LTK-..................................
ENSBTAP00000027912  .............-KL..ES..L........PV.A-VFS.LQK-..................................
ENSBTAP00000016858  .............---..--..-........--.-----.----..................................
ENSBTAP00000017631  .............-AL..TE..I........PV.QAFRS.LSA-..................................
ENSBTAP00000023709  .............NRI..EA..I........PS.GYFKS.FPN-..................................
ENSBTAP00000028690  .............---..--..-........--.-----.----..................................
ENSBTAP00000055273  .............LGL..RH..L........DE.GLFGR.LRN-..................................
ENSBTAP00000003618  .............-QL..QT..L........PP.DLLRG.PLN-..................................
ENSBTAP00000053607  .............-QI..TT..I........AP.GAFDT.LHSLstlnllanpfncncylawlgewlrkkrivtgnpr
ENSBTAP00000004298  .............-LL..NNhgL........GD.KVFFN.LVN-..................................
ENSBTAP00000019854  .............-EI..QE..V........GS.S-MKG.LRS-..................................
ENSBTAP00000047764  .............-EI..QE..V........GS.S-MKG.LRS-..................................
ENSBTAP00000011082  .............-DL..EV..L........PD.T-LGA.LPN-..................................
ENSBTAP00000001193  .............-KI..EV..L........PS.H-LFL.CNK-..................................
ENSBTAP00000020135  .............-HL..QV..L........PK.QMCAQ.MPQ-..................................
ENSBTAP00000013620  .............-VL..TR..L........PD.KSLCQ.HMPR..................................
ENSBTAP00000034140  .............-LL..RA..V........DN.RWFEM.LPS-..................................
ENSBTAP00000007981  .............-QL..SNagL........PP.DAFRG.SEA-..................................
ENSBTAP00000054502  .............-LLanQR..I........AD.DTFSR.LQN-..................................
ENSBTAP00000015726  .............NQI..ER..I........PG.YVFGH.MEPG..................................
ENSBTAP00000053353  .............-DI..RY..L........PG.PVHWR.SLN-..................................
ENSBTAP00000015704  .............NRL..ES..M........PP.G----.LPSS..................................
ENSBTAP00000049410  .............-NL..RQ..V........PW.AGIGA.MPA-..................................
ENSBTAP00000005636  .............-KL..ET..L........PT.Q-LGM.CSS-..................................
ENSBTAP00000011445  .............-GL..SS..T........KL.GTQLQ.LEN-..................................
ENSBTAP00000024223  .............-NL..AF..F........NW.SSLTV.LPR-..................................
ENSBTAP00000048641  .............-RL..EQ..L........PD.T-IER.MQN-..................................
ENSBTAP00000013790  .............-NL..TT..I........GG.RSLYN.RG--..................................
ENSBTAP00000006460  .............-QL..RT..L........PP.ELLVP.TPH-..................................
ENSBTAP00000056481  .............-QL..TK..L........HP.DTFVS.LRY-..................................
ENSBTAP00000004800  .............-NL..ET..I........PW.DAVEK.MVS-..................................
ENSBTAP00000050251  .............NQL..GE..V........PT.EALEG.LPA-..................................
ENSBTAP00000040019  .............-YL..SE..L........PF.--LGN.HVL-..................................
ENSBTAP00000029890  .............-GL..KS..F........SW.ERLQS.LKN-..................................
ENSBTAP00000002279  .............QLK..ED..A........VS.AALKG.LKS-..................................
ENSBTAP00000012650  .............-QF..QY..L........PD.GFLKK.MPS-..................................
ENSBTAP00000019066  .............NSI..EG..I........PE.NYFNV.IPK-..................................
ENSBTAP00000015445  .............---..--..-........--.-----.----..................................
ENSBTAP00000013790  .............---..--..-........--.-----.----..................................
ENSBTAP00000053668  .............---..--..-........--.-----.----..................................
ENSBTAP00000056022  .............-RL..QS..F........PA.SKMAK.LEE-..................................
ENSBTAP00000003973  .............QNL..QQ..L........GS.W----.----..................................
ENSBTAP00000053245  .............-NF..SQ..I........PE.V-YEK.LTMLdkvfmagnrvevlnlgvlkrmshvkhvdlrilrm
ENSBTAP00000000176  .............-NL..EQ..L........PW.EALGR.LGN-..................................
ENSBTAP00000008348  .............HLH..VK..A........PH.SPFQN.LHL-..................................
ENSBTAP00000026919  .............NLK..TV..E........EI.ISFQH.LQN-..................................
ENSBTAP00000041110  .............T--..--..-........--.-----.---Ssenlppimns........................
ENSBTAP00000007883  .............-QL..AS..I........PR.E-LCF.LEN-..................................
ENSBTAP00000048971  .............INI..HT..V........ER.NSFMG.LSFE..................................
ENSBTAP00000054723  .............---..--..-........--.--RQN.LSLEgmvaaalraghalrg...................
ENSBTAP00000016858  .............YGL..ES..L........KD.L-FPN.LTV-..................................
ENSBTAP00000006543  .............-SI..EL..L........ED.QALAG.LSS-..................................
ENSBTAP00000007981  .............-RL..RVggI........GP.GTWHE.LQA-..................................
ENSBTAP00000000073  .............TFL..PR..V........RS.GWIRN.LPR-..................................
ENSBTAP00000011445  .............-NL..AR..LwkhanpggPV.QFLKG.LFH-..................................
ENSBTAP00000053488  .............-KI..QS..L........AK.GTFTS.LRA-..................................
ENSBTAP00000055429  .............-LL..RQ..L........HP.ATFST.FAF-..................................
ENSBTAP00000029877  .............-LL..RQ..L........HP.ATFST.FAF-..................................
ENSBTAP00000023907  .............-NL..HG..L........PW.GSVRR.MIN-..................................
ENSBTAP00000053245  .............-QL..QT..F........PA.SKLNK.LEQ-..................................
ENSBTAP00000039209  .............-DF..EI..L........PP.D-IGK.LTK-..................................
ENSBTAP00000054898  .............-LL..RQ..L........HP.ATFST.FAF-..................................
ENSBTAP00000010138  .............-KL..ES..L........PN.E-IAY.LKD-..................................
ENSBTAP00000002052  .............-NL..KA..F........PD.AWACP.LKCCkasknaleslpdkmavfwknhlkdvdfsenalke
ENSBTAP00000055075  .............-NL..EA..L........PW.EAVGQ.MVN-..................................
ENSBTAP00000046486  .............-KL..QT..I........SK.GLFAP.LQA-..................................
ENSBTAP00000001716  .............-SL..TR..L........GR.RTFLS.TPA-..................................
ENSBTAP00000015445  .............---..--..I........RG.NVLYE.NTH-..................................
ENSBTAP00000048314  .............-IV..SL..F........EA.GALQK.CSQ-..................................
ENSBTAP00000054662  .............-CI..SK..I........EG.--ISK.LTK-..................................
ENSBTAP00000016614  .............-RL..RNraL........GP.RAWTD.LSG-..................................
ENSBTAP00000006288  .............-LI..EG..L........PS.--LRG.CQK-..................................
ENSBTAP00000035220  .............-KL..WT..V........PT.N----.MPSK..................................
ENSBTAP00000044349  .............-FI..KE..I........PP.E-LGN.LPS-..................................
ENSBTAP00000018658  .............LSF..NK..F........AD.SVFGC.LPRN..................................
ENSBTAP00000008412  .............AKL..TH..L........PE.C-IKR.LQN-..................................
ENSBTAP00000029331  .............-RL..QS..L........DR.RTFEP.LAG-..................................
ENSBTAP00000043328  .............INI..HT..V........ER.NSFMG.LSFE..................................
ENSBTAP00000003445  .............-RL..RT..L........AP.GTFDA.LSA-..................................
ENSBTAP00000029056  .............---..--..-........--.-----.----..................................
ENSBTAP00000001716  .............-EM..EI..L........QA.GAFLH.TPLAeldlssnpgldvapgalaglegs...........
ENSBTAP00000037062  .............-EL..QS..L........PT.E-LCS.LPT-..................................
ENSBTAP00000025497  .............-YL..TK..L........PE.V-VCE.LSL-..................................
ENSBTAP00000025116  .............-EI..QT..I........PS.Q-IGN.LEA-..................................
ENSBTAP00000041953  .............-KF..AS..V........PI.C-VLR.MSN-..................................
ENSBTAP00000007913  .............-RL..HT..L........AE.GTFAP.LTA-..................................
ENSBTAP00000033684  .............KEL..KK..V........PN.N----.IPPD..................................
ENSBTAP00000055758  .............-RL..RA..L........PA.E-LPR.MTG-..................................
ENSBTAP00000023771  .............-NL..RS..L........NV.AALTA.LPA-..................................
ENSBTAP00000000700  .............-RL..LT..L........PE.R-LHL.CLS-..................................
ENSBTAP00000043299  .............-RL..RQ..L........DR.ALLES.MPR-..................................
ENSBTAP00000042745  .............-QI..RS..I........LD.T-VGE.LQ--..................................
ENSBTAP00000045371  .............-LL..KS..L........PV.YIFSG.AP--..................................
ENSBTAP00000046486  .............-RI..TT..I........TP.GAFTT.LVS-..................................
ENSBTAP00000056638  .............-RF..AH..I........PV.C-VFS.LKE-..................................
ENSBTAP00000013364  .............-LL..QT..L........PS.GVFSG.LT--..................................
ENSBTAP00000029056  .............---..--..-........--.-----.----..................................
ENSBTAP00000056022  .............-FL..QT..L........PA.E-LEN.MHQ-..................................
ENSBTAP00000003973  .............---..--..-........--.-----.--V-..................................
ENSBTAP00000006219  .............-RL..RE..L........PA.DLARC.APR-..................................
ENSBTAP00000018722  .............-QI..SR..F........PL.ELVKE.----..................................
ENSBTAP00000003370  .............-SI..KD..L........PS.--FNG.CHA-..................................
ENSBTAP00000005510  .............-GL..AF..L........SL.EALEG.LPG-..................................
ENSBTAP00000023124  .............KF-..--..-........--.-----.----..................................
ENSBTAP00000003856  .............-YL..KV..L........PQ.E-LVD.LP--..................................
ENSBTAP00000002625  .............-FL..TQ..F........PM.DLYVG.RF--..................................
ENSBTAP00000052577  .............-VI..RE..I........QP.AAFSL.MPN-..................................
ENSBTAP00000000604  .............WET..GS..C........WD.I-FKG.LSH-..................................
ENSBTAP00000035880  gncswvgsivvlnLSS..NA..L........TD.SVFRC.LPPR..................................
ENSBTAP00000056147  .............-LL..LS..L........PS.N-VFR.FVL-..................................
ENSBTAP00000026157  .............-LL..EA..L........PP.E-IGG.LGS-..................................
ENSBTAP00000020944  .............-KI..TT..I........NG.--LGM.LP--..................................
ENSBTAP00000049290  .............-LL..RS..L........PV.DVFAG.VS--..................................
ENSBTAP00000019433  .............-KL..SN..I........PK.G-LWK.LKS-..................................
ENSBTAP00000056147  .............-LL..RS..L........PD.NIFGG.TA--..................................
ENSBTAP00000002199  .............-GL..QT..L........DE.AAFQN.LIT-..................................
ENSBTAP00000054101  .............-KL..SS..F........SF.NHLHG.LGA-..................................
ENSBTAP00000008348  .............-HI..SS..I........NL.PENFP.TQN-..................................
ENSBTAP00000009238  .............-RL..TT..L........PP.DFLES.WSH-..................................
ENSBTAP00000006107  .............YLL..CD..-........--.-----.----..................................
ENSBTAP00000005757  .............-LL..QV..L........PP.HIFSG.VP--..................................
ENSBTAP00000049290  .............-LI..ST..L........PA.NVFQY.VP--..................................
ENSBTAP00000013364  .............-LL..SS..L........PN.NLFRF.VP--..................................
ENSBTAP00000025189  .............PF-..--..-........--.-----.----..................................
ENSBTAP00000021183  .............---..--..-........--.---EA.VGDT..................................
ENSBTAP00000014533  .............-FL..SH..V........DN.--LNG.LDS-..................................
ENSBTAP00000056496  .............-RI..QR..L........HS.ATFAG.LAR-..................................
ENSBTAP00000045371  .............-LI..SF..L........PD.N----.----..................................
ENSBTAP00000014977  .............-ML..KK..V........EG.--LEN.LSN-..................................
ENSBTAP00000005757  .............-AI..ES..L........PP.NIFRF.VP--..................................
ENSBTAP00000056192  .............-DL..PA..L........AS.GLLAG.LPA-..................................
ENSBTAP00000009548  .............-RL..SR..L........DG.ATFAS.LAS-..................................
ENSBTAP00000052577  .............-LI..PM..L........PT.N-LFK.AVS-..................................
ENSBTAP00000011591  .............HIG..NM..M........NI.IYLRR.FKA-..................................
ENSBTAP00000012486  .............---..--..-........--.-----.----..................................
ENSBTAP00000022047  .............LHI..TT..I........PR.NAFQG.MNNE..................................
ENSBTAP00000017907  .............-II..TS..L........RM.A-PAY.LPRC..................................
ENSBTAP00000048314  .............-LI..SS..I........ST.SMLSS.LVS-..................................
ENSBTAP00000006996  .............---..--..-........--.-----.----..................................
ENSBTAP00000053866  .............-KI..SS..L........QDvSKLKP.LQD-..................................
ENSBTAP00000010504  .............-NL..DH..I........PL.P----.LPEN..................................
ENSBTAP00000007874  .............-HL..DS..V........PT.T-LGA.LKE-..................................
ENSBTAP00000010530  .............NSF..TE..I........HE.KDFTG.LTFLeeleisaqnlqiyvpkslksiqnishlilhlkqp
ENSBTAP00000024223  .............---..--..-........-C.YYMNP.CPR-..................................
ENSBTAP00000006480  .............-KL..PF..L........PS.E-FKN.LS--..................................
ENSBTAP00000017067  .............-QL..TY..L........PR.S-IGN.LIQ-..................................
ENSBTAP00000032951  .............-RL..TV..V........SK.NVFLN.WPA-..................................
ENSBTAP00000052860  .............PYM..TS..I........PA.NAFQG.LCNE..................................
ENSBTAP00000004335  .............---..--..-........-L.MPLHG.IKHK..................................
ENSBTAP00000006011  .............-SL..--..-........--.-----.----..................................
ENSBTAP00000016410  .............-EV..TN..L........ND.Y----.----..................................
ENSBTAP00000018286  .............-LL..DA..I........PP.S----.LPLS..................................
ENSBTAP00000018076  .............---..--..-........--.-----.----..................................
ENSBTAP00000045522  .............-FI..GE..L........SSvKTLQG.NIH-..................................
ENSBTAP00000046486  .............---..--..-........--.-----.----..................................
ENSBTAP00000031247  .............-RL..SA..V........PP.EAARF.LGN-..................................
ENSBTAP00000024223  .............-YH..KK..V........SF.-----.----..................................
ENSBTAP00000028486  .............-EV..TN..L........ND.Y----.----..................................
ENSBTAP00000022049  .............LHI..TT..I........PR.NAFQG.MNNE..................................
ENSBTAP00000053639  .............-LI..SY..F........DV.P----.----..................................
ENSBTAP00000011082  .............-HL..EA..L........PP.E-IGG.CVA-..................................
ENSBTAP00000055544  .............-LI..TT..L........PP.G-LFC.LRY-..................................
ENSBTAP00000056065  .............-LI..TT..L........PP.G-LFC.LRY-..................................
ENSBTAP00000021280  .............-LI..TT..L........PP.G-LFC.LRY-..................................
ENSBTAP00000000604  .............-KI..QSlyL........HP.S-FRE.LNS-..................................
ENSBTAP00000002392  .............-LI..ET..L........KL.---DE.FPES..................................
ENSBTAP00000026102  .............---..--..-........--.-----.----..................................
ENSBTAP00000053488  .............---..--..-........--.-----.----..................................
ENSBTAP00000054460  .............---..--..-........--.-----.----..................................
ENSBTAP00000015694  .............-AL..ES..V........PL.N----.LPES..................................
ENSBTAP00000007978  .............---..--..-........--.-----.----..................................
ENSBTAP00000049967  .............-HL..EY..I........PD.GVFDH.LVG-..................................
ENSBTAP00000055245  .............-AL..ES..V........PL.N----.LPES..................................
ENSBTAP00000044315  .............---..--..-........--.-----.----..................................
ENSBTAP00000017571  .............-QL..AF..L........PA.SLFTH.LGN-..................................
ENSBTAP00000008412  .............-DL..AD..I........PV.V-ICK.LLHH..................................
ENSBTAP00000022237  .............-EI..TN..L........ED.Y----.----..................................
ENSBTAP00000023088  .............-SL..SR..I........PS.D-IAK.LHN-..................................
ENSBTAP00000024242  .............-NL..QD..W........TEiRKLGV.MFPS..................................
ENSBTAP00000014881  .............-NI..DD..I........RD.--LEI.LEN-..................................
ENSBTAP00000002011  .............LLQ..RL..L........PH.SSRAG.QPA-..................................
ENSBTAP00000044218  .............-NI..DD..I........RD.--LEI.LEN-..................................
ENSBTAP00000053049  .............---..--..-........--.-----.----..................................
ENSBTAP00000053271  .............-GL..TS..L........PP.S-LAV.AEQEasvtslttkryilrfpa.................
ENSBTAP00000055995  .............---..-S..L........HV.T-SDH.WPN-..................................
ENSBTAP00000005490  .............---..-S..L........HV.T-SDH.WPN-..................................
ENSBTAP00000055569  .............---..-S..L........HV.T-SDH.WPN-..................................
ENSBTAP00000023769  .............---..--..-........--.-----.----..................................
ENSBTAP00000054129  .............-PL..TA..V........ED.SYLFK.LPA-..................................
ENSBTAP00000023886  .............---..--..-........--.-----.----..................................
ENSBTAP00000004849  .............-PL..TA..V........ED.SYLFK.LPA-..................................
ENSBTAP00000041497  .............LLA..GP..A........QL.QCLAG.LRG-..................................
ENSBTAP00000003980  .............-AL..ES..L........SW.KTVQG.LS--..................................
ENSBTAP00000015158  .............-SL..VS..L........EG.--IEC.LTA-..................................
ENSBTAP00000002402  .............NIP..SL..V........EV.SRLQP.LPF-..................................
ENSBTAP00000056550  .............PVV..KS..E........PD.Y----.----..................................
ENSBTAP00000027480  .............---..--..-........--.-----.----..................................
ENSBTAP00000007444  .............---..--..-........--.-----.----..................................
ENSBTAP00000025849  .............-QI..KS..L........PD.TKFWSgLKN-..................................
ENSBTAP00000000533  .............-PI..SK..L........--.-----.----..................................
ENSBTAP00000045403  .............-TI..VE..I........EK.--MHL.VPS-..................................
ENSBTAP00000045610  .............---..--..-........--.-----.----..................................
ENSBTAP00000014097  .............-KL..TI..L........SR.KHFRH.LD--..................................
ENSBTAP00000021517  .............-NL..TT..L........HG.E-LSS.LPS-..................................
ENSBTAP00000053704  .............-KL..TI..L........SR.KHFRH.LD--..................................
ENSBTAP00000042391  .............-HL..TS..F........KQ.--LPK.IPQ-..................................
ENSBTAP00000002883  .............---..--..-........--.-----.----..................................
ENSBTAP00000019525  .............---..--..-........--.-----.----..................................
ENSBTAP00000006728  .............---..--..-........--.-----.----..................................
ENSBTAP00000030722  .............---..--..-........--.-----.----..................................
ENSBTAP00000026919  .............-LL..NT..L........P-.-----.----..................................
ENSBTAP00000049498  .............---..--..-........--.-----.----..................................
ENSBTAP00000026139  .............---..--..-........--.-----.----..................................
ENSBTAP00000046486  .............---..--..-........--.-----.----..................................
ENSBTAP00000026263  .............---..--..-........--.-----.----..................................
ENSBTAP00000056597  .............---..--..-........--.-----.----..................................
ENSBTAP00000046208  .............KLY..LV..H........GL.STIME.ISST..................................
ENSBTAP00000043818  .............KPY..LM..H........GL.STIME.----..................................
ENSBTAP00000030439  .............---..--..-........--.-----.----..................................
ENSBTAP00000053958  .............---..--..-........--.-----.----..................................
ENSBTAP00000022955  .............---..--..-........--.-----.----..................................
ENSBTAP00000030440  .............KPY..LV..H........GL.STIKE.IAST..................................
ENSBTAP00000054502  .............---..--..-........--.-----.----..................................
ENSBTAP00000004298  .............---..--..-........--.-----.----..................................
ENSBTAP00000041674  .............---..--..-........--.-----.----..................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  cqnpdflrqiplqdvaspdfrceegqeeggclprpqcpqecacldtvvrcsnkhlqtlpkgipknvtelyldgnqftl
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  cqkpyflkeipiqdvaiqdftcddgnddnscsplsrcpaectcldtvvrcsnkalkvlpkgiprdvtelyldgnqftl
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  nhlktmiienlegnkyithmdlrdnrltdldlsslcnleqlhcernqlreltlsgfslrtlyansnrlttvnvypvps
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  vplglfqlda....................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  illvdilvdivssldcfelrdtnlhtfhfseasisemstsvkklifrnvqftdesfvevvklfnyvsgilevefddct
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  vpaqlstfky....................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  vpkelsnykh....................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  l.............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  hdgigdfralsldrirhlgnvetltirklhipqfflfhdlssiypltgrvkrvtienskvflvpcllsqhlksleyld
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                                                                                    
                                                                                                    
d1xwdc1               ..............................................................................
ENSBTAP00000021162  ..............................................................................
ENSBTAP00000043657  ..............................................................................
ENSBTAP00000055611  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000011238  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000004562  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000050839  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000054397  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000001560  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000023310  ..............................................................................
ENSBTAP00000016755  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000043683  ..............................................................................
ENSBTAP00000010846  ..............................................................................
ENSBTAP00000021903  ..............................................................................
ENSBTAP00000000484  ..............................................................................
ENSBTAP00000055691  ..............................................................................
ENSBTAP00000040907  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000018866  ..............................................................................
ENSBTAP00000044462  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000056438  ..............................................................................
ENSBTAP00000047707  ..............................................................................
ENSBTAP00000028386  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000009633  ..............................................................................
ENSBTAP00000005771  ..............................................................................
ENSBTAP00000034926  ..............................................................................
ENSBTAP00000016317  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000033782  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000022459  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000055923  ..............................................................................
ENSBTAP00000012294  ..............................................................................
ENSBTAP00000044542  ..............................................................................
ENSBTAP00000017322  ..............................................................................
ENSBTAP00000001045  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000028517  ..............................................................................
ENSBTAP00000027912  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000017631  ..............................................................................
ENSBTAP00000023709  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000055273  ..............................................................................
ENSBTAP00000003618  ..............................................................................
ENSBTAP00000053607  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000019854  ..............................................................................
ENSBTAP00000047764  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000001193  ..............................................................................
ENSBTAP00000020135  ..............................................................................
ENSBTAP00000013620  ..............................................................................
ENSBTAP00000034140  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000015726  ..............................................................................
ENSBTAP00000053353  ..............................................................................
ENSBTAP00000015704  ..............................................................................
ENSBTAP00000049410  ..............................................................................
ENSBTAP00000005636  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000048641  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000006460  ..............................................................................
ENSBTAP00000056481  ..............................................................................
ENSBTAP00000004800  ..............................................................................
ENSBTAP00000050251  ..............................................................................
ENSBTAP00000040019  ..............................................................................
ENSBTAP00000029890  ..............................................................................
ENSBTAP00000002279  ..............................................................................
ENSBTAP00000012650  ..............................................................................
ENSBTAP00000019066  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000000176  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000041110  ..............................................................................
ENSBTAP00000007883  ..............................................................................
ENSBTAP00000048971  ..............................................................................
ENSBTAP00000054723  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000006543  ..............................................................................
ENSBTAP00000007981  ..............................................................................
ENSBTAP00000000073  ..............................................................................
ENSBTAP00000011445  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000055429  ..............................................................................
ENSBTAP00000029877  ..............................................................................
ENSBTAP00000023907  ..............................................................................
ENSBTAP00000053245  ..............................................................................
ENSBTAP00000039209  ..............................................................................
ENSBTAP00000054898  ..............................................................................
ENSBTAP00000010138  ..............................................................................
ENSBTAP00000002052  ..............................................................................
ENSBTAP00000055075  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000054662  ..............................................................................
ENSBTAP00000016614  ..............................................................................
ENSBTAP00000006288  ..............................................................................
ENSBTAP00000035220  ..............................................................................
ENSBTAP00000044349  ..............................................................................
ENSBTAP00000018658  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000029331  ..............................................................................
ENSBTAP00000043328  ..............................................................................
ENSBTAP00000003445  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000001716  ..............................................................................
ENSBTAP00000037062  ..............................................................................
ENSBTAP00000025497  ..............................................................................
ENSBTAP00000025116  ..............................................................................
ENSBTAP00000041953  ..............................................................................
ENSBTAP00000007913  ..............................................................................
ENSBTAP00000033684  ..............................................................................
ENSBTAP00000055758  ..............................................................................
ENSBTAP00000023771  ..............................................................................
ENSBTAP00000000700  ..............................................................................
ENSBTAP00000043299  ..............................................................................
ENSBTAP00000042745  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000056638  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000056022  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000006219  ..............................................................................
ENSBTAP00000018722  ..............................................................................
ENSBTAP00000003370  ..............................................................................
ENSBTAP00000005510  ..............................................................................
ENSBTAP00000023124  ..............................................................................
ENSBTAP00000003856  ..............................................................................
ENSBTAP00000002625  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000035880  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000026157  ..............................................................................
ENSBTAP00000020944  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000019433  ..............................................................................
ENSBTAP00000056147  ..............................................................................
ENSBTAP00000002199  ..............................................................................
ENSBTAP00000054101  ..............................................................................
ENSBTAP00000008348  ..............................................................................
ENSBTAP00000009238  ..............................................................................
ENSBTAP00000006107  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000049290  ..............................................................................
ENSBTAP00000013364  ..............................................................................
ENSBTAP00000025189  ..............................................................................
ENSBTAP00000021183  ..............................................................................
ENSBTAP00000014533  ..............................................................................
ENSBTAP00000056496  ..............................................................................
ENSBTAP00000045371  ..............................................................................
ENSBTAP00000014977  ..............................................................................
ENSBTAP00000005757  ..............................................................................
ENSBTAP00000056192  ..............................................................................
ENSBTAP00000009548  ..............................................................................
ENSBTAP00000052577  ..............................................................................
ENSBTAP00000011591  ..............................................................................
ENSBTAP00000012486  ..............................................................................
ENSBTAP00000022047  ..............................................................................
ENSBTAP00000017907  ..............................................................................
ENSBTAP00000048314  ..............................................................................
ENSBTAP00000006996  ..............................................................................
ENSBTAP00000053866  ..............................................................................
ENSBTAP00000010504  ..............................................................................
ENSBTAP00000007874  ..............................................................................
ENSBTAP00000010530  lsenlmseetlknsackdawpflqtlvlrqnrlkslektgellltlenlnnldisknnflsmpetcqwpgkmkqlnls
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000006480  ..............................................................................
ENSBTAP00000017067  ..............................................................................
ENSBTAP00000032951  ..............................................................................
ENSBTAP00000052860  ..............................................................................
ENSBTAP00000004335  ..............................................................................
ENSBTAP00000006011  ..............................................................................
ENSBTAP00000016410  ..............................................................................
ENSBTAP00000018286  ..............................................................................
ENSBTAP00000018076  ..............................................................................
ENSBTAP00000045522  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000031247  ..............................................................................
ENSBTAP00000024223  ..............................................................................
ENSBTAP00000028486  ..............................................................................
ENSBTAP00000022049  ..............................................................................
ENSBTAP00000053639  ..............................................................................
ENSBTAP00000011082  ..............................................................................
ENSBTAP00000055544  ..............................................................................
ENSBTAP00000056065  ..............................................................................
ENSBTAP00000021280  ..............................................................................
ENSBTAP00000000604  ..............................................................................
ENSBTAP00000002392  ..............................................................................
ENSBTAP00000026102  ..............................................................................
ENSBTAP00000053488  ..............................................................................
ENSBTAP00000054460  ..............................................................................
ENSBTAP00000015694  ..............................................................................
ENSBTAP00000007978  ..............................................................................
ENSBTAP00000049967  ..............................................................................
ENSBTAP00000055245  ..............................................................................
ENSBTAP00000044315  ..............................................................................
ENSBTAP00000017571  ..............................................................................
ENSBTAP00000008412  ..............................................................................
ENSBTAP00000022237  ..............................................................................
ENSBTAP00000023088  ..............................................................................
ENSBTAP00000024242  ..............................................................................
ENSBTAP00000014881  ..............................................................................
ENSBTAP00000002011  ..............................................................................
ENSBTAP00000044218  ..............................................................................
ENSBTAP00000053049  ..............................................................................
ENSBTAP00000053271  ..............................................................................
ENSBTAP00000055995  ..............................................................................
ENSBTAP00000005490  ..............................................................................
ENSBTAP00000055569  ..............................................................................
ENSBTAP00000023769  ..............................................................................
ENSBTAP00000054129  ..............................................................................
ENSBTAP00000023886  ..............................................................................
ENSBTAP00000004849  ..............................................................................
ENSBTAP00000041497  ..............................................................................
ENSBTAP00000003980  ..............................................................................
ENSBTAP00000015158  ..............................................................................
ENSBTAP00000002402  ..............................................................................
ENSBTAP00000056550  ..............................................................................
ENSBTAP00000027480  ..............................................................................
ENSBTAP00000007444  ..............................................................................
ENSBTAP00000025849  ..............................................................................
ENSBTAP00000000533  ..............................................................................
ENSBTAP00000045403  ..............................................................................
ENSBTAP00000045610  ..............................................................................
ENSBTAP00000014097  ..............................................................................
ENSBTAP00000021517  ..............................................................................
ENSBTAP00000053704  ..............................................................................
ENSBTAP00000042391  ..............................................................................
ENSBTAP00000002883  ..............................................................................
ENSBTAP00000019525  ..............................................................................
ENSBTAP00000006728  ..............................................................................
ENSBTAP00000030722  ..............................................................................
ENSBTAP00000026919  ..............................................................................
ENSBTAP00000049498  ..............................................................................
ENSBTAP00000026139  ..............................................................................
ENSBTAP00000046486  ..............................................................................
ENSBTAP00000026263  ..............................................................................
ENSBTAP00000056597  ..............................................................................
ENSBTAP00000046208  ..............................................................................
ENSBTAP00000043818  ..............................................................................
ENSBTAP00000030439  ..............................................................................
ENSBTAP00000053958  ..............................................................................
ENSBTAP00000022955  ..............................................................................
ENSBTAP00000030440  ..............................................................................
ENSBTAP00000054502  ..............................................................................
ENSBTAP00000004298  ..............................................................................
ENSBTAP00000041674  ..............................................................................


                                       160             170          180                             
                                         |               |            |                             
d1xwdc1               ..............SVILWLNKN...GIQE...IHNCAF...NGTQLDELNLSDN.......................
ENSBTAP00000021162  ..............LKMLNLSSN...LLEE...FPAALL...PLAGLEELYLSRN.......................
ENSBTAP00000043657  ..............LGSLMLSHN...ALTH...LPAGVFr..GLKGLVKLYLSSN.......................
ENSBTAP00000055611  ..............LRELRLEGN...RLSQ...LPVALLe..PLHSLEALDLSGN.......................
ENSBTAP00000033782  ..............LKGLDISNN...AIRE...MPTNIG...ELRSLVSLNADNN.......................
ENSBTAP00000011238  ..............LQQLYVSQN...AVER...ISPDAWe..FCQRLSELDLSYN.......................
ENSBTAP00000000533  ..............IRTFAADHN...YLQQ...LPPEIG...SWKNITVLFLHSN.......................
ENSBTAP00000004562  ..............LSYIRIADT...NITT...IPQGL-...-PPSLTELHLDGN.......................
ENSBTAP00000049967  ..............LRELSLHTN...ALQE...LDGSIFr..MLVNLQNISLQNN.......................
ENSBTAP00000050839  ..............LRALDLSRN...PISA...IPARRLs..SLVRLQELRLSGA.......................
ENSBTAP00000003370  ..............LQALTLALN...KISS...IPDFAFt..NLSSLVVLHLHNN.......................
ENSBTAP00000053607  ..............LNSLVLYGN...KITE...LPKSLFe..GLFSLQLLLLNAN.......................
ENSBTAP00000054397  ..............LTHLFLHGN...HIPS...VPERAFr..GLHSLDRLLLHQN.......................
ENSBTAP00000030722  ..............LSILRLSHN...SISH...IAEGAFr..GLKSLRVLDLDHNeisgtiedtsgaftgldslsklt
ENSBTAP00000001560  ..............LESLSFYDN...KLVK...VPQLALq..KVPNLKFLDLNKNpihkiqegdfknmlrlkelginn
ENSBTAP00000010138  ..............ITNLDLQHN...ELLD...LPDTIG...NLSSLSRLGLRYN.......................
ENSBTAP00000023310  ..............LTDLVISQN...LLEM...LPDGIG...KLKKLSILKVDQN.......................
ENSBTAP00000016755  ..............LSHLFLHGN...RLRL...LTEHVFr..GLGSLDRLLLHGN.......................
ENSBTAP00000002883  ..............LQELHLSQN...AISR...ISPDAWe..FCQKLSELDLTYN.......................
ENSBTAP00000043683  ..............LEQLTLEKC...NLTS...IPTEALs..HLHGLIVLRLRHLninairdysfkrlyrlkvleish
ENSBTAP00000010846  ..............LKHLDCNSN...LLET...IPPELA...SMESLELLYLRRN.......................
ENSBTAP00000021903  ..............LTCLNLSHN...PIST...VPRGSFr..DLVRLRELHLAGA.......................
ENSBTAP00000000484  ..............LDFLDLGYN...RLRS...LSRNAFa..GLLKLKELHLEHNqfskinfahfprlfnlrsiylqw
ENSBTAP00000055691  ..............LTHLNLSYN...PIST...IEAGMFs..DLIRLQELHIVGA.......................
ENSBTAP00000040907  ..............LEELELSGN...RLDL...IRPGSFq..GLTSLRKLWLMHA.......................
ENSBTAP00000017631  ..............LQKIDLRHN...EIYE...IQADTFq..QLFSLRSLNLAWN.......................
ENSBTAP00000018866  ..............LEFLDLSTN...RLRS...LARNGFa..GLIKLRELHLEHN.......................
ENSBTAP00000044462  ..............LNELHLDHN...KIQA...IELEDLl..RYSKLYRLGLGHN.......................
ENSBTAP00000006288  ..............LQAVTLALN...RIGR...VPDYAFw..NLSSLVVLHLHNN.......................
ENSBTAP00000056438  ..............LEELEMSGN...HFPE...IRPGSFh..GLGSLKKLWVMNS.......................
ENSBTAP00000047707  ..............LEELEMSGN...HFPE...IRPGSFh..GLGSLKKLWVMNS.......................
ENSBTAP00000028386  ..............VEELKLSHN...PLKS...IPDNAFqs.FGRYLETLWLDNT.......................
ENSBTAP00000050251  ..............ARWLQLSHN...ALSV...LAPEALa..GLPALRRLSLHHNelqalpgaalsqarglarlelgh
ENSBTAP00000009633  ..............LRYLNLAMC...NLRE...IP-NLT...PLIKLDELDLSGNhlsairpgsfqglmhlqklwmiq
ENSBTAP00000005771  ..............LESISFYDN...RLIK...VPNVALq..KAVNLKFLDLNKNpinrirrgdfsnmlhlkelginn
ENSBTAP00000034926  ..............LLELHLDYN...KISV...VELEDFk..RYKDLQRLGLGNN.......................
ENSBTAP00000016317  ..............LSHLFLHGN...KLWS...LGQDTFr..GLVNLDRLLLHEN.......................
ENSBTAP00000021517  ..............LKRLYLNSN...QLDFdg.LPSGIG...KLSSLEEFMAANN.......................
ENSBTAP00000033782  ..............LEKLLLDHN...KLTF...LAVEIF...LLLKMKELQLTDN.......................
ENSBTAP00000053488  ..............LQLVDLSNN...KISS...LSNSSFt..NMSQLTTLILSYN.......................
ENSBTAP00000022459  ..............LELLDLGYN...RIRS...LARNVFa..GMIRLKELHLEHN.......................
ENSBTAP00000044542  ..............LRELVLAGN...KLAY...LQPPLFc..GLGELRELDLSRN.......................
ENSBTAP00000017571  ..............LQVLALSST...GLAS...LPAGLLr..GLCRLRHVSLRSN.......................
ENSBTAP00000055923  ..............LRTLNLGGN...ALGR...VVRAWFa..ELAELELLYLDRN.......................
ENSBTAP00000012294  ..............LRELWMDNN...ALQV...LPGSIG...KLKMLVYLDMSKN.......................
ENSBTAP00000044542  ..............LLELDLTAN...QLTH...LPGRLFq..DLGRLEYLLLARN.......................
ENSBTAP00000017322  ..............LRYLDLSHN...NLTF...LPADIG...LLQSLQNLAVTAN.......................
ENSBTAP00000001045  ..............LRELYLSHN...GIEV...I-EGLD...NNNKLTMLDIASN.......................
ENSBTAP00000016614  ..............LVLLHLEKN...AIRS...VDADVLt..PIRSLEYLLLHSNqlraqgihprafqglkrlhtvhl
ENSBTAP00000028517  ..............LKEFSIVRN...SLSR...PPPDL-...PGTHLVRLYLQDN.......................
ENSBTAP00000027912  ..............LRCLDVSYN...NISM...IPVEIG...LLQNLQHLHITGN.......................
ENSBTAP00000016858  ..............---------...----...------...-------------.......................
ENSBTAP00000017631  ..............LQAMTLALN...KIHH...IPDYAFg..NLSSLVVLHLHNN.......................
ENSBTAP00000023709  ..............LAFIRLNYN...QLSDrg.LPKNSF...NISNLLVLHLSHN.......................
ENSBTAP00000028690  ..............---------...----...------...-------------.......................
ENSBTAP00000055273  ..............LHNLDVADN...QLER...VPPAVR...GLRGLTRLRLAGN.......................
ENSBTAP00000003618  ..............LERLHLEGN...RLQV...LGEGLLa..PQPKLRYLFLNDN.......................
ENSBTAP00000053607  ..............LTLIDLSNN...RIST...LSNQSFs..NMTQLLTLILSYN.......................
ENSBTAP00000004298  ..............LTELSLVRN...SLTA...APVNL-...PGTNLRKLYLQDN.......................
ENSBTAP00000019854  ..............LILLDLSYN...HLRK...VPDGL-...-PSALEQLYLEHN.......................
ENSBTAP00000047764  ..............LILLDLSYN...HLRK...VPDGL-...-PSALEQLYLEHN.......................
ENSBTAP00000011082  ..............LRELWLDRN...QLSA...LPPELG...NLRRLVCLDVSEN.......................
ENSBTAP00000001193  ..............IRYLDLSYN...DIRF...IPPEIG...VLQSLQYFSITCN.......................
ENSBTAP00000020135  ..............LNWMDLEGN...GIKF...LTNSTFl..SCSSLTVLFLPRN.......................
ENSBTAP00000013620  ..............LHWLDFEGN...HIHN...LRNLTFi..SCSNLTVLVMRKN.......................
ENSBTAP00000034140  ..............LEILMIGGN...KVDA...ILDMNFr..PLANLRSLVLAGM.......................
ENSBTAP00000007981  ..............VATLSLSSN...QLSY...VPPSL-...-PPSLERLHLQNN.......................
ENSBTAP00000054502  ..............LTELSLVRN...SLAA...PPLNL-...PSARLQKLYLQDN.......................
ENSBTAP00000015726  ..............LEYLYLSFN...KLVDdg.IDRVSFyg.AYHSLRELFLDHN.......................
ENSBTAP00000053353  ..............LRELLFSHN...QISIld.LSEKAC...AWSRIEKLHLSHN.......................
ENSBTAP00000015704  ..............LMYLSLENN...SISS...IPENYFn..KLPKLHALRISHN.......................
ENSBTAP00000049410  ..............LHTLNLDHN...LIDA...LPPGAFa..QLSQLSRLDLTSN.......................
ENSBTAP00000005636  ..............LRLLDVSHN...GLHS...LPAELG...LLQNLQHLALSYN.......................
ENSBTAP00000011445  ..............LQELLLSNN...KISS...LTPEEFdflGNSSLKRLELSSNqikefspgcfhtlgelsglslnn
ENSBTAP00000024223  ..............LEALDLAGN...QLKA...LSNGSLp..PGIRLQKLDVSSN.......................
ENSBTAP00000048641  ..............LHTLWLQRN...EITC...LPETIS...SMKNLSTLVLSNN.......................
ENSBTAP00000013790  ..............FSLLIMKNL...NVTS...LGFRSL...KEISAGRIYISAN.......................
ENSBTAP00000006460  ..............LKKLSLAEN...DLQE...LPPELLk..GLEELDTLYLQKN.......................
ENSBTAP00000056481  ..............LQYLYLSDN...FLSS...IPQEMVt..YMSDLESLYLHGN.......................
ENSBTAP00000004800  ..............LHTLSLDHN...MIDN...IPKGTFs..HLHKMTRLDVTSN.......................
ENSBTAP00000050251  ..............LLELQLSGN...PLGA...LRDGAFrp.VGRSLQHLFLNSS.......................
ENSBTAP00000040019  ..............LRELHLDDN...SIST...VETFSSy..WLPLLQILTISQN.......................
ENSBTAP00000029890  ..............LETLDLSFN...QLKT...VPERLSn..CSRSLKKLILKNN.......................
ENSBTAP00000002279  ..............LEYLDLSFN...QMTK...LPSGL-...-PVSLLTLYLDNN.......................
ENSBTAP00000012650  ..............LSHLNLKQN...CLVT...LHIREHe..PPGALVELDLSQN.......................
ENSBTAP00000019066  ..............VAFLRLNHN...KLSDag.LPSSGF...NVSSILDLQLSHN.......................
ENSBTAP00000015445  ..............---------...E---...------...-------------.......................
ENSBTAP00000013790  ..............A--------...----...------...-------------.......................
ENSBTAP00000053668  ..............---------...----...------...-------------.......................
ENSBTAP00000056022  ..............LEEIDLSGN...KLKA...VPTTIM...NCRRMHTVTAHSN.......................
ENSBTAP00000003973  ..............---------...----...------...-------------.......................
ENSBTAP00000053245  ..............LTSLELSRN...LLEC...VPDWAC...EAKKIEILDVSYN.......................
ENSBTAP00000000176  ..............VNTLGLDHN...LLAS...VPAGAFs..RLHKLARLDMTSN.......................
ENSBTAP00000008348  ..............LRVLNLSHC...LLDT...SNQHLLa..GLQDLRHLNLQGNsfqdgsisktnllqm........
ENSBTAP00000026919  ..............LSCLKLWHN...NIAY...IPAQIG...ALSNLEQLSLDHN.......................
ENSBTAP00000041110  ..............LEVLHLGYN...GICNl..IQLQLN...RLRNLKFLFLQGN.......................
ENSBTAP00000007883  ..............LSELQLNYN...QLVC...IPKEIK...FLKKLRKLLLSRN.......................
ENSBTAP00000048971  ..............SMTVWLSKN...GIQE...IHNCAF...NGTQLDELNLSDN.......................
ENSBTAP00000054723  ..............LRRLELASN...QLLY...LPHDVLa..HLPGLRHLDLRNN.......................
ENSBTAP00000016858  ..............-----IRGS...RLFFn..YALVIF...EMVHLKELGLYNL.......................
ENSBTAP00000006543  ..............LALLDLSRN...----...------...-------------.......................
ENSBTAP00000007981  ..............LQVLDLSHN...ELSF...VPPDL-...-PEALEELHLQGN.......................
ENSBTAP00000000073  ..............LTSLYLRKMp..RLRS...LEGDIFk..MTPDLQHLDCQHS.......................
ENSBTAP00000011445  ..............LHILNLGSN...GFDE...IPVEAFk..DLRELKSIDLGMN.......................
ENSBTAP00000053488  ..............IQTLHLAQN...PFIC...------...-------------.......................
ENSBTAP00000055429  ..............LDYFRL---...----...------...-------------.......................
ENSBTAP00000029877  ..............LDYFRL---...----...------...-------------.......................
ENSBTAP00000023907  ..............LHQLSLDHN...LLDH...IAEGTFt..DLQKLARLDLTSN.......................
ENSBTAP00000053245  ..............LEELNLSGN...KLKT...IPTTIA...NCKRLHTLVAHSN.......................
ENSBTAP00000039209  ..............LQILSLRDN...DLIS...LPKEIG...ELTQLKELHIQGN.......................
ENSBTAP00000054898  ..............LDYFRL---...----...------...-------------.......................
ENSBTAP00000010138  ..............LQKLVLTNN...QLTT...LPRGIG...HLTNLTHLGLGEN.......................
ENSBTAP00000002052  ..............LMFLKLQGN...QLVA...LPPQEKw..TCRQLKTLDLSRNhfgkne.................
ENSBTAP00000055075  ..............LNTLTLDHN...LIDH...IAEGTFv..QLHKLVRLDMTSN.......................
ENSBTAP00000046486  ..............IQTLHLAQN...PFVC...------...-------------.......................
ENSBTAP00000001716  ..............LERLDLHSN...VLMD...IEDGAFe..ALPRLVHLNLSRN.......................
ENSBTAP00000015445  ..............---------...ALAV...LSNYGA...NKTGLRELPLRN-.......................
ENSBTAP00000048314  ..............LSNLALEQN...LLLS...IPLRL-...-PGTLARLDLKGN.......................
ENSBTAP00000054662  ..............LTHLSINNN...LLTG...LEKHIFd..NMLHLHSLSLENN.......................
ENSBTAP00000016614  ..............LQLLDIAGN...QLTE...IPGGL-...-PESLEYLYLQNN.......................
ENSBTAP00000006288  ..............LEEIGLQHN...RIWE...VRADTFr..ELTFLRSLDLSWN.......................
ENSBTAP00000035220  ..............LHTVDLSNN...SLTQi..LPGTLI...NLTNLTHLYLHNN.......................
ENSBTAP00000044349  ..............LNYLVLCDN...KIQS...VPPQLS...QLHSLRSLSLHNN.......................
ENSBTAP00000018658  ..............IQILDLNSN...KIQT...VPKAIT...HLTSLRELNLAFN.......................
ENSBTAP00000008412  ..............LKELYIENN...HLEY...LPVSLG...SMPNLEILDCHCN.......................
ENSBTAP00000029331  ..............LQLLQVADN...PWE-...------...-------------.......................
ENSBTAP00000043328  ..............SMTVWLSKN...GIQE...IHNCAF...NGTQLDELNLSDN.......................
ENSBTAP00000003445  ..............LSHLQLYHN...PFHC...------...-------------.......................
ENSBTAP00000029056  ..............---------...----...------...-------------.......................
ENSBTAP00000001716  ..............LEVLALQGN...GLAV...LQVDLP...CFSCLKRLNLAEN.......................
ENSBTAP00000037062  ..............LRDLNVRRN...QLST...LPDELG...DLP-LVRLDFSCN.......................
ENSBTAP00000025497  ..............LKTLHAGSN...ALRL...LPGQLQ...RLRELRTIWLSGN.......................
ENSBTAP00000025116  ..............LRDLNVRRN...HLVR...LPEELA...ELP-LIRLDFSCN.......................
ENSBTAP00000041953  ..............LKWLDISNN...NLSD...LPQDID...RLEGLQTFLLYKN.......................
ENSBTAP00000007913  ..............LSHLQINDN...PFDCt..CGIV--...-------------.......................
ENSBTAP00000033684  ..............IVKLDLSHN...KINQ...LRPKEFe..DVHELKKLNLSSN.......................
ENSBTAP00000055758  ..............LRGLWLYGN...RFEE...FPPALL...RMGRLHILDLDRN.......................
ENSBTAP00000023771  ..............LRTLRLDGN...PW--...------...-------------.......................
ENSBTAP00000000700  ..............LQYLTVDRN...RLWC...VPRHLC...QLPSLNELSMAGN.......................
ENSBTAP00000043299  ..............MKRLFLKDN...LWKC...------...-------------.......................
ENSBTAP00000042745  ..............VIELNLNQN...QISQ...ISVKIS...SCPRLKVLRLEEN.......................
ENSBTAP00000045371  ..............LARLNLRNN...KFMY...LPV---...-------------.......................
ENSBTAP00000046486  ..............LSTINLLSN...PFNC...------...-------------.......................
ENSBTAP00000056638  ..............LDFLHVGSN...RLEN...IAESIQ...CLAGLQIFIAEGN.......................
ENSBTAP00000013364  ..............LLRLNLRSN...HFTS...LPVSRVld.QLTSLIQIDLHDN.......................
ENSBTAP00000029056  ..............-Y-------...----...------...-------------.......................
ENSBTAP00000056022  ..............LSYLGLSFN...EFTD...LPEVLQ...KLTAVEKLCMSGN.......................
ENSBTAP00000003973  ..............---------...----...------...-------------.......................
ENSBTAP00000006219  ..............LQTLNLTGN...RLDA...FPAALFlpgALPLLSELAAADN.......................
ENSBTAP00000018722  ..............---------...----...------...-------------.......................
ENSBTAP00000003370  ..............LEEISLQRN...QIHQ...IKEDTFq..GLTSLKILDLSRN.......................
ENSBTAP00000005510  ..............LVTLQIGGN...PW--...------...-------------.......................
ENSBTAP00000023124  ..............---------...----...------...-------------.......................
ENSBTAP00000003856  ..............LVKFDFSCN...KVLV...IPICFR...EMKQLQVLLLENN.......................
ENSBTAP00000002625  ..............---------...----...------...KLAELMFLDVSYN.......................
ENSBTAP00000052577  ..............LKLLFLNNN...LLRT...LPTDAF...AGTSLARLNLRKN.......................
ENSBTAP00000000604  ..............LQLLYLNKN...YLNF...LPPGVFh..HLTALRGLSLKDN.......................
ENSBTAP00000035880  ..............IKVLDLHNN...RIRS...IPKDVT...GLETLQELNLASN.......................
ENSBTAP00000056147  ..............LTHLDLRGN...RLKL...MPF---...-------------.......................
ENSBTAP00000026157  ..............LAELNLASN...RLQS...LPSSLA...GLRALRLFILHSN.......................
ENSBTAP00000020944  ..............IKILCLSNN...QIEK...M-TGLD...DLRVLQILDLSQN.......................
ENSBTAP00000049290  ..............LSKLSLHNN...YFMY...LPV---...-------------.......................
ENSBTAP00000019433  ..............LQSLDLSFN...RISQ...IGLSDFh..NCLQLENLHLKSN.......................
ENSBTAP00000056147  ..............LTRLNLRNN...HFSH...LPV---...-------------.......................
ENSBTAP00000002199  ..............LQTLYLSGN...PWKC...------...-------------.......................
ENSBTAP00000054101  ..............---------...----...------...-------------.......................
ENSBTAP00000008348  ..............LKVLDFQNN...AIHY...ISRKDTn..SLEQATNLSLNFNgndikgiepgafsskifqslkfg
ENSBTAP00000009238  ..............---------...----...------...-------------.......................
ENSBTAP00000006107  ..............---------...----...------...-------------.......................
ENSBTAP00000005757  ..............LTRINLKTN...QFTH...LPV---...-------------.......................
ENSBTAP00000049290  ..............ITHLDLRGN...RLKT...LPY---...-------------.......................
ENSBTAP00000013364  ..............LTHLDLRGN...RLKL...LPY---...-------------.......................
ENSBTAP00000025189  ..............---------...----...------...-------------.......................
ENSBTAP00000021183  ..............LEELWISYN...FIEK...L-KGIH...VMKKLKILYMSNN.......................
ENSBTAP00000014533  ..............LTELNLRHN...QITF...VR-DVD...NLPCLQRLFLSFN.......................
ENSBTAP00000056496  ..............LSVCELYSN...PFYC...S-----...-------------.......................
ENSBTAP00000045371  ..............---------...----...----IF...RFASLTHLDIRGN.......................
ENSBTAP00000014977  ..............LTTLHLRDN...QIET...LSGFSK...EMKSLQYLNLRGN.......................
ENSBTAP00000005757  ..............LTHLDLRGN...QLQT...LPYVGFle.HIGRILDLQLEDN.......................
ENSBTAP00000056192  ..............LNTLRLRGN...PWT-...------...-------------.......................
ENSBTAP00000009548  ..............LMVCELAGN...PFNC...ECDL--...-------------.......................
ENSBTAP00000052577  ..............LTHLDLRGN...RLKV...------...-------------.......................
ENSBTAP00000011591  ..............LRTLSLSGN...PVAEdedYKMFICa..YLPDLVYLDFRR-.......................
ENSBTAP00000012486  ..............---------...TL--...------...-------------.......................
ENSBTAP00000022047  ..............SITLKLYGN...GFEE...IQSHAF...NGTTLISLELKEN.......................
ENSBTAP00000017907  ..............LAILSLAEN...EIRD...LNEVSFla.SLTELEQLSIMNN.......................
ENSBTAP00000048314  ..............LQSLMLDAN...NIEN...V-EGPL...ALPHLKHLSMENN.......................
ENSBTAP00000006996  ..............IKILNLSNN...ELNSm..WELNKM...KGLKLEELWLRGN.......................
ENSBTAP00000053866  ..............LTSLILAEN...PVVT...LPHYLQf..TIFHLRSL-----.......................
ENSBTAP00000010504  ..............LRALHLQNN...NIME...MHEDTFc..NVKNLTYIR----.......................
ENSBTAP00000007874  ..............LHEVGLHDN...LLSN...IPNSIS...KLPKLKKLNTKRN.......................
ENSBTAP00000010530  strihsltqclpqtLEILDVSNN...NLDS...F---SL...ILPQLKELYISRN.......................
ENSBTAP00000024223  ..............---------...ALEV...APGALL...GLGNLTHLSLKYN.......................
ENSBTAP00000006480  ..............LEYLDLFGN...TFE-...------...-------------.......................
ENSBTAP00000017067  ..............LQTLNVKDN...RLKE...LPDTLG...ELRSLRTLDISEN.......................
ENSBTAP00000032951  ..............---------...----...------...-------------.......................
ENSBTAP00000052860  ..............TLTLKLYNN...GFTS...IQGHAF...NGTKLDAVYLNKN.......................
ENSBTAP00000004335  ..............LRYIDLHSN...CIDS...IHHLLQctvGLHFLTNLILEKNgednpvchlpgyra.........
ENSBTAP00000006011  ..............---------...----...------...-------------.......................
ENSBTAP00000016410  ..............---------...----...-RENVFk..LLPQLTYL-----.......................
ENSBTAP00000018286  ..............LRSLHLQNN...MIET...MQRDAFc..D------------.......................
ENSBTAP00000018076  ..............---------...----...------...-------------.......................
ENSBTAP00000045522  ..............LKELFLMGN...PC--...------...-------------.......................
ENSBTAP00000046486  ..............---------...----...------...-------------.......................
ENSBTAP00000031247  ..............LTFLDLSSN...QLLR...LPQELLa..TWIHLHT------.......................
ENSBTAP00000024223  ..............-AHLHLA--...----...---SSFg..SLVSLEKLDMHGIff.....................
ENSBTAP00000028486  ..............---------...----...-RE---...-------------.......................
ENSBTAP00000022049  ..............SITLKLYGN...GFEE...IQSHAF...NGTTLISLELKEN.......................
ENSBTAP00000053639  ..............---------...----...------...QLFHLEFIILYGN.......................
ENSBTAP00000011082  ..............LSVLSLRDN...RLAV...LPPELA...HTAELHVLDVAGN.......................
ENSBTAP00000055544  ..............LEELDISYN...SIAF...IPNDIQ...KLRSLEKLMVDGN.......................
ENSBTAP00000056065  ..............LEELDISYN...SIAF...IPNDIQ...KLRSLEKLMVDGN.......................
ENSBTAP00000021280  ..............LEELDISYN...SIAF...IPNDIQ...KLRSLEKLMVDGN.......................
ENSBTAP00000000604  ..............LKSIDFSFN...KIPI...VCEQEFkplQGKTLSFLSLADN.......................
ENSBTAP00000002392  ..............LLILNLTGN...SCTN...Q-----...-------------.......................
ENSBTAP00000026102  ..............---------...----...------...-------------.......................
ENSBTAP00000053488  ..............---------...----...------...-------------.......................
ENSBTAP00000054460  ..............---------...CVED...LGQLRYlq.LCPQLATLTLEGN.......................
ENSBTAP00000015694  ..............LRVIHLQFN...NITS...ITDDTF...CKA----------.......................
ENSBTAP00000007978  ..............---------...----...------...-------------.......................
ENSBTAP00000049967  ..............LTKLNLGKN...SLTH...L-----...-------------.......................
ENSBTAP00000055245  ..............LRVIHLQFN...NITS...ITDDTF...CKA----------.......................
ENSBTAP00000044315  ..............---------...----...------...-------------.......................
ENSBTAP00000017571  ..............LKLLDLSGN...NLTH...LPEGLFg..VQV----------.......................
ENSBTAP00000008412  ..............LELLGLAGN...HLKS...LPKEIV...NQTKLREIHLKHN.......................
ENSBTAP00000022237  ..............---------...----...------...-------------.......................
ENSBTAP00000023088  ..............LVYLDLSSN...KIRS...LPAELG...NMVSLRELHLNNN.......................
ENSBTAP00000024242  ..............LDTLVLANN...HLNAie.EPDDSLar.LFPNLRSISLHKS.......................
ENSBTAP00000014881  ..............LNQLIAADN...QLLH...VKDLEFllnKLMKLWKMDLNRN.......................
ENSBTAP00000002011  ..............---------...----...------...--PTIQSLNLAWN.......................
ENSBTAP00000044218  ..............LNQLIAADN...QLLH...VKDLEFllnKLMKLWKMDLNRN.......................
ENSBTAP00000053049  ..............---------...----...------...-------------.......................
ENSBTAP00000053271  ..............LETLMLDDN...KLSN...PNCFVSla.GLKRLKKLSLDQNrifripylqqvqlrdgsgdwvgg
ENSBTAP00000055995  ..............LVSLDLSFN...NLTD...LQNMVAglqTLKHLRLLLLQGN.......................
ENSBTAP00000005490  ..............LVSLDLSFN...NLTD...LQNMVAglqTLKHLRLLLLQGN.......................
ENSBTAP00000055569  ..............LVSLDLSFN...NLTD...LQNMVAglqTLKHLRLLLLQGN.......................
ENSBTAP00000023769  ..............---------...----...------...-------------.......................
ENSBTAP00000054129  ..............LKYLDMGTTqv.SLTT...IESILM...MTLELEKLILP--.......................
ENSBTAP00000023886  ..............---------...----...------...-------------.......................
ENSBTAP00000004849  ..............LKYLDMGTTqv.SLTT...IESILM...MTLELEKLILP--.......................
ENSBTAP00000041497  ..............LERLRLRD-...----...------...-------------.......................
ENSBTAP00000003980  ..............LQELVLSGN...PLHC...------...-------------.......................
ENSBTAP00000015158  ..............LESLNLYYN...RISS...LAEVFRlh.SLAGLLDVDLRLN.......................
ENSBTAP00000002402  ..............LKELDLRLN...PVV-...------...-------------.......................
ENSBTAP00000056550  ..............---------...----...------...-------------.......................
ENSBTAP00000027480  ..............---------...----...------...------ALDVSHN.......................
ENSBTAP00000007444  ..............---------...----...------...-------------.......................
ENSBTAP00000025849  ..............LKLLYLHDN...GFAK...LKNLCMls.ACPSLIALTMFDC.......................
ENSBTAP00000000533  ..............---------...----...------...-------------.......................
ENSBTAP00000045403  ..............LHGLLLGRKvmtNLDS...IFKSME...GKKELKNLTLYQN.......................
ENSBTAP00000045610  ..............---------...----...------...-------------.......................
ENSBTAP00000014097  ..............LSELILVGN...PFTC...------...-------------.......................
ENSBTAP00000021517  ..............LRAIVARAN...SLKNsg.VPDDIF...KLDDLSVLDLSYN.......................
ENSBTAP00000053704  ..............LSELILVGN...PFTC...------...-------------.......................
ENSBTAP00000042391  ..............IQHLSLADN...HIET...LTGLSSl..RCTPLESLILKRN.......................
ENSBTAP00000002883  ..............---------...----...------...-------------.......................
ENSBTAP00000019525  ..............---------...----...------...-------------.......................
ENSBTAP00000006728  ..............---------...----...------...-------------.......................
ENSBTAP00000030722  ..............---------...----...------...-------------.......................
ENSBTAP00000026919  ..............---------...----...------...-------------.......................
ENSBTAP00000049498  ..............---------...----...------...-------------.......................
ENSBTAP00000026139  ..............---------...----...------...-LDELRLLGLAGN.......................
ENSBTAP00000046486  ..............---------...----...------...-------------.......................
ENSBTAP00000026263  ..............------TWN...RRNG...MPASLH...IHPELSSLDQSNK.......................
ENSBTAP00000056597  ..............----NLSSN...RLTT...LSWQLF...QTLSLRELRLEQN.......................
ENSBTAP00000046208  ..............MENLNLSNT...----...------...-------------.......................
ENSBTAP00000043818  ..............---------...----...------...IASNTENLNLSN-.......................
ENSBTAP00000030439  ..............FSSLDLSNNkpyLLNG...LSTIMG...NASNTQNLNISNT.......................
ENSBTAP00000053958  ..............---------...----...------...-------------.......................
ENSBTAP00000022955  ..............---------...----...------...-------------.......................
ENSBTAP00000030440  ..............TKNLNLSN-...----...------...-------------.......................
ENSBTAP00000054502  ..............---------...----...------...-------------.......................
ENSBTAP00000004298  ..............---------...----...------...-------------.......................
ENSBTAP00000041674  ..............---------...----...------...-------------.......................


                                                                                               190  
                                                                                                 |  
d1xwdc1               ........................................................................NNLEEL
ENSBTAP00000021162  ........................................................................-QLTSV
ENSBTAP00000043657  ........................................................................-NLTVL
ENSBTAP00000055611  ........................................................................-ELSTL
ENSBTAP00000033782  ........................................................................-QIRYL
ENSBTAP00000011238  ........................................................................-QLTRL
ENSBTAP00000000533  ........................................................................-KLETL
ENSBTAP00000004562  ........................................................................-KITKV
ENSBTAP00000049967  ........................................................................-RLRQL
ENSBTAP00000050839  ........................................................................-CLTSI
ENSBTAP00000003370  ........................................................................-KIKSL
ENSBTAP00000053607  ........................................................................-KINCL
ENSBTAP00000054397  ........................................................................-RVARV
ENSBTAP00000030722  .....................................................................lfgNKIKSV
ENSBTAP00000001560  ..............................................mgelvsvdryaldnlpeltkleatnnPKLSYI
ENSBTAP00000010138  ........................................................................-RLSAI
ENSBTAP00000023310  ........................................................................-RLTQL
ENSBTAP00000016755  ........................................................................-RLQGV
ENSBTAP00000002883  ........................................................................-HLSRL
ENSBTAP00000043683  wpyldtmtpnclyglnltslsithcnltavpylavrhlvylrflnlsynpistiegsmlhellrlqeiqlvgGQLAVV
ENSBTAP00000010846  ........................................................................-KLRFL
ENSBTAP00000021903  ........................................................................-LLAVV
ENSBTAP00000000484  ........................................................................NRIRSI
ENSBTAP00000055691  ........................................................................-QLRTI
ENSBTAP00000040907  ........................................................................-QVATI
ENSBTAP00000017631  ........................................................................-KIAII
ENSBTAP00000018866  ........................................................................-QLTKI
ENSBTAP00000044462  ........................................................................-QIRMI
ENSBTAP00000006288  ........................................................................-RIRHL
ENSBTAP00000056438  ........................................................................-QVSLI
ENSBTAP00000047707  ........................................................................-QVSLI
ENSBTAP00000028386  ........................................................................-NLEKF
ENSBTAP00000050251  ................................................npftytgeedglalpglrelrldhGALQAL
ENSBTAP00000009633  ........................................................................SQIQVI
ENSBTAP00000005771  ..............................................mpelisidslavdnlpdlrkieatnnPRLSYI
ENSBTAP00000034926  ........................................................................-RITDI
ENSBTAP00000016317  ........................................................................-QLQWV
ENSBTAP00000021517  ........................................................................-KLELI
ENSBTAP00000033782  ........................................................................-KLEVI
ENSBTAP00000053488  ........................................................................-SLQCI
ENSBTAP00000022459  ........................................................................-QFSKL
ENSBTAP00000044542  ........................................................................-TLRSV
ENSBTAP00000017571  ........................................................................-RLRAL
ENSBTAP00000055923  ........................................................................-RIAFV
ENSBTAP00000012294  ........................................................................-RIETV
ENSBTAP00000044542  ........................................................................-RLSAL
ENSBTAP00000017322  ........................................................................-RIEAL
ENSBTAP00000001045  ........................................................................-RIKKI
ENSBTAP00000016614  .................................................ynnalervpsglprrvrtlmilhNQITGV
ENSBTAP00000028517  ........................................................................-QINHI
ENSBTAP00000027912  ........................................................................-KVDVL
ENSBTAP00000016858  ........................................................................------
ENSBTAP00000017631  ........................................................................-RIHSL
ENSBTAP00000023709  ........................................................................-RISSV
ENSBTAP00000028690  ........................................................................------
ENSBTAP00000055273  ........................................................................TRIAQL
ENSBTAP00000003618  ........................................................................-RLASV
ENSBTAP00000053607  ........................................................................-RLRCI
ENSBTAP00000004298  ........................................................................-HINRV
ENSBTAP00000019854  ........................................................................-NVFSV
ENSBTAP00000047764  ........................................................................-NVFSV
ENSBTAP00000011082  ........................................................................-RLEEL
ENSBTAP00000001193  ........................................................................-KVESL
ENSBTAP00000020135  ........................................................................-QIGFV
ENSBTAP00000013620  ........................................................................-KINHL
ENSBTAP00000034140  ........................................................................-NLREI
ENSBTAP00000007981  ........................................................................-LISKV
ENSBTAP00000054502  ........................................................................-AISHV
ENSBTAP00000015726  ........................................................................-ELKSI
ENSBTAP00000053353  ........................................................................-KLKEI
ENSBTAP00000015704  ........................................................................-KLQDI
ENSBTAP00000049410  ........................................................................------
ENSBTAP00000005636  ........................................................................-ALEFL
ENSBTAP00000011445  .............................................aklspslteklclelsntsienlslssNQLDTI
ENSBTAP00000024223  ........................................................................-SIGFV
ENSBTAP00000048641  ........................................................................-KLQDI
ENSBTAP00000013790  ........................................................................RQLCYH
ENSBTAP00000006460  ........................................................................-RLRTI
ENSBTAP00000056481  ........................................................................PWIC--
ENSBTAP00000004800  ........................................................................-KLQKL
ENSBTAP00000050251  ........................................................................-GLEQI
ENSBTAP00000040019  ........................................................................-SLTKI
ENSBTAP00000029890  ........................................................................-QIRCL
ENSBTAP00000002279  ........................................................................-KISNI
ENSBTAP00000012650  ........................................................................-QLSEL
ENSBTAP00000019066  ........................................................................-QLTKV
ENSBTAP00000015445  ........................................................................------
ENSBTAP00000013790  ........................................................................------
ENSBTAP00000053668  ........................................................................------
ENSBTAP00000056022  ........................................................................-CIEVF
ENSBTAP00000003973  ........................................................................------
ENSBTAP00000053245  ........................................................................-LLTEV
ENSBTAP00000000176  ........................................................................-RLTTI
ENSBTAP00000008348  ........................................................................V-----
ENSBTAP00000026919  ........................................................................-NIENL
ENSBTAP00000041110  ........................................................................-EISQI
ENSBTAP00000007883  ........................................................................-NIKSL
ENSBTAP00000048971  ........................................................................SNLEEL
ENSBTAP00000054723  ........................................................................-SLVGL
ENSBTAP00000016858  ........................................................................MNITR-
ENSBTAP00000006543  ........................................................................------
ENSBTAP00000007981  ........................................................................-RIGHV
ENSBTAP00000000073  ........................................................................PALSSV
ENSBTAP00000011445  ........................................................................-NLNIL
ENSBTAP00000053488  ........................................................................------
ENSBTAP00000055429  ........................................................................------
ENSBTAP00000029877  ........................................................................------
ENSBTAP00000023907  ........................................................................-RLQKL
ENSBTAP00000053245  ........................................................................-HISIF
ENSBTAP00000039209  ........................................................................-RLTVL
ENSBTAP00000054898  ........................................................................------
ENSBTAP00000010138  ........................................................................-LLTHL
ENSBTAP00000002052  ........................................................................D-----
ENSBTAP00000055075  ........................................................................-RLHKL
ENSBTAP00000046486  ........................................................................------
ENSBTAP00000001716  ........................................................................-SLTCI
ENSBTAP00000015445  ........................................................................------
ENSBTAP00000048314  ........................................................................-AIQDI
ENSBTAP00000054662  ........................................................................-RITSL
ENSBTAP00000016614  ........................................................................-KISAV
ENSBTAP00000006288  ........................................................................-AIRSI
ENSBTAP00000035220  ........................................................................-KFTFI
ENSBTAP00000044349  ........................................................................-LLTYL
ENSBTAP00000018658  ........................................................................-FLTDL
ENSBTAP00000008412  ........................................................................-LIKQL
ENSBTAP00000029331  ........................................................................------
ENSBTAP00000043328  ........................................................................SNLEEL
ENSBTAP00000003445  ........................................................................------
ENSBTAP00000029056  ........................................................................------
ENSBTAP00000001716  ........................................................................-RLSRL
ENSBTAP00000037062  ........................................................................-RVSRI
ENSBTAP00000025497  ........................................................................-LLTDF
ENSBTAP00000025116  ........................................................................-KITTI
ENSBTAP00000041953  ........................................................................-KLTYL
ENSBTAP00000007913  ........................................................................------
ENSBTAP00000033684  ........................................................................-GIQFI
ENSBTAP00000055758  ........................................................................-RLGGF
ENSBTAP00000023771  ........................................................................------
ENSBTAP00000000700  ........................................................................-RLAFL
ENSBTAP00000043299  ........................................................................------
ENSBTAP00000042745  ........................................................................C-----
ENSBTAP00000045371  ........................................................................------
ENSBTAP00000046486  ........................................................................------
ENSBTAP00000056638  ........................................................................-HIHTF
ENSBTAP00000013364  ........................................................................------
ENSBTAP00000029056  ........................................................................------
ENSBTAP00000056022  ........................................................................-CVGTL
ENSBTAP00000003973  ........................................................................------
ENSBTAP00000006219  ........................................................................-CLREL
ENSBTAP00000018722  ........................................................................------
ENSBTAP00000003370  ........................................................................-LIHEI
ENSBTAP00000005510  ........................................................................------
ENSBTAP00000023124  ........................................................................------
ENSBTAP00000003856  ........................................................................-PLQSP
ENSBTAP00000002625  ........................................................................-RISSL
ENSBTAP00000052577  ........................................................................-YFLYL
ENSBTAP00000000604  ........................................................................-RLTVL
ENSBTAP00000035880  ........................................................................-SLAHL
ENSBTAP00000056147  ........................................................................------
ENSBTAP00000026157  ........................................................................-LLASV
ENSBTAP00000020944  ........................................................................-QISSL
ENSBTAP00000049290  ........................................................................------
ENSBTAP00000019433  ........................................................................-RIFRI
ENSBTAP00000056147  ........................................................................------
ENSBTAP00000002199  ........................................................................------
ENSBTAP00000054101  ........................................................................------
ENSBTAP00000008348  ...................gslnlfiifkglqnstlqslwlgtfedtddqyltsatfeglcdmsvesinlqkHRFSDL
ENSBTAP00000009238  ........................................................................------
ENSBTAP00000006107  ........................................................................------
ENSBTAP00000005757  ........................................................................------
ENSBTAP00000049290  ........................................................................------
ENSBTAP00000013364  ........................................................................------
ENSBTAP00000025189  ........................................................................------
ENSBTAP00000021183  ........................................................................LVKDWA
ENSBTAP00000014533  ........................................................................------
ENSBTAP00000056496  ........................................................................------
ENSBTAP00000045371  ........................................................................-RIQKL
ENSBTAP00000014977  ........................................................................-MVADL
ENSBTAP00000005757  ........................................................................------
ENSBTAP00000056192  ........................................................................------
ENSBTAP00000009548  ........................................................................------
ENSBTAP00000052577  ........................................................................------
ENSBTAP00000011591  ........................................................................------
ENSBTAP00000012486  ........................................................................------
ENSBTAP00000022047  ........................................................................ARLEKM
ENSBTAP00000017907  ........................................................................PCVMAT
ENSBTAP00000048314  ........................................................................-KLHLI
ENSBTAP00000006996  ........................................................................PLCNRF
ENSBTAP00000053866  ........................................................................------
ENSBTAP00000010504  ........................................................................------
ENSBTAP00000007874  ........................................................................PFPKAE
ENSBTAP00000010530  ........................................................................-KLKTL
ENSBTAP00000024223  ........................................................................-NLTEV
ENSBTAP00000006480  ........................................................................------
ENSBTAP00000017067  ........................................................................-EIQRL
ENSBTAP00000032951  ........................................................................-YQKHR
ENSBTAP00000052860  ........................................................................KYLTVI
ENSBTAP00000004335  ........................................................................V-----
ENSBTAP00000006011  ........................................................................------
ENSBTAP00000016410  ........................................................................------
ENSBTAP00000018286  ........................................................................------
ENSBTAP00000018076  ........................................................................------
ENSBTAP00000045522  ........................................................................------
ENSBTAP00000046486  ........................................................................------
ENSBTAP00000031247  ........................................................................------
ENSBTAP00000024223  ........................................................................RSLTNI
ENSBTAP00000028486  ........................................................................------
ENSBTAP00000022049  ........................................................................ARLEKM
ENSBTAP00000053639  ........................................................................PWNCSC
ENSBTAP00000011082  ........................................................................-RLQSL
ENSBTAP00000055544  ........................................................................-ELTSF
ENSBTAP00000056065  ........................................................................-ELTSF
ENSBTAP00000021280  ........................................................................-ELTSF
ENSBTAP00000000604  ........................................................................QLYSRV
ENSBTAP00000002392  ........................................................................------
ENSBTAP00000026102  ........................................................................------
ENSBTAP00000053488  ........................................................................------
ENSBTAP00000054460  ........................................................................P-----
ENSBTAP00000015694  ........................................................................------
ENSBTAP00000007978  ........................................................................------
ENSBTAP00000049967  ........................................................................------
ENSBTAP00000055245  ........................................................................------
ENSBTAP00000044315  ........................................................................------
ENSBTAP00000017571  ........................................................................------
ENSBTAP00000008412  ........................................................................------
ENSBTAP00000022237  ........................................................................------
ENSBTAP00000023088  ........................................................................-LLRVL
ENSBTAP00000024242  ........................................................................GLQSWE
ENSBTAP00000014881  ........................................................................------
ENSBTAP00000002011  ........................................................................-RLRAV
ENSBTAP00000044218  ........................................................................------
ENSBTAP00000053049  ........................................................................------
ENSBTAP00000053271  ..rgsprkqpqsmlqskswiyeasddqpdytilpmkkdvdrtevvfssypgfstsettkvcalppifeilpvKSLKAR
ENSBTAP00000055995  ........................................................................-PLALV
ENSBTAP00000005490  ........................................................................-PLALV
ENSBTAP00000055569  ........................................................................-PLALV
ENSBTAP00000023769  ........................................................................------
ENSBTAP00000054129  ........................................................................------
ENSBTAP00000023886  ........................................................................------
ENSBTAP00000004849  ........................................................................------
ENSBTAP00000041497  ........................................................................------
ENSBTAP00000003980  ........................................................................------
ENSBTAP00000015158  ........................................................................PVVKSE
ENSBTAP00000002402  ........................................................................------
ENSBTAP00000056550  ........................................................................------
ENSBTAP00000027480  ........................................................................-LLQAL
ENSBTAP00000007444  ........................................................................------
ENSBTAP00000025849  ........................................................................------
ENSBTAP00000000533  ........................................................................------
ENSBTAP00000045403  ........................................................................------
ENSBTAP00000045610  ........................................................................------
ENSBTAP00000014097  ........................................................................------
ENSBTAP00000021517  ........................................................................-QLTE-
ENSBTAP00000053704  ........................................................................------
ENSBTAP00000042391  ........................................................................------
ENSBTAP00000002883  ........................................................................------
ENSBTAP00000019525  ........................................................................------
ENSBTAP00000006728  ........................................................................------
ENSBTAP00000030722  ........................................................................------
ENSBTAP00000026919  ........................................................................------
ENSBTAP00000049498  ........................................................................------
ENSBTAP00000026139  ........................................................................-ALSRL
ENSBTAP00000046486  ........................................................................------
ENSBTAP00000026263  ........................................................................KPYMVH
ENSBTAP00000056597  ........................................................................------
ENSBTAP00000046208  ........................................................................------
ENSBTAP00000043818  ........................................................................------
ENSBTAP00000030439  ........................................................................------
ENSBTAP00000053958  ........................................................................------
ENSBTAP00000022955  ........................................................................------
ENSBTAP00000030440  ........................................................................------
ENSBTAP00000054502  ........................................................................------
ENSBTAP00000004298  ........................................................................------
ENSBTAP00000041674  ........................................................................------


                               200            210                            220                230 
                                 |              |                              |                  | 
d1xwdc1               PN..D.V.FHGA.....SGPVILDISRT..RIH..SLP...............S..YGLENL.......KKLRA..--
ENSBTAP00000021162  PC..L.-.ISGL.....GRLLTLWLDNN..RIR..YL-...............P..DSIVEL.......TGLEE..LV
ENSBTAP00000043657  HP..A.L.FQNL.....SKLELLSLSRN..LLT..TLP...............E..GIFDTN.......DNLFN..LA
ENSBTAP00000055611  HP..T.V.FGRL.....GRLRELSLRDN..ALS..ALS...............G..DIFAAS.......PALYR..LD
ENSBTAP00000033782  PS..S.-.FLSL.....NALQQLNLSGN..NLS..VL-...............P..SGIYNL.......FSLKE..IN
ENSBTAP00000011238  DE..S.A.FVGL.....SLLERLNLGDN..RVT..HIA...............D..GVFRFL.......SNLQT..LN
ENSBTAP00000000533  PE..E.-.MGDM.....QKLKVINLSDN..RLK..NL-...............P..FSFTKL.......QQLTA..MW
ENSBTAP00000004562  DA..A.S.LKGL.....NNLAKLGLSFN..SIS..AVD...............N..GSLANT.......PHLRE..LH
ENSBTAP00000049967  PG..N.L.FANV.....NNLLTIQLQNN..QLE..NLP...............L..GIFDHL.......GKLCE..LR
ENSBTAP00000050839  AA..H.A.FHGL.....TAFHLLDVADN..ALQ..TLE...............E..TAFPSP.......DKLVT..LR
ENSBTAP00000003370  GQ..H.C.FDGL.....DNLETLDLNYN..NLG..EF-...............P..QAIKAL.......PSLKE..LL
ENSBTAP00000053607  RV..D.A.FQDL.....HNLNLLSLYDN..KLQ..TIA...............K..GTFSPL.......RAIQT..MH
ENSBTAP00000054397  HP..H.A.FRDL.....GRLMTLYLFAN..NLS..ALS...............A..EALAPL.......RSLQY..LR
ENSBTAP00000030722  AK..R.A.FSGL.....EGLEHLNLGEN..AIR..SVQ...............F..DAFVKM.......KNLKE..LH
ENSBTAP00000001560  HR..L.A.FRSV.....PALESLMLNNN..ALN..AVY...............Q..KTVESL.......PNLRE..IS
ENSBTAP00000010138  PR..S.-.LAKC.....SALEELNLENN..NIS..TLP...............E..SLLSSL.......VKLNS..LT
ENSBTAP00000023310  PE..A.-.VGDC.....ESLTELVLTEN..RLL..TL-...............P..KSIGKL.......KKLSN..LN
ENSBTAP00000016755  HR..A.A.FRGL.....GRLTILYLFNN..SLA..SLP...............G..EALADL.......PSLEF..LR
ENSBTAP00000002883  DD..S.S.FLGL.....SLLNTLHIGNN..RVN..YIA...............D..CAFRGL.......SSLKT..LD
ENSBTAP00000043683  EP..Y.A.FRGL.....NYLRVLNVSGN..QLT..TLE...............E..SAFHSV.......GNLET..LI
ENSBTAP00000010846  PE..-.-.FPSC.....KLLKELHVGEN..QIE..MLG...............A..EHLKHL.......NSILV..LD
ENSBTAP00000021903  EP..Q.A.FLGL.....RQIRLLNLSNN..LLS..TLE...............E..STFHSV.......NTLET..LR
ENSBTAP00000000484  SQ..G.L.TWTW.....SSLHNLDLSGN..DIQ..GIE...............P..GTFKCL.......PNLQK..LN
ENSBTAP00000055691  EP..H.S.FQGL.....RFLRVLNVSQN..LLE..TLE...............E..NVFSSP.......RALEV..LS
ENSBTAP00000040907  ER..N.A.FDDL.....KSLEELNLSHN..NLM..SLP...............H..DLFTPL.......HRLER..VH
ENSBTAP00000017631  DP..N.A.FSTL.....PSLRKLDLSSN..RLS..SIP...............V..TGLHGL.......THLK-..--
ENSBTAP00000018866  NF..A.H.FLRL.....SSLHTLFLQWN..KIS..NLT...............C..GMEWTW.......GTLEK..LD
ENSBTAP00000044462  EN..G.S.LSFL.....PTLRELHLDNN..KLS..RV-...............P..AGLPDL.......KLLQV..VY
ENSBTAP00000006288  GA..H.S.FEGL.....QNLETLDLNCN..QLH..EF-...............P..VAIQTL.......GRLQE..LG
ENSBTAP00000056438  ER..N.A.FDGL.....ASLVELNLAHN..NLS..SLP...............H..DLFTPL.......RYLVE..LH
ENSBTAP00000047707  ER..N.A.FDGL.....ASLVELNLAHN..NLS..SLP...............H..DLFTPL.......RYLVE..LH
ENSBTAP00000028386  SD..G.A.FLGV.....TTLKHVHLENN..RLH..QLP...............-..-SNFPF.......DSLET..LT
ENSBTAP00000050251  DA..R.A.FARC.....PRLHTLDLRGN..QLD..ALP...............P..--LQGP.......GQLRR..LR
ENSBTAP00000009633  ER..N.A.FDNL.....QSLVEINLAHN..NLT..LLP...............H..DLFTPL.......HHLER..IH
ENSBTAP00000005771  HP..N.A.FFRL.....PKLESLMLNSN..ALS..ALY...............Q..GTVESL.......PNLKE..IS
ENSBTAP00000034926  EN..G.S.LANI.....PRVREIHLENN..KLK..KV-...............P..SGLQEL.......KYLQI..IF
ENSBTAP00000016317  HH..K.A.FHDL.....RRLTTLFLFNN..SLS..ELP...............G..DCLAPL.......GALEF..LR
ENSBTAP00000021517  PE..S.-.LCRC.....TKLRKLVLNKN..RLV..TL-...............P..EAIHFL.......TEIEV..LD
ENSBTAP00000033782  SN..K.-.IENF.....KELRILILDKN..LLK..DM-...............P..ENISHC.......AVLEC..LS
ENSBTAP00000053488  PP..L.A.FQGL.....RSLRLLSLHGN..DIS..TLQ...............E..GIFADV.......TSLSH..LA
ENSBTAP00000022459  NL..A.L.FPRL.....VSLQNLYLQWN..KIS..VIG...............Q..TMSWTW.......SSLQR..LD
ENSBTAP00000044542  KA..N.V.FVKL.....PKLQKLYLDHN..LVA..AVA...............P..GAFLGM.......KALRW..LD
ENSBTAP00000017571  PS..A.L.FRNL.....SSLEEVQLDHN..QLE..TLP...............G..DAFEAL.......PRLAG..VL
ENSBTAP00000055923  EE..G.A.FQNL.....SGLLALHLNGN..HLT..VLA...............W..AAFQPG.......FFLGR..LF
ENSBTAP00000012294  DM..D.-.ISGC.....EALEDLLLSSN..MLQ..QL-...............P..DSIGLL.......KKLTT..LK
ENSBTAP00000044542  PA..D.A.LGPL.....QRTFWLDVSHN..RLE..ALP...............A..AALAPL.......SRLRF..LS
ENSBTAP00000017322  PP..E.-.LFQC.....RKLRALHLGNN..VLQ..SL-...............P..SRVGEL.......TSLTQ..IE
ENSBTAP00000001045  EN..-.-.VSHL.....TELQEFWMNDN..LLD..CWS...............Dl.DELKGA.......RSLET..VY
ENSBTAP00000016614  GR..D.D.FATT.....YHLEELNLSYN..RIT..SPR...............VhrDAFRKL.......RLLRS..LD
ENSBTAP00000028517  PL..T.A.FSNL.....RKLERLDISNN..QLR..MLT...............Q..GVFDNL.......SNLKQ..LT
ENSBTAP00000027912  PK..Q.-.LFKC.....VKMRTLNLGQN..CIT..SL-...............P..EKIGQL.......SQLTQ..LE
ENSBTAP00000016858  --..-.-.----.....-----------..---..---...............-..------.......-----..--
ENSBTAP00000017631  GK..K.C.FDGL.....HSLETLDLNYN..NLD..E--...............-..------.......-----..--
ENSBTAP00000023709  PA..I.-.---S.....SRLEHLYLNNN..SIE..KINgtqicpnnivafhdfS..SDLEHV.......PHLRY..LR
ENSBTAP00000028690  --..-.-.----.....-----------..---..---...............-..------.......-----..--
ENSBTAP00000055273  WL..E.D.LAGL.....AALQELDLSNL..SLQ..ALP...............H..ELSTLF.......PRLRL..LE
ENSBTAP00000003618  AA..G.A.FRGL.....QKLDMLDLSNN..LLT..TVP...............T..GLWTSLgkaa...RNLKDg.FD
ENSBTAP00000053607  PP..R.T.FDGL.....KSLRLLSLHGN..DIS..VVP...............E..GAFNDL.......AALSH..LA
ENSBTAP00000004298  PP..N.A.FSYL.....RQLYRLDMSNN..NLS..NLP...............Q..GIFDDL.......DNITQ..LI